BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF012M20

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004171648.1|  PREDICTED: serine/threonine-protein phosphat...    150   3e-42   
gb|EYU44112.1|  hypothetical protein MIMGU_mgv1a025841mg                147   9e-41   Erythranthe guttata [common monkey flower]
ref|XP_004290707.1|  PREDICTED: serine/threonine-protein phosphat...    156   1e-40   Fragaria vesca subsp. vesca
gb|KHG21887.1|  Serine/threonine-protein phosphatase BSL1               156   1e-40   Gossypium arboreum [tree cotton]
ref|XP_007050742.1|  BRI1 suppressor 1 (BSU1)-like 1                    156   1e-40   
gb|KHG21886.1|  Serine/threonine-protein phosphatase BSL1               156   1e-40   Gossypium arboreum [tree cotton]
ref|XP_010112705.1|  Serine/threonine-protein phosphatase BSL1          156   2e-40   
gb|AFN44700.1|  Ser/Thr phosphatase-containing Kelch repeat domai...    155   3e-40   Solanum tuberosum [potatoes]
ref|NP_001266004.1|  Hop-interacting protein THI129                     155   3e-40   Solanum lycopersicum
emb|CDP03570.1|  unnamed protein product                                155   4e-40   Coffea canephora [robusta coffee]
gb|EYU38113.1|  hypothetical protein MIMGU_mgv1a0013161mg               153   4e-40   Erythranthe guttata [common monkey flower]
ref|XP_008234964.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    154   7e-40   Prunus mume [ume]
ref|XP_007201214.1|  hypothetical protein PRUPE_ppa001177mg             154   7e-40   Prunus persica
ref|XP_003591564.1|  Serine/threonine protein phosphatase               145   9e-40   
ref|XP_009778415.1|  PREDICTED: serine/threonine-protein phosphat...    153   1e-39   Nicotiana sylvestris
ref|XP_010556800.1|  PREDICTED: serine/threonine-protein phosphat...    152   2e-39   
ref|XP_002520710.1|  bsu-protein phosphatase, putative                  152   2e-39   Ricinus communis
ref|XP_008449460.1|  PREDICTED: serine/threonine-protein phosphat...    152   3e-39   Cucumis melo [Oriental melon]
ref|XP_004140092.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    152   3e-39   
ref|XP_008386603.1|  PREDICTED: serine/threonine-protein phosphat...    152   4e-39   
ref|XP_008368903.1|  PREDICTED: serine/threonine-protein phosphat...    152   5e-39   
ref|XP_010556798.1|  PREDICTED: serine/threonine-protein phosphat...    152   5e-39   Tarenaya hassleriana [spider flower]
ref|XP_011082512.1|  PREDICTED: serine/threonine-protein phosphat...    151   7e-39   Sesamum indicum [beniseed]
gb|KDP21537.1|  hypothetical protein JCGZ_22008                         151   8e-39   Jatropha curcas
ref|XP_009347104.1|  PREDICTED: serine/threonine-protein phosphat...    151   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_009593091.1|  PREDICTED: serine/threonine-protein phosphat...    150   2e-38   Nicotiana tomentosiformis
gb|EPS69063.1|  serine/threonine-protein phosphatase                    145   2e-38   Genlisea aurea
gb|KDO87445.1|  hypothetical protein CISIN_1g002713mg                   149   3e-38   Citrus sinensis [apfelsine]
emb|CDY17964.1|  BnaC03g30360D                                          149   4e-38   Brassica napus [oilseed rape]
emb|CDX90906.1|  BnaA03g25860D                                          149   4e-38   
ref|XP_009134374.1|  PREDICTED: serine/threonine-protein phosphat...    149   4e-38   Brassica rapa
gb|KJB22560.1|  hypothetical protein B456_004G054500                    149   5e-38   Gossypium raimondii
ref|XP_006444191.1|  hypothetical protein CICLE_v10018791mg             148   8e-38   Citrus clementina [clementine]
ref|XP_006444192.1|  hypothetical protein CICLE_v10018791mg             148   8e-38   Citrus clementina [clementine]
ref|XP_010279479.1|  PREDICTED: serine/threonine-protein phosphat...    148   9e-38   Nelumbo nucifera [Indian lotus]
ref|XP_004496006.1|  PREDICTED: serine/threonine-protein phosphat...    148   9e-38   Cicer arietinum [garbanzo]
ref|XP_004496005.1|  PREDICTED: serine/threonine-protein phosphat...    148   1e-37   
gb|KJB42021.1|  hypothetical protein B456_007G132700                    148   1e-37   Gossypium raimondii
ref|XP_006286760.1|  hypothetical protein CARUB_v10003201mg             148   1e-37   Capsella rubella
ref|XP_002872798.1|  kelch repeat-containing serine/threonine pho...    148   1e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_010522672.1|  PREDICTED: serine/threonine-protein phosphat...    148   1e-37   Tarenaya hassleriana [spider flower]
ref|XP_010455968.1|  PREDICTED: serine/threonine-protein phosphat...    147   1e-37   
ref|XP_002270638.2|  PREDICTED: serine/threonine-protein phosphat...    147   2e-37   Vitis vinifera
ref|XP_006575099.1|  PREDICTED: serine/threonine-protein phosphat...    147   2e-37   
ref|XP_010422504.1|  PREDICTED: serine/threonine-protein phosphat...    147   2e-37   
ref|XP_010430668.1|  PREDICTED: serine/threonine-protein phosphat...    147   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008368904.1|  PREDICTED: serine/threonine-protein phosphat...    147   3e-37   
ref|NP_192217.2|  serine/threonine-protein phosphatase BSL1             146   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAM83219.1|  AT4g03080/T4I9_4                                        146   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAC79097.1|  putative phospho-ser/thr phosphatase                    146   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002321044.2|  phosphatase family protein                         146   4e-37   
gb|KHG15629.1|  Serine/threonine-protein phosphatase BSL1 -like p...    146   5e-37   Gossypium arboreum [tree cotton]
ref|XP_003518942.1|  PREDICTED: serine/threonine-protein phosphat...    146   6e-37   Glycine max [soybeans]
gb|AFY26889.1|  kelch repeat-containing serine/threonine phosphoe...    146   6e-37   Morella rubra [Chinese arbutus]
gb|AES61845.2|  serine/threonine-protein phosphatase                    145   7e-37   Medicago truncatula
ref|XP_007144577.1|  hypothetical protein PHAVU_007G167400g             145   7e-37   Phaseolus vulgaris [French bean]
gb|KFK30905.1|  hypothetical protein AALP_AA6G041300                    145   1e-36   Arabis alpina [alpine rockcress]
ref|XP_010070326.1|  PREDICTED: serine/threonine-protein phosphat...    145   1e-36   Eucalyptus grandis [rose gum]
ref|XP_011033646.1|  PREDICTED: serine/threonine-protein phosphat...    144   3e-36   Populus euphratica
ref|XP_011033645.1|  PREDICTED: serine/threonine-protein phosphat...    144   3e-36   Populus euphratica
ref|XP_003536338.1|  PREDICTED: serine/threonine-protein phosphat...    144   3e-36   Glycine max [soybeans]
ref|XP_006396534.1|  hypothetical protein EUTSA_v10028417mg             144   3e-36   Eutrema salsugineum [saltwater cress]
emb|CDY62088.1|  BnaC02g46770D                                          143   4e-36   Brassica napus [oilseed rape]
ref|XP_010244624.1|  PREDICTED: serine/threonine-protein phosphat...    143   5e-36   Nelumbo nucifera [Indian lotus]
gb|KJB22562.1|  hypothetical protein B456_004G054500                    143   5e-36   Gossypium raimondii
ref|XP_010244625.1|  PREDICTED: serine/threonine-protein phosphat...    143   6e-36   Nelumbo nucifera [Indian lotus]
ref|XP_009144526.1|  PREDICTED: serine/threonine-protein phosphat...    143   6e-36   Brassica rapa
emb|CDX97296.1|  BnaA02g20870D                                          143   6e-36   
ref|XP_002301559.1|  phosphatase family protein                         140   5e-35   
ref|XP_011011094.1|  PREDICTED: serine/threonine-protein phosphat...    140   5e-35   Populus euphratica
ref|XP_008813651.1|  PREDICTED: serine/threonine-protein phosphat...    135   6e-35   
ref|XP_008813652.1|  PREDICTED: serine/threonine-protein phosphat...    135   6e-35   
ref|XP_008813653.1|  PREDICTED: serine/threonine-protein phosphat...    135   7e-35   Phoenix dactylifera
ref|XP_011011093.1|  PREDICTED: serine/threonine-protein phosphat...    139   1e-34   Populus euphratica
ref|XP_011011092.1|  PREDICTED: serine/threonine-protein phosphat...    139   1e-34   Populus euphratica
gb|AEK86563.1|  serine/threonine-protein phosphatase                    139   2e-34   Camellia sinensis [black tea]
emb|CAN67846.1|  hypothetical protein VITISV_016669                     131   2e-34   Vitis vinifera
ref|XP_010910522.1|  PREDICTED: serine/threonine-protein phosphat...    130   2e-33   Elaeis guineensis
ref|XP_010684726.1|  PREDICTED: serine/threonine-protein phosphat...    134   7e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009385028.1|  PREDICTED: serine/threonine-protein phosphat...    133   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846753.1|  hypothetical protein AMTR_s00276p00018700          112   5e-27   
ref|XP_010904839.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    117   5e-27   Elaeis guineensis
gb|AFW82656.1|  hypothetical protein ZEAMMB73_760112                    111   1e-25   
ref|XP_004960470.1|  PREDICTED: serine/threonine-protein phosphat...    113   1e-25   Setaria italica
ref|XP_002439264.1|  hypothetical protein SORBIDRAFT_09g003440          113   2e-25   Sorghum bicolor [broomcorn]
ref|XP_008795124.1|  PREDICTED: serine/threonine-protein phosphat...    112   4e-25   Phoenix dactylifera
ref|XP_008655295.1|  PREDICTED: uncharacterized protein LOC100383...    111   8e-25   Zea mays [maize]
ref|XP_008655294.1|  PREDICTED: uncharacterized protein LOC100383...    111   9e-25   Zea mays [maize]
ref|NP_001054625.1|  Os05g0144400                                       111   1e-24   
gb|EEE62303.1|  hypothetical protein OsJ_17091                          111   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_171844.6|  serine/threonine-protein phosphatase BSU1             108   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003568959.1|  PREDICTED: serine/threonine-protein phosphat...    107   2e-23   Brachypodium distachyon [annual false brome]
ref|XP_010231726.1|  PREDICTED: serine/threonine-protein phosphat...    102   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_010231727.1|  PREDICTED: serine/threonine-protein phosphat...    102   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_002892160.1|  Serine/threonine-protein phosphatase BSU1          102   1e-21   
gb|KGN66599.1|  hypothetical protein Csa_1G638460                     89.0    4e-17   Cucumis sativus [cucumbers]
ref|XP_010474966.1|  PREDICTED: serine/threonine-protein phosphat...  89.0    4e-17   
ref|XP_006367867.1|  PREDICTED: serine/threonine-protein phosphat...  86.3    6e-17   
ref|XP_010045170.1|  PREDICTED: serine/threonine-protein phosphat...  88.6    7e-17   Eucalyptus grandis [rose gum]
gb|KHG00523.1|  Serine/threonine-protein phosphatase BSL3 -like p...  85.5    8e-17   Gossypium arboreum [tree cotton]
ref|XP_004139147.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    8e-17   
ref|XP_008450272.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    8e-17   
ref|NP_172318.1|  serine/threonine-protein phosphatase BSL2           88.2    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184935.1|  serine/threonine-protein phosphatase BSL2        88.2    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010263036.1|  PREDICTED: serine/threonine-protein phosphat...  88.2    1e-16   Nelumbo nucifera [Indian lotus]
dbj|BAH19666.1|  AT1G08420                                            88.2    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010247574.1|  PREDICTED: serine/threonine-protein phosphat...  87.8    1e-16   Nelumbo nucifera [Indian lotus]
gb|ABV91338.1|  kelch repeat-containing protein /serine/threonine...  87.8    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|EYU25964.1|  hypothetical protein MIMGU_mgv1a0006242mg             85.1    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_010457353.1|  PREDICTED: serine/threonine-protein phosphat...  87.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_001760494.1|  predicted protein                                87.4    2e-16   
gb|EYU41291.1|  hypothetical protein MIMGU_mgv1a0202661mg             84.7    2e-16   Erythranthe guttata [common monkey flower]
ref|XP_007150014.1|  hypothetical protein PHAVU_005G118700g           87.0    2e-16   Phaseolus vulgaris [French bean]
gb|KHN47652.1|  Serine/threonine-protein phosphatase BSL1             80.9    2e-16   Glycine soja [wild soybean]
dbj|BAK03675.1|  predicted protein                                    84.7    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007015657.1|  BRI1 suppressor 1 (BSU1)-like 2 isoform 1        87.0    2e-16   
ref|XP_008230041.1|  PREDICTED: serine/threonine-protein phosphat...  87.0    3e-16   Prunus mume [ume]
ref|XP_010488844.1|  PREDICTED: serine/threonine-protein phosphat...  87.0    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006369377.1|  hypothetical protein POPTR_0001s22320g           87.0    3e-16   
gb|KFK43163.1|  hypothetical protein AALP_AA1G088000                  87.0    3e-16   Arabis alpina [alpine rockcress]
ref|XP_008230036.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    3e-16   Prunus mume [ume]
ref|XP_001781021.1|  predicted protein                                87.0    3e-16   
ref|XP_002889692.1|  kelch repeat-containing protein                  86.7    3e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_009336399.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    3e-16   Pyrus x bretschneideri [bai li]
ref|XP_009368358.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    3e-16   Pyrus x bretschneideri [bai li]
ref|XP_007208428.1|  hypothetical protein PRUPE_ppa000783mg           86.7    3e-16   Prunus persica
ref|XP_006594918.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    3e-16   Glycine max [soybeans]
ref|XP_008361620.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    3e-16   
ref|XP_008385576.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    3e-16   
ref|XP_009398342.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009373887.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    3e-16   Pyrus x bretschneideri [bai li]
ref|XP_009398341.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011044597.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    3e-16   Populus euphratica
ref|XP_010101992.1|  Serine/threonine-protein phosphatase BSL2        86.7    3e-16   
ref|XP_007132502.1|  hypothetical protein PHAVU_011G099600g           86.7    3e-16   Phaseolus vulgaris [French bean]
gb|KHG29076.1|  Serine/threonine-protein phosphatase BSL3 -like p...  86.7    3e-16   Gossypium arboreum [tree cotton]
gb|KJB55556.1|  hypothetical protein B456_009G082300                  86.7    3e-16   Gossypium raimondii
emb|CDY22684.1|  BnaC08g43180D                                        86.7    3e-16   Brassica napus [oilseed rape]
ref|XP_010473113.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009118376.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    4e-16   Brassica rapa
ref|XP_010419412.1|  PREDICTED: serine/threonine-protein phosphat...  86.3    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_004291538.1|  PREDICTED: serine/threonine-protein phosphat...  86.3    4e-16   Fragaria vesca subsp. vesca
ref|XP_002976889.1|  hypothetical protein SELMODRAFT_175932           86.3    4e-16   
gb|KDO46578.1|  hypothetical protein CISIN_1g001895mg                 86.3    4e-16   Citrus sinensis [apfelsine]
ref|XP_003543410.1|  PREDICTED: serine/threonine-protein phosphat...  86.3    4e-16   Glycine max [soybeans]
emb|CDY06313.1|  BnaA09g48900D                                        86.3    4e-16   
dbj|BAF00990.1|  putative phosphoprotein phosphatase                  85.9    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002980607.1|  hypothetical protein SELMODRAFT_268371           86.3    4e-16   
ref|XP_006826448.1|  hypothetical protein AMTR_s00004p00175690        86.3    4e-16   
ref|XP_006424082.1|  hypothetical protein CICLE_v10027742mg           86.3    4e-16   
ref|XP_006424083.1|  hypothetical protein CICLE_v10027742mg           86.3    5e-16   Citrus clementina [clementine]
ref|XP_006408677.1|  hypothetical protein EUTSA_v10001894mg           86.3    5e-16   Eutrema salsugineum [saltwater cress]
ref|NP_001266022.1|  Hop-interacting protein THI140                   86.3    5e-16   Solanum lycopersicum
ref|XP_002879075.1|  kelch repeat-containing serine/threonine pho...  85.9    5e-16   
ref|XP_003596905.1|  Serine/threonine protein phosphatase             85.9    6e-16   Medicago truncatula
gb|KJB35474.1|  hypothetical protein B456_006G116600                  85.9    6e-16   Gossypium raimondii
ref|XP_006303893.1|  hypothetical protein CARUB_v10008182mg           85.9    6e-16   Capsella rubella
ref|XP_010513312.1|  PREDICTED: serine/threonine-protein phosphat...  85.9    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_004487445.1|  PREDICTED: serine/threonine-protein phosphat...  85.9    6e-16   Cicer arietinum [garbanzo]
ref|XP_010458078.1|  PREDICTED: serine/threonine-protein phosphat...  85.9    6e-16   
gb|KJB35473.1|  hypothetical protein B456_006G116600                  85.5    7e-16   Gossypium raimondii
ref|XP_009388972.1|  PREDICTED: serine/threonine-protein phosphat...  85.5    7e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP42962.1|  hypothetical protein JCGZ_23904                       85.5    7e-16   Jatropha curcas
pir||T00913  probable phosphoprotein phosphatase (EC 3.1.3.16) F2...  85.5    7e-16
gb|KHG22818.1|  Serine/threonine-protein phosphatase BSL3 -like p...  85.5    7e-16   Gossypium arboreum [tree cotton]
gb|KJB35470.1|  hypothetical protein B456_006G116600                  85.5    7e-16   Gossypium raimondii
gb|AFW68154.1|  hypothetical protein ZEAMMB73_166373                  81.3    7e-16   
emb|CBI24435.3|  unnamed protein product                              85.5    8e-16   Vitis vinifera
ref|XP_006295510.1|  hypothetical protein CARUB_v10024614mg           85.5    8e-16   
ref|XP_009770253.1|  PREDICTED: serine/threonine-protein phosphat...  85.5    8e-16   Nicotiana sylvestris
ref|XP_002264614.1|  PREDICTED: serine/threonine-protein phosphat...  85.5    8e-16   Vitis vinifera
ref|XP_009770255.1|  PREDICTED: serine/threonine-protein phosphat...  85.5    8e-16   Nicotiana sylvestris
ref|XP_010557449.1|  PREDICTED: serine/threonine-protein phosphat...  85.5    8e-16   Tarenaya hassleriana [spider flower]
ref|XP_009770254.1|  PREDICTED: serine/threonine-protein phosphat...  85.5    8e-16   Nicotiana sylvestris
ref|XP_008681453.1|  PREDICTED: uncharacterized protein LOC100192...  85.5    8e-16   
ref|XP_008681503.1|  PREDICTED: uncharacterized protein LOC100192...  85.5    8e-16   Zea mays [maize]
ref|XP_006592783.1|  PREDICTED: serine/threonine-protein phosphat...  85.5    9e-16   
ref|XP_009412503.1|  PREDICTED: serine/threonine-protein phosphat...  85.5    9e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003539489.1|  PREDICTED: serine/threonine-protein phosphat...  85.5    9e-16   Glycine max [soybeans]
ref|XP_006417691.1|  hypothetical protein EUTSA_v10006669mg           85.5    9e-16   Eutrema salsugineum [saltwater cress]
ref|XP_006591057.1|  PREDICTED: serine/threonine-protein phosphat...  85.1    9e-16   Glycine max [soybeans]
ref|XP_010475640.1|  PREDICTED: serine/threonine-protein phosphat...  85.1    9e-16   Camelina sativa [gold-of-pleasure]
ref|XP_003538088.1|  PREDICTED: serine/threonine-protein phosphat...  85.1    1e-15   Glycine max [soybeans]
ref|XP_009788953.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    1e-15   Nicotiana sylvestris
ref|XP_010544322.1|  PREDICTED: serine/threonine-protein phosphat...  85.1    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_006592360.1|  PREDICTED: serine/threonine-protein phosphat...  85.1    1e-15   
ref|XP_006592359.1|  PREDICTED: serine/threonine-protein phosphat...  85.1    1e-15   
ref|XP_004963199.1|  PREDICTED: serine/threonine-protein phosphat...  85.1    1e-15   Setaria italica
ref|XP_010544321.1|  PREDICTED: serine/threonine-protein phosphat...  85.1    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_002443577.1|  hypothetical protein SORBIDRAFT_08g021850        85.1    1e-15   Sorghum bicolor [broomcorn]
ref|XP_003540821.1|  PREDICTED: serine/threonine-protein phosphat...  85.1    1e-15   Glycine max [soybeans]
ref|NP_180289.3|  serine/threonine-protein phosphatase BSL3           85.1    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011008746.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    1e-15   Populus euphratica
ref|NP_001189614.1|  serine/threonine-protein phosphatase BSL3        84.7    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008674098.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    1e-15   Zea mays [maize]
ref|XP_006361106.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    1e-15   Solanum tuberosum [potatoes]
ref|XP_011008648.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    1e-15   Populus euphratica
ref|XP_010322449.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    1e-15   Solanum lycopersicum
emb|CDX97481.1|  BnaC08g13460D                                        84.7    1e-15   
ref|XP_002313501.2|  kelch repeat-containing family protein           84.7    1e-15   
ref|NP_001275238.1|  serine/threonine-protein phosphatase BSL3-like   84.7    1e-15   Solanum tuberosum [potatoes]
ref|XP_009110896.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    1e-15   Brassica rapa
emb|CDY31148.1|  BnaA08g26980D                                        84.7    1e-15   Brassica napus [oilseed rape]
ref|XP_011090290.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    1e-15   Sesamum indicum [beniseed]
ref|XP_004241349.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    2e-15   Solanum lycopersicum
ref|XP_009587046.1|  PREDICTED: serine/threonine-protein phosphat...  84.7    2e-15   Nicotiana tomentosiformis
gb|EYU36016.1|  hypothetical protein MIMGU_mgv1a000720mg              84.3    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_011090288.1|  PREDICTED: serine/threonine-protein phosphat...  84.3    2e-15   Sesamum indicum [beniseed]
ref|XP_011090289.1|  PREDICTED: serine/threonine-protein phosphat...  84.3    2e-15   Sesamum indicum [beniseed]
ref|XP_009587040.1|  PREDICTED: serine/threonine-protein phosphat...  84.3    2e-15   Nicotiana tomentosiformis
ref|XP_009587594.1|  PREDICTED: serine/threonine-protein phosphat...  84.3    2e-15   Nicotiana tomentosiformis
ref|XP_009587053.1|  PREDICTED: serine/threonine-protein phosphat...  84.3    2e-15   
emb|CDP15567.1|  unnamed protein product                              84.3    2e-15   Coffea canephora [robusta coffee]
ref|XP_006340328.1|  PREDICTED: serine/threonine-protein phosphat...  84.0    2e-15   Solanum tuberosum [potatoes]
gb|KJB21740.1|  hypothetical protein B456_004G011600                  84.0    2e-15   Gossypium raimondii
ref|XP_006340327.1|  PREDICTED: serine/threonine-protein phosphat...  84.0    3e-15   Solanum tuberosum [potatoes]
gb|AES88189.2|  serine/threonine-protein phosphatase BSL2-like pr...  83.6    3e-15   Medicago truncatula
ref|XP_009598633.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    3e-15   Nicotiana tomentosiformis
emb|CDY57791.1|  BnaCnng32470D                                        83.6    4e-15   Brassica napus [oilseed rape]
ref|XP_010658896.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    4e-15   
ref|XP_009598634.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    4e-15   Nicotiana tomentosiformis
gb|EEC75832.1|  hypothetical protein OsI_12812                        83.2    4e-15   Oryza sativa Indica Group [Indian rice]
gb|ABF97885.1|  kelch repeat-containing serine/threonine phosphoe...  83.2    4e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009795596.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  83.2    5e-15   Nicotiana sylvestris
ref|XP_010658894.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    5e-15   
ref|XP_008449600.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    5e-15   Cucumis melo [Oriental melon]
ref|XP_009140775.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    5e-15   Brassica rapa
ref|XP_010658895.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    5e-15   
ref|XP_002262846.2|  PREDICTED: serine/threonine-protein phosphat...  83.2    5e-15   Vitis vinifera
emb|CDY57485.1|  BnaAnng14650D                                        83.2    5e-15   Brassica napus [oilseed rape]
ref|XP_010685448.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    5e-15   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI24997.3|  unnamed protein product                              82.8    5e-15   Vitis vinifera
ref|XP_011088984.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    6e-15   Sesamum indicum [beniseed]
ref|XP_004506226.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    6e-15   Cicer arietinum [garbanzo]
ref|XP_011088983.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    7e-15   Sesamum indicum [beniseed]
ref|XP_001765008.1|  predicted protein                                82.8    7e-15   
ref|XP_008811286.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    7e-15   Phoenix dactylifera
ref|XP_008811284.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    7e-15   Phoenix dactylifera
ref|XP_010941606.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    7e-15   
ref|XP_008811285.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    7e-15   Phoenix dactylifera
ref|XP_010313488.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    8e-15   Solanum lycopersicum
ref|XP_004251224.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    8e-15   Solanum lycopersicum
gb|EPS70499.1|  hypothetical protein M569_04238                       82.4    8e-15   Genlisea aurea
gb|AAD26883.1|  putative phosphoprotein phosphatase                   82.0    8e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006651637.1|  PREDICTED: serine/threonine-protein phosphat...  82.0    1e-14   Oryza brachyantha
ref|XP_009418973.1|  PREDICTED: serine/threonine-protein phosphat...  81.6    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001769730.1|  predicted protein                                81.6    2e-14   
ref|XP_010232097.1|  PREDICTED: serine/threonine-protein phosphat...  81.6    2e-14   Brachypodium distachyon [annual false brome]
gb|EPS67556.1|  serine/threonine-protein phosphatase                  78.2    2e-14   Genlisea aurea
ref|XP_004140171.1|  PREDICTED: serine/threonine-protein phosphat...  81.3    2e-14   Cucumis sativus [cucumbers]
ref|XP_003561867.1|  PREDICTED: serine/threonine-protein phosphat...  81.3    2e-14   Brachypodium distachyon [annual false brome]
ref|XP_010907354.1|  PREDICTED: serine/threonine-protein phosphat...  81.3    2e-14   Elaeis guineensis
ref|XP_010907353.1|  PREDICTED: serine/threonine-protein phosphat...  81.3    2e-14   Elaeis guineensis
ref|XP_008643918.1|  PREDICTED: uncharacterized protein LOC100381...  80.5    2e-14   
ref|XP_006304779.1|  hypothetical protein CARUB_v10012319mg           80.1    4e-14   
ref|NP_001067290.1|  Os12g0617900                                     80.1    5e-14   
ref|XP_006664752.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    5e-14   
tpg|DAA50299.1|  TPA: putative kelch repeat-containing protein co...  79.7    6e-14   
ref|XP_002464169.1|  hypothetical protein SORBIDRAFT_01g013460        79.7    7e-14   Sorghum bicolor [broomcorn]
ref|XP_004982314.1|  PREDICTED: serine/threonine-protein phosphat...  79.3    8e-14   Setaria italica
gb|KHN17986.1|  Serine/threonine-protein phosphatase BSL2             78.6    2e-13   Glycine soja [wild soybean]
ref|XP_010031570.1|  PREDICTED: serine/threonine-protein phosphat...  77.8    3e-13   Eucalyptus grandis [rose gum]
gb|AAF22889.1|AC006932_6  T27G7.10                                    77.4    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003577251.1|  PREDICTED: serine/threonine-protein phosphat...  76.3    1e-12   Brachypodium distachyon [annual false brome]
gb|KFK42699.1|  hypothetical protein AALP_AA1G028300                  74.3    6e-12   Arabis alpina [alpine rockcress]
gb|KFK42698.1|  hypothetical protein AALP_AA1G028300                  74.3    6e-12   Arabis alpina [alpine rockcress]
ref|XP_006418234.1|  hypothetical protein EUTSA_v10009980mg           73.2    9e-12   
gb|AAF86539.1|AC002560_32  F21B7.7                                    68.9    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KHN03760.1|  Serine/threonine-protein phosphatase BSL1             63.2    2e-10   Glycine soja [wild soybean]
ref|XP_009144944.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    3e-10   Brassica rapa
ref|XP_002499734.1|  predicted protein                                68.9    3e-10   Micromonas commoda
emb|CDY29598.1|  BnaA05g15720D                                        68.6    3e-10   Brassica napus [oilseed rape]
gb|AFW82657.1|  hypothetical protein ZEAMMB73_760112                  63.2    2e-09   
ref|XP_010098907.1|  hypothetical protein L484_006545                 60.8    3e-09   
gb|KGN47885.1|  hypothetical protein Csa_6G409910                     63.5    8e-09   Cucumis sativus [cucumbers]
ref|XP_003058098.1|  predicted protein                                64.3    8e-09   Micromonas pusilla CCMP1545
gb|KDD72504.1|  hypothetical protein H632_c3260p0                     58.5    6e-08   Helicosporidium sp. ATCC 50920
ref|XP_001689767.1|  protein phosphatase 1 beta                       61.2    7e-08   Chlamydomonas reinhardtii
ref|XP_002963377.1|  hypothetical protein SELMODRAFT_438528           60.8    9e-08   Selaginella moellendorffii
ref|XP_002974662.1|  hypothetical protein SELMODRAFT_442608           60.8    1e-07   
ref|XP_006654987.1|  PREDICTED: serine/threonine-protein phosphat...  60.5    1e-07   
ref|XP_002958148.1|  hypothetical protein VOLCADRAFT_84366            60.1    2e-07   
ref|XP_007510268.1|  predicted protein                                60.1    2e-07   
ref|XP_001782643.1|  predicted protein                                58.2    5e-07   
ref|XP_005846245.1|  hypothetical protein CHLNCDRAFT_135536           58.5    6e-07   
ref|XP_002513729.1|  hypothetical protein RCOM_1754260                54.3    2e-06   
ref|XP_004166313.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    2e-06   
gb|EMS55151.1|  Serine/threonine-protein phosphatase BSL1-like pr...  56.2    3e-06   
ref|XP_001785960.1|  predicted protein                                53.9    2e-05   
ref|XP_005645525.1|  protein phosphatase 1 beta                       53.1    3e-05   
ref|XP_010106779.1|  hypothetical protein L484_020801                 49.3    5e-05   
tpg|DAA48783.1|  TPA: hypothetical protein ZEAMMB73_808698            51.6    1e-04   
ref|XP_004173418.1|  PREDICTED: serine/threonine-protein phosphat...  50.4    2e-04   
ref|XP_003605990.1|  Serine/threonine protein phosphatase             50.1    2e-04   
gb|EMS59471.1|  Serine/threonine-protein phosphatase BSL2-like pr...  50.4    2e-04   
gb|EEE59591.1|  hypothetical protein OsJ_11899                        49.7    4e-04   
gb|EMT33719.1|  Serine/threonine-phosphatase BSL2-like protein        49.7    5e-04   
ref|XP_004164757.1|  PREDICTED: serine/threonine-protein phosphat...  49.3    6e-04   
gb|KEH38997.1|  serine/threonine-protein phosphatase BSL2-like pr...  48.9    7e-04   
gb|KIY99882.1|  hypothetical protein MNEG_8078                        48.9    7e-04   



>ref|XP_004171648.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like, partial 
[Cucumis sativus]
Length=173

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 92/100 (92%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            MA+KPWLYPAP+YR+LET+WDTD+DAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDDAPGPRCGHTLTAVAATKSFGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   ASSAAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPR  100



>gb|EYU44112.1| hypothetical protein MIMGU_mgv1a025841mg [Erythranthe guttata]
Length=207

 Score =   147 bits (372),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAP YR+LE+FWDTD+DAPGPRCGHTLTAVAATKT GPRLILFGGATAIE G
Sbjct  1    MGSKPWLYPAPAYRNLESFWDTDDDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIESG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +GG    + LAGVTN IHSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   SGGLSPFLGLAGVTNCIHSYDVLTRKWTRLRPAGEPPSPR  100



>ref|XP_004290707.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Fragaria 
vesca subsp. vesca]
Length=883

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M++KPWLYPAPTYR+LET+WDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MSSKPWLYPAPTYRTLETYWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPR  100



>gb|KHG21887.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=827

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 92/100 (92%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPR  100



>ref|XP_007050742.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
 gb|EOX94899.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
Length=887

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 92/100 (92%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   ASSSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPR  100



>gb|KHG21886.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=854

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 92/100 (92%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPR  100



>ref|XP_010112705.1| Serine/threonine-protein phosphatase BSL1 [Morus notabilis]
 gb|EXC34663.1| Serine/threonine-protein phosphatase BSL1 [Morus notabilis]
Length=883

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 91/100 (91%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYR LET+WDTDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRPLETYWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPR  100



>gb|AFN44700.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=878

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRLLETFWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            NG   GIRLAGVTN IHSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   NGAAPGIRLAGVTNCIHSYDVLTRKWTRLRPAGEPPSPR  99



>ref|NP_001266004.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 ref|XP_010326541.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326542.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69819.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 gb|AFU48608.1| BSL1, partial [Solanum lycopersicum]
Length=878

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRLLETFWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            NG   GIRLAGVTN IHSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   NGAAPGIRLAGVTNCIHSYDVLTRKWTRLRPAGEPPSPR  99



>emb|CDP03570.1| unnamed protein product [Coffea canephora]
Length=883

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 94/99 (95%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYRSLETFW TD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRSLETFWATDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            NGG  GIRLAGVTN+IHSYDVLTRKW RL+PAGEPPSPR
Sbjct  61   NGGAPGIRLAGVTNSIHSYDVLTRKWIRLRPAGEPPSPR  99



>gb|EYU38113.1| hypothetical protein MIMGU_mgv1a0013161mg, partial [Erythranthe 
guttata]
Length=696

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAP YR+LE+FWDTD+DAPGPRCGHTLTAVAATKT GPRLILFGGATAIE G
Sbjct  1    MGSKPWLYPAPAYRNLESFWDTDDDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIESG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +GG  GIRLAGVTN IHSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   SGGAPGIRLAGVTNCIHSYDVLTRKWTRLRPAGEPPSPR  99



>ref|XP_008234964.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 [Prunus mume]
Length=873

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYR+LET+WDTD+D PGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDTDDDGPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRMRPAGEPPSPR  100



>ref|XP_007201214.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
 gb|EMJ02413.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
Length=887

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYR+LET+WDTD+D PGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDTDDDGPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRMRPAGEPPSPR  100



>ref|XP_003591564.1| Serine/threonine protein phosphatase, partial [Medicago truncatula]
Length=203

 Score =   145 bits (365),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTY+ +E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYKPIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN++H+YDV ++KWTR++PAG+PPSPR
Sbjct  61   STSAPGIRLAGVTNSVHAYDVDSKKWTRIKPAGDPPSPR  99



>ref|XP_009778415.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778416.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778417.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778418.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
Length=879

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRILETFWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +G   GIRLAGVTN +HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   SGAAPGIRLAGVTNCVHSYDVLTRKWTRVRPAGEPPSPR  99



>ref|XP_010556800.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X3 [Tarenaya hassleriana]
Length=756

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP YR+LETFWDT++DAPGPRCGHTLT VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPMYRALETFWDTEDDAPGPRCGHTLTVVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            N    GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   NSSTPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPR  99



>ref|XP_002520710.1| bsu-protein phosphatase, putative [Ricinus communis]
 gb|EEF41672.1| bsu-protein phosphatase, putative [Ricinus communis]
Length=885

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAPTYR LET+WDTDEDAPGPRCGHTLTAVAAT THGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRPLETYWDTDEDAPGPRCGHTLTAVAATNTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   GSSSAPGIRLAGVTNSVHSYDVLTRKWTRMRPAGEPPSPR  100



>ref|XP_008449460.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Cucumis 
melo]
Length=883

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 92/100 (92%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            MA+KPWLYPAP+YR+LET+WDTD+DAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDDAPGPRCGHTLTAVAATKSFGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   ASSAAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPR  100



>ref|XP_004140092.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1-like [Cucumis sativus]
Length=905

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 92/100 (92%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            MA+KPWLYPAP+YR+LET+WDTD+DAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDDAPGPRCGHTLTAVAATKSFGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   ASSAAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPR  100



>ref|XP_008386603.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
 ref|XP_008350076.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
Length=886

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAPTYR+LETFWD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLFPAPTYRTLETFWDCDDDAPGPRCSHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYD+LTRKWTR++PAGEPPSPR
Sbjct  61   AASSAPGIRLAGVTNSVHSYDILTRKWTRMRPAGEPPSPR  100



>ref|XP_008368903.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
 ref|XP_008363688.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
Length=884

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYR+LET+WD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDCDDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                 GIRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   AASAPGIRLAGVTNSVHSYDVLTRKWTRMRPAGEPPSPR  99



>ref|XP_010556798.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010556799.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Tarenaya hassleriana]
Length=887

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP YR+LETFWDT++DAPGPRCGHTLT VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPMYRALETFWDTEDDAPGPRCGHTLTVVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            N    GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   NSSTPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPR  99



>ref|XP_011082512.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Sesamum 
indicum]
Length=882

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 95/99 (96%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL PAPTYR+LE++WDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLCPAPTYRTLESYWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            NGG  GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   NGGAPGIRLAGVTNSVHSYDVLTRKWTRLRPAGEPPSPR  99



>gb|KDP21537.1| hypothetical protein JCGZ_22008 [Jatropha curcas]
Length=886

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAPTYR LET+WDTDEDAPGPRCGHTLTAVAAT +HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRPLETYWDTDEDAPGPRCGHTLTAVAATNSHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   GSSSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPR  100



>ref|XP_009347104.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Pyrus x 
bretschneideri]
Length=885

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 93/100 (93%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAPTYR+LETFWD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLFPAPTYRTLETFWDCDDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  --nggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
              +  PGIRLAGVTN++HSYD+LTRKWTR++PAGEPPSPR
Sbjct  61   GPSSAPGIRLAGVTNSVHSYDILTRKWTRMRPAGEPPSPR  100



>ref|XP_009593091.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
tomentosiformis]
Length=879

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATK HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRILETFWDTDDDAPGPRCGHTLTAVAATKIHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +G   GIRLAGVTN +HSYDVLTRKWTR++PAG+PPSPR
Sbjct  61   SGAAPGIRLAGVTNCVHSYDVLTRKWTRVRPAGDPPSPR  99



>gb|EPS69063.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=348

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAPTYR LE+FWD ++D+PGPRCGHTLTAV+ATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRPLESFWDAEDDSPGPRCGHTLTAVSATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWT-RLQPAGEPPSPR  491
            NG   GIRLAGVTN++HSYDVLTRKWT RLQPAGEPPSPR
Sbjct  61   NGAAPGIRLAGVTNSVHSYDVLTRKWTSRLQPAGEPPSPR  100



>gb|KDO87445.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=769

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M AKPWL+PAP+YR+LET+WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDEDAPGPRCGHTLTAVAATKTTGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++H YDVLTRKWTR++PAGEPPSPR
Sbjct  61   ATSSAPGIRLAGVTNSVHLYDVLTRKWTRIRPAGEPPSPR  100



>emb|CDY17964.1| BnaC03g30360D [Brassica napus]
Length=886

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            MAAKPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            N    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   NSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPR  99



>emb|CDX90906.1| BnaA03g25860D [Brassica napus]
Length=886

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            MAAKPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            N    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   NSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPR  99



>ref|XP_009134374.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Brassica 
rapa]
Length=878

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            MAAKPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            N    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   NSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPR  99



>gb|KJB22560.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=887

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +K  LYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKLLLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPR  100



>ref|XP_006444191.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479835.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Citrus sinensis]
 gb|ESR57431.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87437.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
 gb|KDO87438.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=885

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M AKPWL+PAP+YR+LET+WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDEDAPGPRCGHTLTAVAATKTTGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++H YDVLTRKWTR++PAGEPPSPR
Sbjct  61   ATSSAPGIRLAGVTNSVHLYDVLTRKWTRIRPAGEPPSPR  100



>ref|XP_006444192.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006444193.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479834.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Citrus sinensis]
 gb|ESR57432.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|ESR57433.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87439.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=889

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M AKPWL+PAP+YR+LET+WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDEDAPGPRCGHTLTAVAATKTTGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++H YDVLTRKWTR++PAGEPPSPR
Sbjct  61   ATSSAPGIRLAGVTNSVHLYDVLTRKWTRIRPAGEPPSPR  100



>ref|XP_010279479.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Nelumbo 
nucifera]
Length=885

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYRS+ET W+TDEDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRSVETSWETDEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  n-ggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                PGIRLAGVT+++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   GPSAPGIRLAGVTSSVHSYDVLTRKWTRIRPAGEPPSPR  99



>ref|XP_004496006.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Cicer arietinum]
Length=876

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAPTYR++E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRAIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN++HSYD+ T+KWTR++PAG+PPSPR
Sbjct  61   SSSAPGIRLAGVTNSVHSYDLQTKKWTRIKPAGDPPSPR  99



>ref|XP_004496005.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Cicer arietinum]
Length=885

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAPTYR++E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRAIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN++HSYD+ T+KWTR++PAG+PPSPR
Sbjct  61   SSSAPGIRLAGVTNSVHSYDLQTKKWTRIKPAGDPPSPR  99



>gb|KJB42021.1| hypothetical protein B456_007G132700 [Gossypium raimondii]
Length=878

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPW  PAPTYR+LETFWDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWQSPAPTYRTLETFWDTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLT+KWTR++PAG+PPSPR
Sbjct  61   ASSSSPGIRLAGVTNSVHSYDVLTKKWTRIRPAGDPPSPR  100



>ref|XP_006286760.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
 gb|EOA19658.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
Length=881

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN++HSYDVLTRKWTRL PAGEPPSPR
Sbjct  61   SSSVPGIRLAGVTNSVHSYDVLTRKWTRLVPAGEPPSPR  99



>ref|XP_002872798.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49057.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=881

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   SSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPR  99



>ref|XP_010522672.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
Length=887

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP Y++LETFWDT+EDAPGPRC HTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPMYQALETFWDTEEDAPGPRCAHTLTAVAATKTRGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            N    GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   NSSTPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPR  99



>ref|XP_010455968.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Camelina sativa]
 ref|XP_010455970.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Camelina sativa]
Length=882

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKALETFWDDEEDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   GSSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPR  100



>ref|XP_002270638.2| PREDICTED: serine/threonine-protein phosphatase BSL1 [Vitis vinifera]
 emb|CBI32287.3| unnamed protein product [Vitis vinifera]
Length=888

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 89/99 (90%), Gaps = 2/99 (2%)
 Frame = +3

Query  201  AAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggn  380
             +KPWLYPAPTYR+LE++WDTD+DAPGPRCGHTLTA+A TKTHGPRLILFGGATAIEGG 
Sbjct  3    GSKPWLYPAPTYRTLESYWDTDDDAPGPRCGHTLTAIAPTKTHGPRLILFGGATAIEGGA  62

Query  381  ggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                  IRLAGVTN++HSYDVLTRKWTRL+PAGEPPS R
Sbjct  63   SSSAPGIRLAGVTNSVHSYDVLTRKWTRLRPAGEPPSVR  101



>ref|XP_006575099.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Glycine max]
Length=753

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYR++ETFW TDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTIETFWVTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN +HSYDV +RKWT ++PAGEPPSPR
Sbjct  61   SSSAPGIRLAGVTNTVHSYDVQSRKWTSIKPAGEPPSPR  99



>ref|XP_010422504.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=881

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKALETFWDDEEDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   GSSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPR  100



>ref|XP_010430668.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=882

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEEDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      IRLAGVTN++HSYDVLTR+WTRL+PAGEPPSPR
Sbjct  61   STSSVPGIRLAGVTNSVHSYDVLTRRWTRLKPAGEPPSPR  100



>ref|XP_008368904.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
 ref|XP_008363689.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
Length=882

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYR+LET+WD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDCDDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   + GVTN++HSYDVLTRKWTR++PAGEPPSPR
Sbjct  61   AASAPG-ITGVTNSVHSYDVLTRKWTRMRPAGEPPSPR  97



>ref|NP_192217.2| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
 sp|Q8L7U5.2|BSL1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL1; AltName: 
Full=BSU1-like protein 1 [Arabidopsis thaliana]
 gb|AEE82268.1| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
Length=881

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN +HSYD+LTRKWTRL+PAGEPPSPR
Sbjct  61   SSSVPGIRLAGVTNTVHSYDILTRKWTRLKPAGEPPSPR  99



>gb|AAM83219.1| AT4g03080/T4I9_4 [Arabidopsis thaliana]
Length=881

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN +HSYD+LTRKWTRL+PAGEPPSPR
Sbjct  61   SSSVPGIRLAGVTNTVHSYDILTRKWTRLKPAGEPPSPR  99



>gb|AAC79097.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
 emb|CAB77793.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
Length=894

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN +HSYD+LTRKWTRL+PAGEPPSPR
Sbjct  61   SSSVPGIRLAGVTNTVHSYDILTRKWTRLKPAGEPPSPR  99



>ref|XP_002321044.2| phosphatase family protein [Populus trichocarpa]
 gb|EEE99359.2| phosphatase family protein [Populus trichocarpa]
Length=892

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAPTYR+LET+WD+D+DAPG RC HTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRTLETYWDSDDDAPGSRCAHTLTAVAATKSQGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                 GIRLAGVTN++HSYDVLTRKWTR+QPAGEPPSPR
Sbjct  61   ASSAPGIRLAGVTNSVHSYDVLTRKWTRVQPAGEPPSPR  99



>gb|KHG15629.1| Serine/threonine-protein phosphatase BSL1 -like protein [Gossypium 
arboreum]
Length=838

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPW  PAPTYR+LETFWDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWQPPAPTYRTLETFWDTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      IRLAGVTN++HSYDVLT+KWTR++PAG+PPSPR
Sbjct  61   SSSSSPGIRLAGVTNSVHSYDVLTKKWTRIRPAGDPPSPR  100



>ref|XP_003518942.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Glycine max]
Length=881

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYR++ETFW TDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTIETFWVTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN +HSYDV +RKWT ++PAGEPPSPR
Sbjct  61   SSSAPGIRLAGVTNTVHSYDVQSRKWTSIKPAGEPPSPR  99



>gb|AFY26889.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Morella rubra]
Length=887

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL PAPTYR+LET+WDTDEDAPGPRCGHTLTAVAATK+HG RLILFGGATAIEGG
Sbjct  1    MGSKPWLSPAPTYRTLETYWDTDEDAPGPRCGHTLTAVAATKSHGARLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR++PAG+PPS R
Sbjct  61   ASSSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGDPPSLR  100



>gb|AES61845.2| serine/threonine-protein phosphatase [Medicago truncatula]
Length=879

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTY+ +E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYKPIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN++H+YDV ++KWTR++PAG+PPSPR
Sbjct  61   STSAPGIRLAGVTNSVHAYDVDSKKWTRIKPAGDPPSPR  99



>ref|XP_007144577.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
 gb|ESW16571.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
Length=878

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPA TYR+LETFWDTDED PGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPASTYRNLETFWDTDEDGPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN +HSYDV TRKW  ++PAGEPPSPR
Sbjct  61   SSSAPGIRLAGVTNTVHSYDVQTRKWISIKPAGEPPSPR  99



>gb|KFK30905.1| hypothetical protein AALP_AA6G041300 [Arabis alpina]
Length=878

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            MA KP+L+PAP Y+SLETFWD ++DAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MATKPFLHPAPQYKSLETFWDEEDDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   SSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPR  99



>ref|XP_010070326.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Eucalyptus 
grandis]
 gb|KCW58989.1| hypothetical protein EUGRSUZ_H01613 [Eucalyptus grandis]
Length=887

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYR+LET+WD DEDAP PR GHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRNLETYWDADEDAPLPRVGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYD+LT+KWTR++PAG+PPSPR
Sbjct  61   AASSAPGIRLAGVTNSVHSYDILTKKWTRMKPAGDPPSPR  100



>ref|XP_011033646.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Populus euphratica]
Length=885

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 88/99 (89%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL PAPTYR+L T+WD+D+DAPG RC HTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLQPAPTYRTLATYWDSDDDAPGSRCAHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                 GIRLAGVTN++HSYDVLTRKWTR+QPAGEPPSPR
Sbjct  61   ASSAPGIRLAGVTNSVHSYDVLTRKWTRVQPAGEPPSPR  99



>ref|XP_011033645.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Populus euphratica]
Length=886

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 88/99 (89%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL PAPTYR+L T+WD+D+DAPG RC HTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLQPAPTYRTLATYWDSDDDAPGSRCAHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                 GIRLAGVTN++HSYDVLTRKWTR+QPAGEPPSPR
Sbjct  61   ASSAPGIRLAGVTNSVHSYDVLTRKWTRVQPAGEPPSPR  99



>ref|XP_003536338.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Glycine 
max]
Length=881

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWLYPAPTYR++ET WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTIETVWDTDEDAPGPRCGHTLTAVAATKTLGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN +H+YDV +RKWT ++PAGEPPSPR
Sbjct  61   SSSAPGIRLAGVTNTVHAYDVQSRKWTSVKPAGEPPSPR  99



>ref|XP_006396534.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
 gb|ESQ37987.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
Length=881

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 88/99 (89%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M  K WL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKQWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   SSSLPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPR  99



>emb|CDY62088.1| BnaC02g46770D [Brassica napus]
Length=877

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M  KP+++PAP Y+++ETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            N      IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   NSSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPR  100



>ref|XP_010244624.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Nelumbo nucifera]
Length=897

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 2/101 (2%)
 Frame = +3

Query  195  GMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieg  374
            G  +KPWLYPAPTYRS+ET W+TD DAPGPRC HTLTAVAATK+HG RLILFGG TAIEG
Sbjct  2    GSNSKPWLYPAPTYRSVETSWETDRDAPGPRCAHTLTAVAATKSHGHRLILFGGTTAIEG  61

Query  375  g--nggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            G  +  PGIRLAGVTN++HSYDVLTRKWTR+QP GEPPSPR
Sbjct  62   GGPSSVPGIRLAGVTNSVHSYDVLTRKWTRIQPVGEPPSPR  102



>gb|KJB22562.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=891

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 90/104 (87%), Gaps = 6/104 (6%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +K  LYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKLLLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTR----LQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLTRKWTR    ++PAGEPPSPR
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRFLLIIRPAGEPPSPR  104



>ref|XP_010244625.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Nelumbo nucifera]
Length=888

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 2/101 (2%)
 Frame = +3

Query  195  GMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieg  374
            G  +KPWLYPAPTYRS+ET W+TD DAPGPRC HTLTAVAATK+HG RLILFGG TAIEG
Sbjct  2    GSNSKPWLYPAPTYRSVETSWETDRDAPGPRCAHTLTAVAATKSHGHRLILFGGTTAIEG  61

Query  375  g--nggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            G  +  PGIRLAGVTN++HSYDVLTRKWTR+QP GEPPSPR
Sbjct  62   GGPSSVPGIRLAGVTNSVHSYDVLTRKWTRIQPVGEPPSPR  102



>ref|XP_009144526.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Brassica 
rapa]
Length=880

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M  KP+++PAP Y+++ETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            N      IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   NSPSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPR  100



>emb|CDX97296.1| BnaA02g20870D [Brassica napus]
Length=874

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M  KP+++PAP Y+++ETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            N      IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   NSPSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPR  100



>ref|XP_002301559.1| phosphatase family protein [Populus trichocarpa]
 gb|EEE80832.1| phosphatase family protein [Populus trichocarpa]
Length=890

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 84/101 (83%), Gaps = 3/101 (3%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRALETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  378  nggp---giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                     RL G TN++HSYDVLTRKWTR+Q AGEPPSPR
Sbjct  61   ASSAPGISYRLDGATNSVHSYDVLTRKWTRIQAAGEPPSPR  101



>ref|XP_011011094.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X3 [Populus euphratica]
Length=781

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                 GIRL G TN++HSYDVLTRKW R+Q AGEPPSPR
Sbjct  61   ASSAPGIRLDGATNSVHSYDVLTRKWIRIQAAGEPPSPR  99



>ref|XP_008813651.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Phoenix dactylifera]
Length=351

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M  KPW  PAPTYR L+  WDTD+DAPGPRCGH+LTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MDTKPWPIPAPTYRPLDASWDTDDDAPGPRCGHSLTAVAATKSHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN+IHSYDV TRKWTRL P GEPPSPR
Sbjct  61   ASSAVPGIRLAGVTNSIHSYDVETRKWTRLHPVGEPPSPR  100



>ref|XP_008813652.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Phoenix dactylifera]
Length=350

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M  KPW  PAPTYR L+  WDTD+DAPGPRCGH+LTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MDTKPWPIPAPTYRPLDASWDTDDDAPGPRCGHSLTAVAATKSHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN+IHSYDV TRKWTRL P GEPPSPR
Sbjct  61   ASSAVPGIRLAGVTNSIHSYDVETRKWTRLHPVGEPPSPR  100



>ref|XP_008813653.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Phoenix dactylifera]
Length=349

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M  KPW  PAPTYR L+  WDTD+DAPGPRCGH+LTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MDTKPWPIPAPTYRPLDASWDTDDDAPGPRCGHSLTAVAATKSHGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN+IHSYDV TRKWTRL P GEPPSPR
Sbjct  61   ASSAVPGIRLAGVTNSIHSYDVETRKWTRLHPVGEPPSPR  100



>ref|XP_011011093.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
 ref|XP_011012420.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
Length=885

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                 GIRL G TN++HSYDVLTRKW R+Q AGEPPSPR
Sbjct  61   ASSAPGIRLDGATNSVHSYDVLTRKWIRIQAAGEPPSPR  99



>ref|XP_011011092.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
 ref|XP_011012419.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
Length=886

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  378  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                 GIRL G TN++HSYDVLTRKW R+Q AGEPPSPR
Sbjct  61   ASSAPGIRLDGATNSVHSYDVLTRKWIRIQAAGEPPSPR  99



>gb|AEK86563.1| serine/threonine-protein phosphatase [Camellia sinensis]
Length=888

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 85/101 (84%), Gaps = 3/101 (3%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +    YPAPTYR+LET+WD+D+D+PGPRC HTLTAV+ATK+ GPRLILFGGATAIEGG
Sbjct  1    MGSNRQFYPAPTYRTLETYWDSDDDSPGPRCSHTLTAVSATKSQGPRLILFGGATAIEGG  60

Query  378  nggpgi---RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                     RLAGVTNAIHSYDVLTRKWTRL+PAGEPPSPR
Sbjct  61   ASSSSAPGIRLAGVTNAIHSYDVLTRKWTRLRPAGEPPSPR  101



>emb|CAN67846.1| hypothetical protein VITISV_016669 [Vitis vinifera]
Length=208

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 80/127 (63%), Gaps = 30/127 (24%)
 Frame = +3

Query  201  AAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILF----------  350
             +KPWLYPAPTYR+LE++WDTD+DAPGPRCGHTLTA+A TKTHGPRLILF          
Sbjct  3    GSKPWLYPAPTYRTLESYWDTDDDAPGPRCGHTLTAIAPTKTHGPRLILFGGATAIEGGA  62

Query  351  --------------------ggataieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPA  470
                                     +        + LAGVTN++HSYDVLTRKWTRL+PA
Sbjct  63   SSSAPGIRTPHPIRFFFFVWIRVCVVASLCVVCFLGLAGVTNSVHSYDVLTRKWTRLRPA  122

Query  471  GEPPSPR  491
            GEPPS R
Sbjct  123  GEPPSVR  129



>ref|XP_010910522.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Elaeis guineensis]
Length=278

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 80/100 (80%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M  K W  PAPTYR L+  WD D+DAPGPRCGH+LT VAATK+HGPRL+LFGGATAIEGG
Sbjct  1    MGTKSWTIPAPTYRPLDASWDNDDDAPGPRCGHSLTTVAATKSHGPRLVLFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDV TRKWTRL P GEPPSPR
Sbjct  61   ASSAVPGIRLAGVTNSVHSYDVETRKWTRLHPVGEPPSPR  100



>ref|XP_010684726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Beta vulgaris 
subsp. vulgaris]
Length=877

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 3/100 (3%)
 Frame = +3

Query  201  AAKPWLYPAPTYRSL-ETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            ++KPWL PAP+Y  L ++FWD+DEDAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  3    SSKPWLQPAPSYTPLLDSFWDSDEDAPGPRCGHTLTAVAATKSQGPRLILFGGATAIEGG  62

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDVLT+KWTR++PAG+PPSPR
Sbjct  63   ASSSAPGIRLAGVTNSVHSYDVLTKKWTRIRPAGDPPSPR  102



>ref|XP_009385028.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Musa acuminata subsp. malaccensis]
Length=893

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +KPWL PAP YR L++ W+TD+DAPGPRCGH+LTAV A+K+ GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLIPAPNYRRLDSSWETDDDAPGPRCGHSLTAVDASKSRGPRLILFGGATAIEGG  60

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   IRLAGVTN++HSYDV TRKWTR+ P GEPPSPR
Sbjct  61   ASSAVPGIRLAGVTNSVHSYDVNTRKWTRIHPVGEPPSPR  100



>ref|XP_006846753.1| hypothetical protein AMTR_s00276p00018700, partial [Amborella 
trichopoda]
 gb|ERN08334.1| hypothetical protein AMTR_s00276p00018700, partial [Amborella 
trichopoda]
Length=218

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 81/112 (72%), Gaps = 14/112 (13%)
 Frame = +3

Query  198  MAAKPWLYPAP----TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH----------GP  335
            M +K  L PAP     YR ++T W+TDED+PGPRCGHTLT V+               GP
Sbjct  1    MGSKLRLCPAPLPASAYRVVDTSWETDEDSPGPRCGHTLTPVSTPSNSSSSSGSHHYVGP  60

Query  336  RLILFggataieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            RLILFGGATAIE  + G GIRLAGVTN++HSYDVLTRKWTRLQP+GEPPSPR
Sbjct  61   RLILFGGATAIEMSSTGAGIRLAGVTNSVHSYDVLTRKWTRLQPSGEPPSPR  112



>ref|XP_010904839.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 homolog [Elaeis guineensis]
Length=888

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M +K  L PAP+YR +E  W+   D+PGPRC HTLTAV AT +HGPRLILFGG TAIEG 
Sbjct  1    MGSKTRLVPAPSYRPVEASWEAAGDSPGPRCSHTLTAVPATGSHGPRLILFGGTTAIEGS  60

Query  378  n-ggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                PGIRLAGVTN++HS+DV TRKWTR+QPAGEPPSPR
Sbjct  61   XPPAPGIRLAGVTNSVHSFDVQTRKWTRIQPAGEPPSPR  99



>gb|AFW82656.1| hypothetical protein ZEAMMB73_760112 [Zea mays]
Length=491

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 77/102 (75%), Gaps = 3/102 (3%)
 Frame = +3

Query  195  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  371
            G A K  W+ PAP YR +E +    +DAPG RC H+LTAVA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDAPGFRCAHSLTAVAPTKGHGPRLILFGGATAIE  61

Query  372  ggnggp--giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G      GIRLAGVTN++HSYDV TR+WTRL PAGEPPSPR
Sbjct  62   TGASSGLPGIRLAGVTNSVHSYDVETRRWTRLHPAGEPPSPR  103



>ref|XP_004960470.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Setaria italica]
Length=887

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = +3

Query  195  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  371
            G A K  W+ PAP YR +E +    EDAPG RCGH+LTAVA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKNAWVVPAPAYREVEGWEGVGEDAPGFRCGHSLTAVAPTKGHGPRLILFGGATAIE  61

Query  372  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G       IRLAGVTN++HSYDV  R+WTRL PAGEPPSPR
Sbjct  62   AGASSGLPGIRLAGVTNSVHSYDVEKRRWTRLHPAGEPPSPR  103



>ref|XP_002439264.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
 gb|EES17694.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
Length=895

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = +3

Query  195  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  371
            G A K  W+ PAP YR +E +    +DAPG RCGH+LTAVA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGVGDDAPGFRCGHSLTAVAPTKGHGPRLILFGGATAIE  61

Query  372  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G       IRLAGVTN++HSYDV  RKWTRL PAGEPPSPR
Sbjct  62   AGASSGLPGIRLAGVTNSVHSYDVEKRKWTRLHPAGEPPSPR  103



>ref|XP_008795124.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Phoenix dactylifera]
Length=867

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            M ++  L PAP+YR +E  W+   DAPGPR  HTLTAV AT +HGPRLILFGG TAIEG 
Sbjct  1    MGSRTRLVPAPSYRPVEASWEAAGDAPGPRYAHTLTAVPATGSHGPRLILFGGGTAIEGS  60

Query  378  nggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
              GPGIRLAGVTN +HS+DV TRKWTR QPAG+PPSPR
Sbjct  61   PCGPGIRLAGVTNWVHSFDVRTRKWTRAQPAGQPPSPR  98



>ref|XP_008655295.1| PREDICTED: uncharacterized protein LOC100383776 isoform X2 [Zea 
mays]
Length=979

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = +3

Query  195  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  371
            G A K  W+ PAP YR +E +    +DAPG RC H+LTAVA TK HGPRLILFGGATAIE
Sbjct  94   GTAGKGAWVVPAPAYREVEGWEGAGDDAPGFRCAHSLTAVAPTKGHGPRLILFGGATAIE  153

Query  372  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPR
Sbjct  154  TGASSGLPGIRLAGVTNSVHSYDVETRRWTRLHPAGEPPSPR  195



>ref|XP_008655294.1| PREDICTED: uncharacterized protein LOC100383776 isoform X1 [Zea 
mays]
Length=987

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = +3

Query  195  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  371
            G A K  W+ PAP YR +E +    +DAPG RC H+LTAVA TK HGPRLILFGGATAIE
Sbjct  94   GTAGKGAWVVPAPAYREVEGWEGAGDDAPGFRCAHSLTAVAPTKGHGPRLILFGGATAIE  153

Query  372  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPR
Sbjct  154  TGASSGLPGIRLAGVTNSVHSYDVETRRWTRLHPAGEPPSPR  195



>ref|NP_001054625.1| Os05g0144400 [Oryza sativa Japonica Group]
 sp|Q60EX6.1|BSL1_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL1 homolog; 
AltName: Full=BSU1-like protein 1 homolog [Oryza sativa 
Japonica Group]
 gb|AAU90203.1| putative Serine/threonine protein phosphatase BSL1 [Oryza sativa 
Japonica Group]
 dbj|BAF16539.1| Os05g0144400 [Oryza sativa Japonica Group]
 dbj|BAG99920.1| unnamed protein product [Oryza sativa Japonica Group]
Length=883

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = +3

Query  195  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  371
            G A K  W+ PAP YR +E +    +D+PG RCGH+LT VA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDSPGFRCGHSLTVVAPTKGHGPRLILFGGATAIE  61

Query  372  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPR
Sbjct  62   AGASSGMPGIRLAGVTNSVHSYDVDTRRWTRLHPAGEPPSPR  103



>gb|EEE62303.1| hypothetical protein OsJ_17091 [Oryza sativa Japonica Group]
Length=877

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = +3

Query  195  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  371
            G A K  W+ PAP YR +E +    +D+PG RCGH+LT VA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDSPGFRCGHSLTVVAPTKGHGPRLILFGGATAIE  61

Query  372  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPR
Sbjct  62   AGASSGMPGIRLAGVTNSVHSYDVDTRRWTRLHPAGEPPSPR  103



>ref|NP_171844.6| serine/threonine-protein phosphatase BSU1 [Arabidopsis thaliana]
 sp|Q9LR78.2|BSU1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSU1; AltName: 
Full=Bri1 suppressor protein 1 [Arabidopsis thaliana]
 gb|AAR19789.1| BSU1 Ser/Thr phosphatase [Arabidopsis thaliana]
 gb|AEE27572.1| serine/threonine-protein phosphatase BSU1 [Arabidopsis thaliana]
Length=793

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 71/97 (73%), Gaps = 4/97 (4%)
 Frame = +3

Query  207  KPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggngg  386
            + + YP+P+Y S++TF+DTDED PGPRCGHTLTAV    +H  +LILFGG+T     +  
Sbjct  5    QSYQYPSPSYESIQTFYDTDEDWPGPRCGHTLTAVFVNNSH--QLILFGGSTTAVANHNS  62

Query  387  p--giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                I L GVTN++HS+DVLTRKWTRL P G+ PSPR
Sbjct  63   SLPEISLDGVTNSVHSFDVLTRKWTRLNPIGDVPSPR  99



>ref|XP_003568959.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Brachypodium distachyon]
Length=889

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 75/102 (74%), Gaps = 3/102 (3%)
 Frame = +3

Query  195  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  371
            G A K  W+ PAP YR +E +    +DAPG RCGH+LT +A TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDAPGYRCGHSLTFIAPTKGHGPRLILFGGATAIE  61

Query  372  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G       IRLAGVTN++HSYDV  R+WTR+ PAG+PPSPR
Sbjct  62   AGASSGLPGIRLAGVTNSVHSYDVEKRRWTRMHPAGDPPSPR  103



>ref|XP_010231726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Brachypodium distachyon]
Length=900

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 74/113 (65%), Gaps = 14/113 (12%)
 Frame = +3

Query  195  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  371
            G A K  W+ PAP YR +E +    +DAPG RCGH+LT +A TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDAPGYRCGHSLTFIAPTKGHGPRLILFGGATAIE  61

Query  372  ggnggpg-------------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G                   RLAGVTN++HSYDV  R+WTR+ PAG+PPSPR
Sbjct  62   AGASSGLPGISSVPPPSLAPPRLAGVTNSVHSYDVEKRRWTRMHPAGDPPSPR  114



>ref|XP_010231727.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Brachypodium distachyon]
Length=868

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 74/113 (65%), Gaps = 14/113 (12%)
 Frame = +3

Query  195  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  371
            G A K  W+ PAP YR +E +    +DAPG RCGH+LT +A TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDAPGYRCGHSLTFIAPTKGHGPRLILFGGATAIE  61

Query  372  ggnggpg-------------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G                   RLAGVTN++HSYDV  R+WTR+ PAG+PPSPR
Sbjct  62   AGASSGLPGISSVPPPSLAPPRLAGVTNSVHSYDVEKRRWTRMHPAGDPPSPR  114



>ref|XP_002892160.1| Serine/threonine-protein phosphatase BSU1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68419.1| Serine/threonine-protein phosphatase BSU1 [Arabidopsis lyrata 
subsp. lyrata]
Length=795

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 4/93 (4%)
 Frame = +3

Query  219  YPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggp--g  392
            YP+P+Y S++TF+DTDE  PGPRCGHTLT V    +H  +LILFGG++     +      
Sbjct  11   YPSPSYESIQTFYDTDEGWPGPRCGHTLTGVFVNNSH--QLILFGGSSTAVTTHDSSLPE  68

Query  393  iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            I L GVTN++HS+DVLTRKWTRL P G+ PSPR
Sbjct  69   ISLEGVTNSVHSFDVLTRKWTRLNPDGDVPSPR  101



>gb|KGN66599.1| hypothetical protein Csa_1G638460 [Cucumis sativus]
Length=736

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKT------HGPRLILFggataieggngg  386
            APTY  +    D  ED PGPRCGHTLTAV+A          GPRLILFGGATA+EG +  
Sbjct  72   APTYSVVNALMDKKEDGPGPRCGHTLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAA  131

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KWTR+ P GEPP+PR
Sbjct  132  AGTPTSAGNAGIRLAGATADVHCYDVLTNKWTRVTPLGEPPTPR  175



>ref|XP_010474966.1| PREDICTED: serine/threonine-protein phosphatase BSU1-like [Camelina 
sativa]
Length=800

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 67/100 (67%), Gaps = 5/100 (5%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            MA+  + Y + +Y  L+ F D DED PGPRCGHTLTA+ A  +H  +L+LFGG+T     
Sbjct  1    MASHSYPY-STSYDYLQNFSDNDEDWPGPRCGHTLTAIFANDSH--QLVLFGGSTDAVTT  57

Query  378  nggp--giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      I L GVTN++HS+DVLTRKWTR+   G+ PSPR
Sbjct  58   DDSSLPAISLGGVTNSVHSFDVLTRKWTRINTDGDLPSPR  97



>ref|XP_006367867.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Solanum 
tuberosum]
Length=367

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 67/104 (64%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY ++++  +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  51   APTYTAVQSVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  110

Query  387  pg---------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                       IRLAG T  +HSYDVLT KW+R+ P GEPP+PR
Sbjct  111  AAAPSSPGGAGIRLAGATADVHSYDVLTNKWSRITPIGEPPTPR  154



>ref|XP_010045170.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Eucalyptus 
grandis]
 gb|KCW87326.1| hypothetical protein EUGRSUZ_B03812 [Eucalyptus grandis]
Length=999

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 66/105 (63%), Gaps = 15/105 (14%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  383
            PAPTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG + 
Sbjct  64   PAPTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSA  123

Query  384  ---------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                       GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  124  ASGAPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  168



>gb|KHG00523.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=315

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 59/104 (57%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            AP Y  ++   +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  78   APPYSVVDAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  137

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  138  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  181



>ref|XP_004139147.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=981

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKT------HGPRLILFggataieggngg  386
            APTY  +    D  ED PGPRCGHTLTAV+A          GPRLILFGGATA+EG +  
Sbjct  45   APTYSVVNALMDKKEDGPGPRCGHTLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAA  104

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KWTR+ P GEPP+PR
Sbjct  105  AGTPTSAGNAGIRLAGATADVHCYDVLTNKWTRVTPLGEPPTPR  148



>ref|XP_008450272.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450273.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450274.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
Length=1008

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKT------HGPRLILFggataieggngg  386
            APTY  +    D  ED PGPRCGHTLTAV+A          GPRLILFGGATA+EG +  
Sbjct  72   APTYSVVNALMDKKEDGPGPRCGHTLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAA  131

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KWTR+ P GEPP+PR
Sbjct  132  AGTPTSAGNAGIRLAGATADVHCYDVLTNKWTRVTPLGEPPTPR  175



>ref|NP_172318.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 sp|Q9SJF0.2|BSL2_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL2; AltName: 
Full=BSU1-like protein 2 [Arabidopsis thaliana]
 gb|AEE28287.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1018

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 73/129 (57%), Gaps = 17/129 (13%)
 Frame = +3

Query  150  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  329
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  330  G------PRLILFggataie---------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQ  464
            G      PRL+LFGGATA+E            G  GIRLAG T  +H YDVL+ KWTRL 
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLT  179

Query  465  PAGEPPSPR  491
            P GEPP+PR
Sbjct  180  PFGEPPTPR  188



>ref|NP_001184935.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 gb|AEE28288.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1013

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 73/129 (57%), Gaps = 17/129 (13%)
 Frame = +3

Query  150  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  329
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  330  G------PRLILFggataie---------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQ  464
            G      PRL+LFGGATA+E            G  GIRLAG T  +H YDVL+ KWTRL 
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLT  179

Query  465  PAGEPPSPR  491
            P GEPP+PR
Sbjct  180  PFGEPPTPR  188



>ref|XP_010263036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Nelumbo 
nucifera]
Length=1015

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 65/105 (62%), Gaps = 15/105 (14%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie----  371
            PAPTY  +E   +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+E    
Sbjct  81   PAPTYSVVEANIEKKEDGPGPRCGHTLTAVAAVGEEGTAGYIGPRLILFGGATALEGNSA  140

Query  372  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                    G  GIRLAG T  +H YDV + KW+RL P GEPPSPR
Sbjct  141  ASGPPSSAGSAGIRLAGATADVHCYDVNSNKWSRLTPLGEPPSPR  185



>dbj|BAH19666.1| AT1G08420 [Arabidopsis thaliana]
Length=1018

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 73/129 (57%), Gaps = 17/129 (13%)
 Frame = +3

Query  150  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  329
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  330  G------PRLILFggataie---------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQ  464
            G      PRL+LFGGATA+E            G  GIRLAG T  +H YDVL+ KWTRL 
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLT  179

Query  465  PAGEPPSPR  491
            P GEPP+PR
Sbjct  180  PFGEPPTPR  188



>ref|XP_010247574.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nelumbo 
nucifera]
Length=1021

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 65/105 (62%), Gaps = 15/105 (14%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  371
            PAPTY  +E   +  ED PG RCGHTLTA+AA    G      PRLILFGGATA+E    
Sbjct  84   PAPTYSVVEAIIEKKEDGPGSRCGHTLTAIAAVGEEGTPGYIGPRLILFGGATALEGNAA  143

Query  372  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                    G  GIRLAG T  +H YDV++ KW+RL P GEPPSPR
Sbjct  144  ASGPPSSAGSAGIRLAGATADVHCYDVISNKWSRLTPLGEPPSPR  188



>gb|ABV91338.1| kelch repeat-containing protein /serine/threonine phosphoesterase 
family protein [Arabidopsis thaliana]
Length=1018

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 73/129 (57%), Gaps = 17/129 (13%)
 Frame = +3

Query  150  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  329
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  330  G------PRLILFggataie---------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQ  464
            G      PRL+LFGGATA+E            G  GIRLAG T  +H YDVL+ KWTRL 
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATPDVHCYDVLSNKWTRLT  179

Query  465  PAGEPPSPR  491
            P GEPP+PR
Sbjct  180  PFGEPPTPR  188



>gb|EYU25964.1| hypothetical protein MIMGU_mgv1a0006242mg, partial [Erythranthe 
guttata]
Length=340

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 62/104 (60%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            AP+Y  +    D  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  69   APSYSVVNALMDKKEDGPGPRCGHTLTAVPAVGEEGNPGYIGPRLILFGGATALEGNSAA  128

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YD LT KWTR+ P GEPP+PR
Sbjct  129  SGTPTSAGSAGIRLAGATADVHCYDALTNKWTRVTPIGEPPTPR  172



>ref|XP_010457353.1| PREDICTED: serine/threonine-protein phosphatase BSU1-like [Camelina 
sativa]
Length=796

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 5/100 (5%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  377
            MA+  + YP+ +Y  L+TF + DE  PGPRCGHTLTAV A  +H  +L+LFGG+T     
Sbjct  1    MASHSYPYPSTSYEYLQTFANDDE-WPGPRCGHTLTAVFANDSH--QLVLFGGSTTAVTT  57

Query  378  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            N      I L GVTN++HS+DVLTR+WTR+   G+ PSPR
Sbjct  58   NDYSLPGISLEGVTNSVHSFDVLTRRWTRIHTDGDLPSPR  97



>ref|XP_001760494.1| predicted protein [Physcomitrella patens]
 gb|EDQ74569.1| predicted protein [Physcomitrella patens]
Length=954

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 66/106 (62%), Gaps = 16/106 (15%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  383
            PAP +R +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG + 
Sbjct  7    PAPAFRMVSAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYVGPRLILFGGATALEGNSS  66

Query  384  gpg----------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
              G          IRLAG T  +H YDV +RKW+RL P G+PPSPR
Sbjct  67   AAGGPQTAAAGAGIRLAGATADVHCYDVTSRKWSRLIPVGDPPSPR  112



>gb|EYU41291.1| hypothetical protein MIMGU_mgv1a0202661mg, partial [Erythranthe 
guttata]
Length=340

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 62/104 (60%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            AP+Y  +    D  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  69   APSYSVVNALMDKKEDGPGPRCGHTLTAVPAVGEEGNPGYIGPRLILFGGATALEGNSAA  128

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YD LT KWTR+ P GEPP+PR
Sbjct  129  SGTPTSAGSAGIRLAGATADVHCYDALTNKWTRVTPIGEPPTPR  172



>ref|XP_007150014.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
 gb|ESW22008.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
Length=996

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  62   APTYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAA  121

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+RL P GEPP+PR
Sbjct  122  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRLTPFGEPPTPR  165



>gb|KHN47652.1| Serine/threonine-protein phosphatase BSL1 [Glycine soja]
Length=89

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  198  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILF  350
            M +K WLY  PTYR++ETFW TDE+AP P CGHT T VA TKT GP +ILF
Sbjct  1    MGSKSWLYLVPTYRTIETFWVTDENAPSPHCGHTFTVVATTKTQGPHVILF  51



>dbj|BAK03675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 63/103 (61%), Gaps = 13/103 (13%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  371
            PAP Y ++    D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  61   PAPGYTAVNAVIDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSA  120

Query  372  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPR
Sbjct  121  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPLGEPPSPR  163



>ref|XP_007015657.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015658.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015659.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33276.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33277.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33278.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
Length=1019

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 59/104 (57%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  84   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  143

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  144  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRISPFGEPPTPR  187



>ref|XP_008230041.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Prunus mume]
Length=1004

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGCIGPRLILFGGATALEGNSAA  132

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  176



>ref|XP_010488844.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Camelina 
sativa]
Length=1022

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 74/130 (57%), Gaps = 19/130 (15%)
 Frame = +3

Query  153  NQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG  332
            +  S  ++G  +L      P    APTY  ++   D  ED PGPRCGHTLTAV A    G
Sbjct  65   SSQSAPVVGQEQLQAQVVGPRC--APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEG  122

Query  333  ------PRLILFggataieggng-----------gpgiRLAGVTNAIHSYDVLTRKWTRL  461
                  PRL+LFGGATA+EG +G             GIRLAG T  +H YDVL+ KWTRL
Sbjct  123  TPGYIGPRLVLFGGATALEGNSGGGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRL  182

Query  462  QPAGEPPSPR  491
             P GEPP+PR
Sbjct  183  TPFGEPPTPR  192



>ref|XP_006369377.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
 gb|ERP65946.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
Length=1000

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    D  ED PGPRCGHTLT VAA    G      PRLILFGGATA+E     
Sbjct  77   APTYSVVNANMDKKEDGPGPRCGHTLTNVAAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KWTR+ P GEPP+PR
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWTRITPFGEPPTPR  180



>gb|KFK43163.1| hypothetical protein AALP_AA1G088000 [Arabis alpina]
Length=1016

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 64/105 (61%), Gaps = 16/105 (15%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  83   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  142

Query  372  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                    G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PR
Sbjct  143  TGTPTSAAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPR  187



>ref|XP_008230036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Prunus mume]
Length=1005

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGCIGPRLILFGGATALEGNSAA  132

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  176



>ref|XP_001781021.1| predicted protein [Physcomitrella patens]
 gb|EDQ54130.1| predicted protein [Physcomitrella patens]
Length=1047

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 62/104 (60%), Gaps = 14/104 (13%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILF--------gga  359
            PAPTYR + +  +  +D PGPRCGHTLTAVA+          GPRLILF          A
Sbjct  106  PAPTYRVVNSVIEKRDDGPGPRCGHTLTAVASVNEEGSPGYIGPRLILFGGATALEGSSA  165

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
               +  + G GIRLAG T  +H YDV + +WTR+ P G+PPSPR
Sbjct  166  AGPQAASSGAGIRLAGATADVHCYDVQSNQWTRITPVGDPPSPR  209



>ref|XP_002889692.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65951.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=1017

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  84   APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGG  143

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PR
Sbjct  144  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPR  187



>ref|XP_009336399.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009336400.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Pyrus x bretschneideri]
Length=1001

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  70   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGQPGYIGPRLILFGGATALEGNSAA  129

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  130  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  173



>ref|XP_009368358.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Pyrus x 
bretschneideri]
Length=1004

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  132

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  176



>ref|XP_007208428.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
 gb|EMJ09627.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
Length=1005

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  132

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  176



>ref|XP_006594918.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Glycine max]
Length=877

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  64   APTYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  123

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  124  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  167



>ref|XP_008361620.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Malus 
domestica]
Length=1001

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  70   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYFGPRLILFGGATALEGNSAA  129

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  130  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  173



>ref|XP_008385576.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Malus domestica]
Length=1002

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  71   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  130

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  131  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  174



>ref|XP_009398342.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=985

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 70/116 (60%), Gaps = 15/116 (13%)
 Frame = +3

Query  183  AELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLI  344
             E   +AA P   PAPT+  +    +  ED PG RCGHTLTAVAA    G      PRLI
Sbjct  41   VEAQAVAAGP--RPAPTFSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLI  98

Query  345  LFggataieggnggpg-------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            LFGGATA+EG +  P        IRLAG T  +H YDVL+ KWTRL P GEPPSPR
Sbjct  99   LFGGATALEGNSAAPASPAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPR  154



>ref|XP_009373887.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Pyrus 
x bretschneideri]
Length=1001

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  70   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGQPGYIGPRLILFGGATALEGNSAA  129

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  130  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  173



>ref|XP_009398341.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=986

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 70/116 (60%), Gaps = 15/116 (13%)
 Frame = +3

Query  183  AELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLI  344
             E   +AA P   PAPT+  +    +  ED PG RCGHTLTAVAA    G      PRLI
Sbjct  41   VEAQAVAAGP--RPAPTFSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLI  98

Query  345  LFggataieggnggpg-------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            LFGGATA+EG +  P        IRLAG T  +H YDVL+ KWTRL P GEPPSPR
Sbjct  99   LFGGATALEGNSAAPASPAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPR  154



>ref|XP_011044597.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 58/104 (56%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            APTY  +    D  ED PGPRCGHTLT VAA    G      PRLILF           +
Sbjct  77   APTYSVVNANMDKKEDGPGPRCGHTLTNVAAVGEEGTPGYIGPRLILFGGATALGGNSAS  136

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            T      G  GIRLAG T  +H YDVLT KWTR+ P GEPP+PR
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWTRITPFGEPPTPR  180



>ref|XP_010101992.1| Serine/threonine-protein phosphatase BSL2 [Morus notabilis]
 gb|EXB91212.1| Serine/threonine-protein phosphatase BSL2 [Morus notabilis]
Length=1084

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  86   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  145

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  146  SGTPSAAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  189



>ref|XP_007132502.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
 gb|ESW04496.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
Length=1007

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGSSAA  132

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDV+T KW+R+ P GEPP+PR
Sbjct  133  SGTPSSAGNAGIRLAGATADVHCYDVITNKWSRITPIGEPPTPR  176



>gb|KHG29076.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1016

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  84   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPSYIGPRLILFGGATALEGNSAS  143

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  144  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  187



>gb|KJB55556.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55557.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55558.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55559.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55560.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=1016

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  84   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPSYIGPRLILFGGATALEGNSAS  143

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  144  AGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  187



>emb|CDY22684.1| BnaC08g43180D [Brassica napus]
Length=995

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 66/105 (63%), Gaps = 16/105 (15%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  383
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+EG +G 
Sbjct  65   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGAPGYIGPRLVLFGGATALEGNSGG  124

Query  384  ---------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                       GIRLAG T  +H YDVL+ KWTRL P GEPP+PR
Sbjct  125  TGTPTSATPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPR  169



>ref|XP_010473113.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Camelina 
sativa]
Length=1011

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  81   APTYSVVNAIMEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  140

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPR
Sbjct  141  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPR  184



>ref|XP_009118376.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Brassica 
rapa]
Length=992

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 66/105 (63%), Gaps = 16/105 (15%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  383
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+EG +G 
Sbjct  62   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  121

Query  384  ---------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                       GIRLAG T  +H YDVL+ KWTRL P GEPP+PR
Sbjct  122  TGTPTSATPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPR  166



>ref|XP_010419412.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1003

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  74   APTYSVVNAIMEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  133

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPR
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPR  177



>ref|XP_004291538.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Fragaria 
vesca subsp. vesca]
Length=998

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 59/104 (57%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  64   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALEGNSAA  123

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YD+LT KW+R+ P GEPP+PR
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDILTNKWSRITPFGEPPTPR  167



>ref|XP_002976889.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
 gb|EFJ21999.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
Length=994

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 66/105 (63%), Gaps = 15/105 (14%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggng  383
            PAP+YR +    +  ED PGPRCGHTLT+VAA          GPRLILFGGATA+EG + 
Sbjct  62   PAPSYRVVNAIIEKKEDGPGPRCGHTLTSVAAVGEQGTAGYIGPRLILFGGATALEGNSA  121

Query  384  ---------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                       GIRLAG T  +H +D+++ KW+RL   GEPPSPR
Sbjct  122  AAPTPPPAGNAGIRLAGATADVHCFDIISNKWSRLNAVGEPPSPR  166



>gb|KDO46578.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=975

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  131

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  175



>ref|XP_003543410.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=988

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  64   APTYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  123

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  124  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  167



>emb|CDY06313.1| BnaA09g48900D [Brassica napus]
Length=992

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 66/105 (63%), Gaps = 16/105 (15%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  383
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+EG +G 
Sbjct  62   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  121

Query  384  ---------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                       GIRLAG T  +H YDVL+ KWTRL P GEPP+PR
Sbjct  122  TGTPTSATPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPR  166



>dbj|BAF00990.1| putative phosphoprotein phosphatase [Arabidopsis thaliana]
Length=707

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  133

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPR
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWSRLTPYGEPPSPR  177



>ref|XP_002980607.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
 gb|EFJ18258.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
Length=995

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 64/106 (60%), Gaps = 16/106 (15%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggn-  380
            PAP+YR +    +  ED PGPRCGHTLT+VAA          GPRLILFGGATA+EG + 
Sbjct  62   PAPSYRVVNAIIEKKEDGPGPRCGHTLTSVAAVGEQGTAGYIGPRLILFGGATALEGNSA  121

Query  381  ---------ggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                          RLAG T  +H +D+++ KW+RL   GEPPSPR
Sbjct  122  AAPTPPPAGNAGISRLAGATADVHCFDIISNKWSRLNAVGEPPSPR  167



>ref|XP_006826448.1| hypothetical protein AMTR_s00004p00175690 [Amborella trichopoda]
 gb|ERM93685.1| hypothetical protein AMTR_s00004p00175690 [Amborella trichopoda]
Length=1423

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 64/108 (59%), Gaps = 18/108 (17%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggng  383
            PAPTY  +    +  ED PGPRCGHTLTAVAA          GPRLILFGGATA+EG + 
Sbjct  66   PAPTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSS  125

Query  384  gpg------------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                           IRLAG T  +H YDVL+ KW+RL P GE PSPR
Sbjct  126  STAPSGPPSSGGNAGIRLAGATADVHCYDVLSNKWSRLTPLGEQPSPR  173



>ref|XP_006424082.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|ESR37322.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46576.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=999

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 59/104 (57%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  131

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  175



>ref|XP_006424083.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 ref|XP_006487860.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Citrus 
sinensis]
 gb|ESR37323.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46577.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=998

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 59/104 (57%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  131

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  175



>ref|XP_006408677.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
 gb|ESQ50130.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
Length=1005

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSGG  132

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPR
Sbjct  133  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPR  176



>ref|NP_001266022.1| Hop-interacting protein THI140 [Solanum lycopersicum]
 gb|AEW69826.1| Hop-interacting protein THI140 [Solanum lycopersicum]
Length=982

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 66/104 (63%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +++  +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  50   APTYTVVQSVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  109

Query  387  pg---------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                       IRLAG T  +HSYDVLT KW+R+ P GEPP+PR
Sbjct  110  AAAPSSPGGAGIRLAGATADVHSYDVLTNKWSRITPIGEPPTPR  153



>ref|XP_002879075.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55334.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=1002

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  70   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSGYIGPRLILFGGATALEGNSGG  129

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPR
Sbjct  130  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPR  173



>ref|XP_003596905.1| Serine/threonine protein phosphatase [Medicago truncatula]
 gb|AES67156.1| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=995

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            AP Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  64   APNYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  123

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+RL P GEPP+PR
Sbjct  124  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRLTPFGEPPTPR  167



>gb|KJB35474.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=982

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 59/104 (57%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVL+ KW+R+ P GEPP+PR
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYDVLSNKWSRITPFGEPPTPR  183



>ref|XP_006303893.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
 gb|EOA36791.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
Length=1018

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  85   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEGTPSYIGPRLVLFGGATALEGNSGG  144

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVL+ KW+RL P GEPP+PR
Sbjct  145  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWSRLTPFGEPPTPR  188



>ref|XP_010513312.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1045

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  136

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPR
Sbjct  137  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPR  180



>ref|XP_004487445.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cicer 
arietinum]
Length=1003

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            AP Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  70   APNYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  129

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+RL P GEPP+PR
Sbjct  130  SGTPTSAGNAGIRLAGATADVHCYDVLTNKWSRLTPFGEPPTPR  173



>ref|XP_010458078.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Camelina 
sativa]
Length=1017

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 66/106 (62%), Gaps = 17/106 (16%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  383
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+EG +G 
Sbjct  82   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGG  141

Query  384  ----------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                        GIRLAG T  +H YDVL+ KWTRL P GEPP+PR
Sbjct  142  GGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPR  187



>gb|KJB35473.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1001

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 59/104 (57%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVL+ KW+R+ P GEPP+PR
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYDVLSNKWSRITPFGEPPTPR  183



>ref|XP_009388972.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=986

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 70/116 (60%), Gaps = 15/116 (13%)
 Frame = +3

Query  183  AELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLI  344
            AE   +AA P   PAP Y  +    +  ED PG RCGHTLTAVAA    G      PRLI
Sbjct  40   AEAQPVAAGP--RPAPGYSVVNAVIERKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLI  97

Query  345  LFggataieggng-------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            LFGGATA+EG +          GIRLAG T  +H YDVL+ KWTR+ P GEPPSPR
Sbjct  98   LFGGATALEGNSAAPASPTGSAGIRLAGATADVHCYDVLSNKWTRVTPLGEPPSPR  153



>gb|KDP42962.1| hypothetical protein JCGZ_23904 [Jatropha curcas]
Length=1008

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 65/104 (63%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  383
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  133

Query  384  --------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                      GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  134  SGAPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  177



>pir||T00913 probable phosphoprotein phosphatase (EC 3.1.3.16) F21B7.27 - 
Arabidopsis thaliana
Length=729

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 55/78 (71%), Gaps = 4/78 (5%)
 Frame = +3

Query  264  DEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggpgiRLA--GVTNAIHSYDV  437
            DED PGPRCGHTLTAV    +H  +LILFGG+T     +      ++  GVTN++HS+DV
Sbjct  74   DEDWPGPRCGHTLTAVFVNNSH--QLILFGGSTTAVANHNSSLPEISLDGVTNSVHSFDV  131

Query  438  LTRKWTRLQPAGEPPSPR  491
            LTRKWTRL P G+ PSPR
Sbjct  132  LTRKWTRLNPIGDVPSPR  149



>gb|KHG22818.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1015

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 59/104 (57%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVL+ KW+R+ P GEPP+PR
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYDVLSNKWSRITPFGEPPTPR  183



>gb|KJB35470.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35471.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35472.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1015

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 59/104 (57%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVL+ KW+R+ P GEPP+PR
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYDVLSNKWSRITPFGEPPTPR  183



>gb|AFW68154.1| hypothetical protein ZEAMMB73_166373 [Zea mays]
Length=185

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 61/103 (59%), Gaps = 13/103 (13%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  371
            PAP Y  +    D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  59   PAPGYTVVNAVIDKKEDGPGCRCGHTLTAVPAVGEDGTPGYIGPRLILFGGATALEGNSA  118

Query  372  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                  G  GIRLAG T  +H YDV + KW+RL P GEPPSPR
Sbjct  119  TPPSSAGSAGIRLAGATADVHCYDVSSNKWSRLTPLGEPPSPR  161



>emb|CBI24435.3| unnamed protein product [Vitis vinifera]
Length=1049

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  43   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  102

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDV+T KW+R+ P GEPP+PR
Sbjct  103  SGTPSSAGSAGIRLAGATADVHCYDVITNKWSRITPFGEPPTPR  146



>ref|XP_006295510.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
 gb|EOA28408.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
Length=999

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  131

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPR
Sbjct  132  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPR  175



>ref|XP_009770253.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Nicotiana sylvestris]
Length=984

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    + +ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  62   APTYSVVHAVLEKEEDGPGPRCGHTLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAA  121

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPR  165



>ref|XP_002264614.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Vitis vinifera]
Length=1006

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  71   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  130

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDV+T KW+R+ P GEPP+PR
Sbjct  131  SGTPSSAGSAGIRLAGATADVHCYDVITNKWSRITPFGEPPTPR  174



>ref|XP_009770255.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Nicotiana sylvestris]
Length=949

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 59/104 (57%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            APTY  +    + +ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  62   APTYSVVHAVLEKEEDGPGPRCGHTLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAA  121

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPR  165



>ref|XP_010557449.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Tarenaya 
hassleriana]
Length=1008

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  81   APTYSVVNAIIENKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGG  140

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PR
Sbjct  141  TGTPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPYGEPPTPR  184



>ref|XP_009770254.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Nicotiana sylvestris]
Length=982

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    + +ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  62   APTYSVVHAVLEKEEDGPGPRCGHTLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAA  121

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPR  165



>ref|XP_008681453.1| PREDICTED: uncharacterized protein LOC100192777 isoform X1 [Zea 
mays]
 tpg|DAA47544.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=996

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 63/103 (61%), Gaps = 13/103 (13%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  371
            PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  61   PAPGYTVVDAAMDKKEDGPGSRCGHTLTAVPAAGEEGSPGYVGPRLILFGGATALEGNSA  120

Query  372  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                  G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPR
Sbjct  121  TPPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPR  163



>ref|XP_008681503.1| PREDICTED: uncharacterized protein LOC100192777 isoform X2 [Zea 
mays]
Length=995

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 63/103 (61%), Gaps = 13/103 (13%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  371
            PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  61   PAPGYTVVDAAMDKKEDGPGSRCGHTLTAVPAAGEEGSPGYVGPRLILFGGATALEGNSA  120

Query  372  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                  G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPR
Sbjct  121  TPPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPR  163



>ref|XP_006592783.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=998

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            AP+Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  67   APSYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  126

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  127  TGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  170



>ref|XP_009412503.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=981

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 65/103 (63%), Gaps = 13/103 (13%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  383
            PAPTYR + +  +  ED  G RCGHTLTAV A    G      PRLILFGGATA+EG + 
Sbjct  47   PAPTYRVVNSIIEKKEDGAGCRCGHTLTAVPAVGEEGTPGFIGPRLILFGGATALEGNSA  106

Query  384  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                     GIRLAG T  +H YDVL+ +WTRL P GEPPSPR
Sbjct  107  APPSPAGSAGIRLAGATADVHCYDVLSNRWTRLMPLGEPPSPR  149



>ref|XP_003539489.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1003

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            AP+Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  67   APSYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  126

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  127  TGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  170



>ref|XP_006417691.1| hypothetical protein EUTSA_v10006669mg [Eutrema salsugineum]
 gb|ESQ36044.1| hypothetical protein EUTSA_v10006669mg [Eutrema salsugineum]
Length=1012

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 63/105 (60%), Gaps = 16/105 (15%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            AP Y  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  78   APNYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  137

Query  372  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                    G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PR
Sbjct  138  TGTPTSAAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPR  182



>ref|XP_006591057.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Glycine max]
Length=1014

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  76   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAA  135

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDV++ KW+R+ P GEPP+PR
Sbjct  136  SGTPSSAGNAGIRLAGATADVHCYDVISNKWSRITPIGEPPTPR  179



>ref|XP_010475640.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X1 [Camelina sativa]
 ref|XP_010475641.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X2 [Camelina sativa]
Length=1023

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 66/107 (62%), Gaps = 18/107 (17%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  383
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+EG +G 
Sbjct  87   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGG  146

Query  384  -----------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                         GIRLAG T  +H YDVL+ KWTRL P GEPP+PR
Sbjct  147  GGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPR  193



>ref|XP_003538088.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=1010

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  76   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAA  135

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDV++ KW+R+ P GEPP+PR
Sbjct  136  SGTPSSAGNAGIRLAGATADVHCYDVISNKWSRITPIGEPPTPR  179



>ref|XP_009788953.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
 ref|XP_009788954.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
Length=709

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 64/105 (61%), Gaps = 16/105 (15%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  ++   +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  47   APTYTVVQAVMEKKEDGPGPRCGHTLTAVPAVGEEGTSNYIGPRLILFGGATALEGNSAA  106

Query  387  pg----------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                        IRLAG T  +H YDVLT KW+RL P GEPP+PR
Sbjct  107  SAPAPSSPGSAGIRLAGATADVHCYDVLTNKWSRLTPIGEPPTPR  151



>ref|XP_010544322.1| PREDICTED: serine/threonine-protein phosphatase BSL2 isoform 
X2 [Tarenaya hassleriana]
Length=991

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  82   APTYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGG  141

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PR
Sbjct  142  TGTPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPYGEPPTPR  185



>ref|XP_006592360.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Glycine max]
Length=986

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  68   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAV  127

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  IH YDV+T KW+R+ P GEPPS R
Sbjct  128  SGTPSSAGNAGIRLAGATADIHCYDVITNKWSRITPIGEPPSSR  171



>ref|XP_006592359.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=996

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  68   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAV  127

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  IH YDV+T KW+R+ P GEPPS R
Sbjct  128  SGTPSSAGNAGIRLAGATADIHCYDVITNKWSRITPIGEPPSSR  171



>ref|XP_004963199.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Setaria italica]
Length=997

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 63/103 (61%), Gaps = 13/103 (13%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  371
            PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  63   PAPGYTVVDAAMDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSA  122

Query  372  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                  G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPR
Sbjct  123  TPPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPR  165



>ref|XP_010544321.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Tarenaya hassleriana]
Length=1015

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  82   APTYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGG  141

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PR
Sbjct  142  TGTPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPYGEPPTPR  185



>ref|XP_002443577.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
 gb|EES17415.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
Length=1008

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 63/103 (61%), Gaps = 13/103 (13%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  371
            PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  74   PAPGYTVVDAAMDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSA  133

Query  372  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                  G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPR
Sbjct  134  TPPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPR  176



>ref|XP_003540821.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1001

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  68   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAV  127

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  IH YDV+T KW+R+ P GEPPS R
Sbjct  128  SGTPSSAGNAGIRLAGATADIHCYDVITNKWSRITPIGEPPSSR  171



>ref|NP_180289.3| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 sp|Q9SHS7.2|BSL3_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL3; AltName: 
Full=BSU1-like protein 3 [Arabidopsis thaliana]
 gb|AEC07953.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1006

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  133

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPR
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWSRLTPYGEPPSPR  177



>ref|XP_011008746.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  180



>ref|NP_001189614.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 gb|AEC07954.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1001

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  133

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPR
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWSRLTPYGEPPSPR  177



>ref|XP_008674098.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Zea mays]
 tpg|DAA54714.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=998

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 68/112 (61%), Gaps = 15/112 (13%)
 Frame = +3

Query  195  GMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFgg  356
            G+ A P   PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGG
Sbjct  57   GLVAGP--RPAPGYTVVDAAMDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGG  114

Query  357  ataieggng-------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            ATA+EG +          GIRLAG T  +H YDVL+ KWTRL P GEPPSPR
Sbjct  115  ATALEGNSATPPSPAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPR  166



>ref|XP_006361106.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=997

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  64   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  123

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPR  167



>ref|XP_011008648.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Populus 
euphratica]
Length=1011

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  180



>ref|XP_010322449.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Solanum lycopersicum]
Length=994

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  62   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  121

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPR  165



>emb|CDX97481.1| BnaC08g13460D [Brassica napus]
Length=992

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 69/122 (57%), Gaps = 16/122 (13%)
 Frame = +3

Query  174  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------P  335
            +GG E            AP Y  ++   D  ED PGPRCGHTLTAV A    G      P
Sbjct  49   VGGGEAQSAQVVVGPRCAPPYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGP  108

Query  336  RLILFggataieggng----------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPS  485
            RL+LFGGATA+EG +G            GIRLAG T  +H YDVL+ KWTRL P GEPP+
Sbjct  109  RLVLFGGATALEGNSGGTGTPTSAAPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPT  168

Query  486  PR  491
            PR
Sbjct  169  PR  170



>ref|XP_002313501.2| kelch repeat-containing family protein [Populus trichocarpa]
 gb|EEE87456.2| kelch repeat-containing family protein [Populus trichocarpa]
Length=993

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  180



>ref|NP_001275238.1| serine/threonine-protein phosphatase BSL3-like [Solanum tuberosum]
 gb|AFN44701.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=999

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  64   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  123

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPR  167



>ref|XP_009110896.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Brassica 
rapa]
Length=990

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 68/122 (56%), Gaps = 16/122 (13%)
 Frame = +3

Query  174  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------P  335
            +GG E            AP Y  ++   D  ED PGPRCGHTLTAV A    G      P
Sbjct  47   VGGGEAQSAQVVVGPRCAPPYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGP  106

Query  336  RLILFggataieggng----------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPS  485
            RL+LFGGATA+E  +G            GIRLAG T  +H YDVL+ KWTRL P GEPP+
Sbjct  107  RLVLFGGATALEDNSGGTGTPTSAAPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPT  166

Query  486  PR  491
            PR
Sbjct  167  PR  168



>emb|CDY31148.1| BnaA08g26980D [Brassica napus]
Length=990

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 69/122 (57%), Gaps = 16/122 (13%)
 Frame = +3

Query  174  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------P  335
            +GG E            AP Y  ++   D  ED PGPRCGHTLTAV A    G      P
Sbjct  47   VGGGEAQSAQVVVGPRCAPPYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTNGYIGP  106

Query  336  RLILFggataieggng----------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPS  485
            RL+LFGGATA+EG +G            GIRLAG T  +H YDVL+ KWTRL P GEPP+
Sbjct  107  RLVLFGGATALEGNSGGTGTPTSAAPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPT  166

Query  486  PR  491
            PR
Sbjct  167  PR  168



>ref|XP_011090290.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Sesamum indicum]
Length=1005

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 58/104 (56%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  72   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAA  131

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPR  175



>ref|XP_004241349.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Solanum lycopersicum]
Length=996

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  62   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  121

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPR  165



>ref|XP_009587046.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=989

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  62   APTYSVVHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  121

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  122  SGTPSAAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPR  165



>gb|EYU36016.1| hypothetical protein MIMGU_mgv1a000720mg [Erythranthe guttata]
Length=1005

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 62/104 (60%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            AP Y  +    D  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  73   APMYTVVNALMDKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSGA  132

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPR  176



>ref|XP_011090288.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Sesamum indicum]
Length=1007

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 58/104 (56%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  72   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAA  131

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPR  175



>ref|XP_011090289.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Sesamum indicum]
Length=1006

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 58/104 (56%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  72   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAA  131

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPR  175



>ref|XP_009587040.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=991

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  62   APTYSVVHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  121

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  122  SGTPSAAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPR  165



>ref|XP_009587594.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
tomentosiformis]
Length=978

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 64/105 (61%), Gaps = 16/105 (15%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  ++   +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  47   APTYTVVQAVMEKKEDGPGPRCGHTLTAVPAVGEEGSSNYIGPRLILFGGATALEGNSAA  106

Query  387  pg----------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                        IRLAG T  +H YDVLT KW+RL P GEPP+PR
Sbjct  107  SAPAPSSPGSAGIRLAGATADVHCYDVLTNKWSRLTPIGEPPTPR  151



>ref|XP_009587053.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Nicotiana tomentosiformis]
Length=956

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  62   APTYSVVHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  121

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  122  SGTPSAAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPR  165



>emb|CDP15567.1| unnamed protein product [Coffea canephora]
Length=1012

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  82   APTYTVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  141

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  142  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPR  185



>ref|XP_006340328.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=994

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  64   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  123

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPR  167



>gb|KJB21740.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
 gb|KJB21741.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
Length=1013

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            AP Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  78   APPYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  137

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  138  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  181



>ref|XP_006340327.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Solanum tuberosum]
Length=996

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  64   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  123

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPR  167



>gb|AES88189.2| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=999

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 64/104 (62%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            AP+Y  ++   +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  69   APSYTVVDAILEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSAA  128

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  129  SGTPTSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  172



>ref|XP_009598633.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=305

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 56/104 (54%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            AP Y  +    +  ED PG RCGHTLTAV A    G      PRLILF           A
Sbjct  63   APAYSVVHAVLEKKEDGPGSRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSAA  122

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  123  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPR  166



>emb|CDY57791.1| BnaCnng32470D [Brassica napus]
Length=997

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 63/105 (60%), Gaps = 16/105 (15%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggn--  380
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  65   APPYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSGG  124

Query  381  --------ggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                       GIRLAG T  +H YDVLT KW+RL P GEPPSPR
Sbjct  125  TGTPTSAGSAGGIRLAGATADVHCYDVLTNKWSRLSPHGEPPSPR  169



>ref|XP_010658896.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X4 [Vitis vinifera]
Length=869

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 62/103 (60%), Gaps = 15/103 (15%)
 Frame = +3

Query  228  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  383
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  384  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PR
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPR  144



>ref|XP_009598634.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=289

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 56/104 (54%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            AP Y  +    +  ED PG RCGHTLTAV A    G      PRLILF           A
Sbjct  63   APAYSVVHAVLEKKEDGPGSRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSAA  122

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  123  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPR  166



>gb|EEC75832.1| hypothetical protein OsI_12812 [Oryza sativa Indica Group]
Length=1003

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 63/103 (61%), Gaps = 13/103 (13%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  371
            PAP Y ++    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  68   PAPGYTAVSAVIEKKEDGPGCRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSA  127

Query  372  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPR
Sbjct  128  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPQGEPPSPR  170



>gb|ABF97885.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
Length=1003

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 63/103 (61%), Gaps = 13/103 (13%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  371
            PAP Y ++    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  68   PAPGYTAVSAVIEKKEDGPGCRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSA  127

Query  372  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPR
Sbjct  128  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPQGEPPSPR  170



>ref|XP_009795596.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL3-like [Nicotiana sylvestris]
Length=989

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 62/104 (60%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY       +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  64   APTYSVAHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  123

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  124  PGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPR  167



>ref|XP_010658894.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Vitis vinifera]
Length=884

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 62/103 (60%), Gaps = 15/103 (15%)
 Frame = +3

Query  228  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  383
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  384  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PR
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPR  144



>ref|XP_008449600.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Cucumis 
melo]
Length=1002

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 62/104 (60%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    D  ED PGPRCGHTLTAV +    G      PRLILFGGATA+E     
Sbjct  69   APTYSVVNAIIDKKEDGPGPRCGHTLTAVGSVGEEGTPGYIGPRLILFGGATALEGNSAA  128

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H +DVL  KW+R+ P GEPP+PR
Sbjct  129  SGTPSSAGSAGIRLAGATADVHCFDVLANKWSRITPLGEPPTPR  172



>ref|XP_009140775.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Brassica 
rapa]
Length=998

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 61/105 (58%), Gaps = 16/105 (15%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataie-----  371
            AP Y  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+E     
Sbjct  66   APPYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEERSANYIGPRLILFGGATALEGNSGG  125

Query  372  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                       GIRLAG T  +H YDVLT KW+RL P GEPPSPR
Sbjct  126  TGTPTSAGSAGGIRLAGATADVHCYDVLTNKWSRLTPHGEPPSPR  170



>ref|XP_010658895.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Vitis vinifera]
Length=875

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 62/104 (60%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  383
             PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  41   VPTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATT  100

Query  384  --------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                       IRLAG T  +H YD+ ++KW+R+ P GEPP+PR
Sbjct  101  SGALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPR  144



>ref|XP_002262846.2| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Vitis vinifera]
 ref|XP_010658893.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Vitis vinifera]
Length=976

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 62/103 (60%), Gaps = 15/103 (15%)
 Frame = +3

Query  228  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  383
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  384  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PR
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPR  144



>emb|CDY57485.1| BnaAnng14650D [Brassica napus]
Length=998

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 61/105 (58%), Gaps = 16/105 (15%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  66   APPYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSGG  125

Query  372  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                       GIRLAG T  +H YDVLT KW+RL P GEPPSPR
Sbjct  126  TGTPTSAGSAGGIRLAGATADVHCYDVLTNKWSRLTPHGEPPSPR  170



>ref|XP_010685448.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Beta vulgaris 
subsp. vulgaris]
Length=1019

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 62/104 (60%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            AP+Y  +    D  ED  GPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  85   APSYSVVNAIIDKKEDGAGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  144

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  IH YDVLT KW+R+ P GEPP+PR
Sbjct  145  AGTPSSAGSAGIRLAGATADIHCYDVLTNKWSRIAPIGEPPTPR  188



>emb|CBI24997.3| unnamed protein product [Vitis vinifera]
Length=928

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 62/103 (60%), Gaps = 15/103 (15%)
 Frame = +3

Query  228  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  383
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  384  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PR
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPR  144



>ref|XP_011088984.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Sesamum indicum]
Length=1013

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 57/104 (55%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  81   APMYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  140

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  141  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRVTPIGEPPTPR  184



>ref|XP_004506226.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004506227.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Cicer arietinum]
Length=1003

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 63/104 (61%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            AP+Y  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  68   APSYTVVNAILEKKEDGPGPRCGHTLTAVPAVGEDGTPGYIGPRLILFGGATALEGNSAA  127

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  128  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPR  171



>ref|XP_011088983.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Sesamum indicum]
Length=1015

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 57/104 (55%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  359
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  81   APMYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  140

Query  360  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PR
Sbjct  141  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRVTPIGEPPTPR  184



>ref|XP_001765008.1| predicted protein [Physcomitrella patens]
 gb|EDQ70224.1| predicted protein [Physcomitrella patens]
Length=986

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 15/105 (14%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  383
            PAP ++++    +  +D PGPRCGHTLTAVAA    G      PRLILFGGATA+EG + 
Sbjct  34   PAPAFKAITAICERKDDGPGPRCGHTLTAVAAVGEEGSPAYIGPRLILFGGATALEGNSS  93

Query  384  gpg---------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
              G         IRLAG T  +H YD  T KW+RL P G+PPSPR
Sbjct  94   QAGPQTAVAGAGIRLAGATADVHCYDAHTNKWSRLIPVGDPPSPR  138



>ref|XP_008811286.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Phoenix dactylifera]
Length=994

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 61/100 (61%), Gaps = 13/100 (13%)
 Frame = +3

Query  231  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  371
            TY  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  61   TYSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPP  120

Query  372  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPR
Sbjct  121  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPR  160



>ref|XP_008811284.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Phoenix dactylifera]
Length=995

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 61/100 (61%), Gaps = 13/100 (13%)
 Frame = +3

Query  231  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  371
            TY  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  61   TYSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPP  120

Query  372  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPR
Sbjct  121  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPR  160



>ref|XP_010941606.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Elaeis guineensis]
Length=978

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 61/100 (61%), Gaps = 13/100 (13%)
 Frame = +3

Query  231  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  371
            TY  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  43   TYSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAAPP  102

Query  372  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPR
Sbjct  103  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPR  142



>ref|XP_008811285.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Phoenix dactylifera]
Length=995

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 61/100 (61%), Gaps = 13/100 (13%)
 Frame = +3

Query  231  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  371
            TY  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  61   TYSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPP  120

Query  372  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPR
Sbjct  121  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPR  160



>ref|XP_010313488.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum lycopersicum]
Length=995

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 62/104 (60%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  65   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  124

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDV T KW+R+ P GEPP+PR
Sbjct  125  SGTPSSAGSAGIRLAGATADVHCYDVFTNKWSRITPIGEPPTPR  168



>ref|XP_004251224.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Solanum lycopersicum]
Length=997

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 62/104 (60%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  65   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  124

Query  387  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G          RLAG T  +H YDV T KW+R+ P GEPP+PR
Sbjct  125  SGTPSSAGSAGIRLAGATADVHCYDVFTNKWSRITPIGEPPTPR  168



>gb|EPS70499.1| hypothetical protein M569_04238, partial [Genlisea aurea]
Length=1011

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 62/104 (60%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PR+ILFGGATA+E     
Sbjct  74   APMYNVVNVIIEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRMILFGGATALEGNSGG  133

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  IH YDV+T KW+R+ P GEPP+PR
Sbjct  134  TGTPTSAGSAGIRLAGATADIHCYDVMTNKWSRMTPIGEPPTPR  177



>gb|AAD26883.1| putative phosphoprotein phosphatase [Arabidopsis thaliana]
Length=715

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 60/104 (58%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  50   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  109

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                  +      LAG T  +H YDVL+ KW+RL P GEPPSPR
Sbjct  110  TGTPTSSNVSYAGLAGATADVHCYDVLSNKWSRLTPYGEPPSPR  153



>ref|XP_006651637.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=940

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 62/103 (60%), Gaps = 13/103 (13%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  371
            PAP Y  +    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  5    PAPGYTVVSAVIEKKEDGPGCRCGHTLTAVPAVGEDGTPGYIGPRLILFGGATALEGNSA  64

Query  372  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPR
Sbjct  65   TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPQGEPPSPR  107



>ref|XP_009418973.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=982

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 63/103 (61%), Gaps = 13/103 (13%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  383
            PAPTYR +    +  ED  G RCGHTLTAV      G      PRLILFGGATA+EG + 
Sbjct  47   PAPTYRVVNAIIEKKEDGAGCRCGHTLTAVPPVGEEGTPGYIGPRLILFGGATALEGNSA  106

Query  384  g-------pgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                     GIRLAG T  +H YD+L+ KWTRL P GEPPSPR
Sbjct  107  APPSPAGTAGIRLAGATADVHCYDMLSNKWTRLTPLGEPPSPR  149



>ref|XP_001769730.1| predicted protein [Physcomitrella patens]
 gb|EDQ65531.1| predicted protein [Physcomitrella patens]
Length=962

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 65/104 (63%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  386
            AP Y+++    +  +D PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  25   APAYKAITAICERKDDGPGPRCGHTLTAVAAVGEEGKLAYVGPRLILFGGATALEGNSSQ  84

Query  387  pg---------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
             G         IRLAG T  +H YD+ + KW+RL P G+PPSPR
Sbjct  85   AGPQMAVAGAGIRLAGATADVHCYDIHSNKWSRLIPVGDPPSPR  128



>ref|XP_010232097.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
isoform X1 [Brachypodium distachyon]
Length=1021

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 63/103 (61%), Gaps = 13/103 (13%)
 Frame = +3

Query  222  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  371
            PAP Y ++    +  ED PG RCGHTLT+V A    G      PRLILFGGATA+E    
Sbjct  60   PAPGYTAVTAVIEKKEDGPGCRCGHTLTSVPAVGEEGSQSYVGPRLILFGGATALEGNSA  119

Query  372  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPR
Sbjct  120  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPLGEPPSPR  162



>gb|EPS67556.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=238

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 60/104 (58%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGP------RLILFggataie-----  371
            AP Y  +    +  ED PGPRCGHTLTAV A    G       R+ILFGGATA+E     
Sbjct  5    APMYNVVNAVMEKKEDGPGPRCGHTLTAVTAVGEEGSPGYIGARMILFGGATALEGNSGG  64

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H YDV T KW+R+ P GEPP+PR
Sbjct  65   TGTPTSAGSAGIRLAGATADVHCYDVSTNKWSRITPIGEPPTPR  108



>ref|XP_004140171.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
 gb|KGN48053.1| hypothetical protein Csa_6G426880 [Cucumis sativus]
Length=1002

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 61/104 (59%), Gaps = 15/104 (14%)
 Frame = +3

Query  225  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  371
            AP Y  +    D  ED PGPRCGHTLTAV +    G      PRLILFGGATA+E     
Sbjct  69   APAYSVVNAIIDKKEDGPGPRCGHTLTAVGSVGEEGTPGYIGPRLILFGGATALEGNSAA  128

Query  372  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPR  491
                   G  GIRLAG T  +H +DVL  KW+R+ P GEPP+PR
Sbjct  129  SGTPSSAGSAGIRLAGATADVHCFDVLANKWSRITPLGEPPTPR  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720