BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF012M12

Length=520
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357614.1|  PREDICTED: glutamate--glyoxylate aminotransf...    201   1e-58   Solanum tuberosum [potatoes]
ref|XP_004239121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    201   1e-58   Solanum lycopersicum
emb|CDP13207.1|  unnamed protein product                                199   1e-57   Coffea canephora [robusta coffee]
gb|EPS68501.1|  hypothetical protein M569_06265                         199   1e-57   Genlisea aurea
ref|XP_009623844.1|  PREDICTED: glutamate--glyoxylate aminotransf...    197   3e-57   Nicotiana tomentosiformis
ref|XP_009765091.1|  PREDICTED: glutamate--glyoxylate aminotransf...    197   3e-57   Nicotiana sylvestris
ref|XP_009624740.1|  PREDICTED: glutamate--glyoxylate aminotransf...    196   9e-57   Nicotiana tomentosiformis
ref|XP_009759837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    196   1e-56   Nicotiana sylvestris
ref|XP_006416098.1|  hypothetical protein EUTSA_v10007514mg             192   2e-56   
ref|XP_010682426.1|  PREDICTED: glutamate--glyoxylate aminotransf...    195   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010552672.1|  PREDICTED: glutamate--glyoxylate aminotransf...    195   3e-56   Tarenaya hassleriana [spider flower]
gb|EYU28421.1|  hypothetical protein MIMGU_mgv1a005535mg                195   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_004489787.1|  PREDICTED: glutamate--glyoxylate aminotransf...    195   4e-56   Cicer arietinum [garbanzo]
ref|XP_004489786.1|  PREDICTED: glutamate--glyoxylate aminotransf...    195   4e-56   
ref|XP_009115544.1|  PREDICTED: glutamate--glyoxylate aminotransf...    194   5e-56   Brassica rapa
ref|NP_001031083.1|  glutamate:glyoxylate aminotransferase              193   7e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307377.1|  hypothetical protein CARUB_v10009003mg             194   8e-56   Capsella rubella
ref|XP_002887312.1|  alanine-2-oxoglutarate aminotransferase 2          193   1e-55   Arabidopsis lyrata subsp. lyrata
gb|AAK25905.1|AF360195_1  putative alanine aminotransferase             193   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564192.2|  glutamate:glyoxylate aminotransferase                 193   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011071137.1|  PREDICTED: glutamate--glyoxylate aminotransf...    193   1e-55   
gb|AAL24255.1|  At1g23310/F26F24_4                                      193   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177215.1|  glutamate--glyoxylate aminotransferase 2              193   1e-55   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20108.1|  AT1G70580                                              193   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003613139.1|  Alanine aminotransferase                           193   1e-55   Medicago truncatula
ref|XP_002893277.1|  alanine-2-oxoglutarate aminotransferase 1          193   1e-55   
ref|XP_010477627.1|  PREDICTED: glutamate--glyoxylate aminotransf...    193   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_003613140.1|  Alanine aminotransferase                           193   2e-55   
emb|CBI23368.3|  unnamed protein product                                193   2e-55   Vitis vinifera
emb|CAN62302.1|  hypothetical protein VITISV_023686                     193   2e-55   Vitis vinifera
ref|NP_001268094.1|  uncharacterized protein LOC100261274               193   2e-55   Vitis vinifera
ref|XP_010927963.1|  PREDICTED: glutamate--glyoxylate aminotransf...    192   2e-55   Elaeis guineensis
ref|XP_010427837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    192   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010471056.1|  PREDICTED: glutamate--glyoxylate aminotransf...    192   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010415743.1|  PREDICTED: glutamate--glyoxylate aminotransf...    192   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006378236.1|  hypothetical protein POPTR_0010s05530g             189   2e-55   
ref|XP_006300456.1|  hypothetical protein CARUB_v10020212mg             192   3e-55   
ref|XP_004228555.1|  PREDICTED: glutamate--glyoxylate aminotransf...    192   3e-55   Solanum lycopersicum
ref|XP_006416099.1|  hypothetical protein EUTSA_v10007514mg             192   3e-55   
ref|XP_006438273.1|  hypothetical protein CICLE_v10031381mg             190   3e-55   
gb|AAZ43368.1|  AlaT1                                                   192   4e-55   Vitis labrusca [Concord grape]
gb|KDP26646.1|  hypothetical protein JCGZ_17804                         192   4e-55   Jatropha curcas
ref|XP_006390865.1|  hypothetical protein EUTSA_v10018474mg             192   5e-55   
ref|XP_010498838.1|  PREDICTED: glutamate--glyoxylate aminotransf...    192   5e-55   Camelina sativa [gold-of-pleasure]
emb|CDY61225.1|  BnaC06g43710D                                          192   5e-55   Brassica napus [oilseed rape]
ref|XP_010251104.1|  PREDICTED: glutamate--glyoxylate aminotransf...    192   5e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010460118.1|  PREDICTED: glutamate--glyoxylate aminotransf...    191   6e-55   Camelina sativa [gold-of-pleasure]
gb|KHG15331.1|  Glutamate--glyoxylate aminotransferase 2 -like pr...    191   6e-55   Gossypium arboreum [tree cotton]
ref|XP_009105727.1|  PREDICTED: glutamate--glyoxylate aminotransf...    191   6e-55   Brassica rapa
ref|XP_002527918.1|  alanine aminotransferase, putative                 191   6e-55   
ref|XP_010023477.1|  PREDICTED: glutamate--glyoxylate aminotransf...    191   7e-55   Eucalyptus grandis [rose gum]
gb|KDO82251.1|  hypothetical protein CISIN_1g041151mg                   191   7e-55   Citrus sinensis [apfelsine]
ref|XP_006658210.1|  PREDICTED: glutamate--glyoxylate aminotransf...    191   8e-55   
ref|XP_006348507.1|  PREDICTED: glutamate--glyoxylate aminotransf...    191   9e-55   
ref|XP_010100388.1|  Glutamate--glyoxylate aminotransferase 2           191   9e-55   Morus notabilis
emb|CDY66294.1|  BnaAnng22050D                                          191   1e-54   Brassica napus [oilseed rape]
ref|XP_006438274.1|  hypothetical protein CICLE_v10031381mg             191   1e-54   Citrus clementina [clementine]
ref|XP_004955317.1|  PREDICTED: glutamate--glyoxylate aminotransf...    190   1e-54   Setaria italica
ref|XP_004309987.1|  PREDICTED: glutamate--glyoxylate aminotransf...    191   1e-54   Fragaria vesca subsp. vesca
ref|XP_009359228.1|  PREDICTED: glutamate--glyoxylate aminotransf...    190   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_008340115.1|  PREDICTED: glutamate--glyoxylate aminotransf...    190   2e-54   Malus domestica [apple tree]
gb|AAO84040.1|  alanine aminotransferase                                190   2e-54   Oryza sativa Indica Group [Indian rice]
ref|NP_001058716.1|  Os07g0108300                                       190   2e-54   
gb|KJB31174.1|  hypothetical protein B456_005G179600                    188   2e-54   Gossypium raimondii
ref|XP_006840828.1|  hypothetical protein AMTR_s00083p00031040          190   2e-54   Amborella trichopoda
gb|AAM61453.1|  putative alanine aminotransferase                       190   2e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CDY41452.1|  BnaA08g20540D                                          190   2e-54   Brassica napus [oilseed rape]
ref|XP_007044762.1|  Alanine-2-oxoglutarate aminotransferase 2 is...    190   2e-54   
ref|XP_009110107.1|  PREDICTED: glutamate--glyoxylate aminotransf...    190   2e-54   Brassica rapa
ref|XP_008446998.1|  PREDICTED: glutamate--glyoxylate aminotransf...    183   3e-54   
ref|XP_002315675.1|  hypothetical protein POPTR_0010s05530g             190   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_009103182.1|  PREDICTED: glutamate--glyoxylate aminotransf...    190   3e-54   Brassica rapa
ref|XP_004955316.1|  PREDICTED: glutamate--glyoxylate aminotransf...    191   3e-54   
ref|XP_008789746.1|  PREDICTED: glutamate--glyoxylate aminotransf...    189   3e-54   
ref|XP_009413361.1|  PREDICTED: glutamate--glyoxylate aminotransf...    189   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008221924.1|  PREDICTED: glutamate--glyoxylate aminotransf...    189   4e-54   Prunus mume [ume]
ref|XP_009406515.1|  PREDICTED: glutamate--glyoxylate aminotransf...    189   4e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003557680.1|  PREDICTED: glutamate--glyoxylate aminotransf...    189   5e-54   Brachypodium distachyon [annual false brome]
ref|XP_007222799.1|  hypothetical protein PRUPE_ppa005017mg             189   5e-54   Prunus persica
ref|XP_003519649.1|  PREDICTED: glutamate--glyoxylate aminotransf...    189   7e-54   Glycine max [soybeans]
ref|NP_001237581.1|  alanine aminotransferase 3                         189   8e-54   Glycine max [soybeans]
ref|NP_001237567.1|  alanine aminotransferase 2                         188   8e-54   
gb|KHN14541.1|  Glutamate--glyoxylate aminotransferase 2                188   9e-54   Glycine soja [wild soybean]
gb|KJB31170.1|  hypothetical protein B456_005G179600                    188   9e-54   Gossypium raimondii
ref|XP_011014669.1|  PREDICTED: glutamate--glyoxylate aminotransf...    188   1e-53   Populus euphratica
gb|AET06145.1|  PLP-dependent aminotransferase                          188   1e-53   Papaver somniferum
ref|XP_008389735.1|  PREDICTED: glutamate--glyoxylate aminotransf...    188   1e-53   
ref|XP_010928898.1|  PREDICTED: glutamate--glyoxylate aminotransf...    188   1e-53   Elaeis guineensis
ref|NP_001151209.1|  alanine aminotransferase 2                         187   2e-53   
ref|XP_007158412.1|  hypothetical protein PHAVU_002G150800g             187   3e-53   Phaseolus vulgaris [French bean]
ref|XP_009105726.1|  PREDICTED: glutamate--glyoxylate aminotransf...    187   3e-53   Brassica rapa
emb|CDY12474.1|  BnaC07g13140D                                          187   4e-53   Brassica napus [oilseed rape]
ref|XP_002312679.2|  alanine-2-oxoglutarate aminotransferase 1 fa...    186   6e-53   Populus trichocarpa [western balsam poplar]
gb|EMT29455.1|  Alanine aminotransferase 2                              187   7e-53   
ref|XP_008447004.1|  PREDICTED: glutamate--glyoxylate aminotransf...    182   1e-52   
ref|XP_002968244.1|  hypothetical protein SELMODRAFT_145611             186   1e-52   Selaginella moellendorffii
ref|XP_004135487.1|  PREDICTED: glutamate--glyoxylate aminotransf...    185   1e-52   
gb|KGN51765.1|  hypothetical protein Csa_5G598730                       184   3e-52   Cucumis sativus [cucumbers]
ref|XP_004155366.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    184   3e-52   
gb|KGN51767.1|  hypothetical protein Csa_5G598750                       184   4e-52   Cucumis sativus [cucumbers]
ref|NP_001183048.1|  uncharacterized protein LOC100501386               184   6e-52   Zea mays [maize]
ref|XP_008444367.1|  PREDICTED: glutamate--glyoxylate aminotransf...    182   1e-51   Cucumis melo [Oriental melon]
ref|XP_001782822.1|  predicted protein                                  182   2e-51   
tpg|DAA42658.1|  TPA: LOW QUALITY PROTEIN: alanine aminotransfera...    182   2e-51   
tpg|DAA42656.1|  TPA: hypothetical protein ZEAMMB73_648980              182   2e-51   
ref|XP_001777071.1|  predicted protein                                  180   1e-50   
gb|EMS58349.1|  Alanine aminotransferase 2                              179   3e-50   Triticum urartu
gb|KJB31175.1|  hypothetical protein B456_005G179600                    179   5e-50   Gossypium raimondii
ref|XP_001763950.1|  predicted protein                                  178   9e-50   
ref|XP_004142968.1|  PREDICTED: glutamate--glyoxylate aminotransf...    177   2e-49   Cucumis sativus [cucumbers]
ref|XP_011086618.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    177   2e-49   
gb|ABK25444.1|  unknown                                                 176   3e-49   Picea sitchensis
ref|XP_002947519.1|  alanine aminotransferase                           152   6e-40   Volvox carteri f. nagariensis
ref|XP_001698518.1|  alanine aminotransferase                           146   5e-38   Chlamydomonas reinhardtii
gb|AAB01685.1|  alanine aminotransferase                                146   5e-38   Chlamydomonas reinhardtii
gb|KIZ04988.1|  alanine transaminase                                    137   2e-36   Monoraphidium neglectum
emb|CBJ25743.1|  nicotinanamine aminotransferase A                      136   1e-34   Ectocarpus siliculosus
ref|XP_005651940.1|  alanine aminotransferase                           134   9e-34   Coccomyxa subellipsoidea C-169
gb|KIY95165.1|  alanine transaminase                                    126   2e-32   Monoraphidium neglectum
gb|AFK37995.1|  unknown                                                 122   3e-32   Lotus japonicus
gb|EWM24220.1|  alanine-2-oxoglutarate aminotransferase 2               129   1e-31   Nannochloropsis gaditana
emb|CDY25781.1|  BnaA07g10010D                                          109   8e-28   Brassica napus [oilseed rape]
ref|XP_001745052.1|  hypothetical protein                               113   2e-26   Monosiga brevicollis MX1
ref|XP_004992298.1|  alanine aminotransferase                           113   4e-26   Salpingoeca rosetta
gb|KIZ07569.1|  alanine transaminase                                    113   7e-26   Monoraphidium neglectum
ref|XP_005847240.1|  hypothetical protein CHLNCDRAFT_57929              112   1e-25   Chlorella variabilis
ref|XP_007510961.1|  predicted protein                                  103   9e-23   Bathycoccus prasinos
emb|CAO02585.1|  alanine amino-transferase                            95.5    2e-22   Medicago truncatula var. truncatula
ref|XP_009041360.1|  hypothetical protein AURANDRAFT_67623              103   5e-22   Aureococcus anophagefferens
ref|XP_005648726.1|  alanine aminotransferase 2                         102   5e-22   Coccomyxa subellipsoidea C-169
ref|XP_002176328.1|  predicted protein                                  100   2e-21   Phaeodactylum tricornutum CCAP 1055/1
gb|EJK48082.1|  hypothetical protein THAOC_33157                        101   2e-21   Thalassiosira oceanica
ref|XP_011398130.1|  putative alanine aminotransferase, mitochond...  99.8    3e-21   Auxenochlorella protothecoides
ref|XP_002175263.1|  alanine aminotransferase                         99.4    4e-21   Schizosaccharomyces japonicus yFS275
gb|KDD76740.1|  aminotransferase                                      98.6    7e-21   Helicosporidium sp. ATCC 50920
gb|EJK50290.1|  hypothetical protein THAOC_30762                      98.6    1e-20   Thalassiosira oceanica
gb|AGT02519.1|  alanine transaminase                                  97.4    2e-20   Herpetomonas muscarum
ref|WP_026853156.1|  aminotransferase class I/II                      96.3    4e-20   Geothrix fermentans
ref|XP_003291733.1|  alanine transaminase                             97.1    4e-20   Dictyostelium purpureum
gb|KIZ01751.1|  alanine transaminase                                  95.1    4e-20   Monoraphidium neglectum
emb|CCW65758.1|  unnamed protein product                              95.9    8e-20   Phytomonas sp. isolate EM1
gb|ACF86318.1|  unknown                                               89.4    9e-20   Zea mays [maize]
ref|XP_010939848.1|  PREDICTED: alanine aminotransferase 2 isofor...  95.5    1e-19   Elaeis guineensis
ref|XP_002946490.1|  hypothetical protein VOLCADRAFT_120326           96.7    1e-19   Volvox carteri f. nagariensis
sp|P52894.1|ALA2_HORVU  RecName: Full=Alanine aminotransferase 2;...  95.1    1e-19   Hordeum vulgare [barley]
pdb|3TCM|A  Chain A, Crystal Structure Of Alanine Aminotransferas...  95.1    1e-19   Hordeum vulgare [barley]
ref|XP_001622550.1|  hypothetical protein NEMVEDRAFT_v1g236165        95.1    2e-19   Nematostella vectensis
ref|XP_011048627.1|  PREDICTED: alanine aminotransferase 2, mitoc...  94.7    2e-19   Populus euphratica
ref|XP_009380146.1|  PREDICTED: alanine aminotransferase 2-like       95.1    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_637993.1|  alanine transaminase                                94.7    3e-19   Dictyostelium discoideum AX4
ref|XP_005833147.1|  hypothetical protein GUITHDRAFT_157749           93.6    5e-19   Guillardia theta CCMP2712
ref|XP_008783332.1|  PREDICTED: alanine aminotransferase 2            94.0    5e-19   Phoenix dactylifera
ref|XP_008800517.1|  PREDICTED: alanine aminotransferase 2-like       93.6    6e-19   
gb|EFA80185.1|  alanine transaminase                                  93.6    7e-19   Heterostelium album PN500
ref|NP_001132269.1|  uncharacterized protein LOC100193705             89.0    1e-18   
gb|KDR12685.1|  Alanine aminotransferase 2                            92.4    1e-18   Zootermopsis nevadensis
ref|XP_001563113.2|  alanine aminotransferase                         92.4    1e-18   Leishmania braziliensis MHOM/BR/75/M2904
dbj|BAF93199.1|  putative alanine aminotransferase                    85.5    1e-18   Hordeum vulgare [barley]
emb|CCC89394.1|  putative alanine aminotransferase                    92.4    2e-18   Trypanosoma congolense IL3000
ref|XP_010697044.1|  alanine aminotransferase                         92.0    2e-18   Leishmania panamensis
ref|XP_009315638.1|  alanine aminotransferase                         92.0    2e-18   Trypanosoma grayi
ref|XP_010917381.1|  PREDICTED: alanine aminotransferase 2-like i...  91.7    2e-18   Elaeis guineensis
ref|XP_010917380.1|  PREDICTED: alanine aminotransferase 2-like i...  91.7    2e-18   Elaeis guineensis
ref|XP_010261672.1|  PREDICTED: alanine aminotransferase 2-like       92.0    2e-18   Nelumbo nucifera [Indian lotus]
gb|AGT60040.1|  aminotransferase                                      91.7    2e-18   uncultured bacterium
ref|XP_002289904.1|  alanine aminotransferase                         91.3    2e-18   Thalassiosira pseudonana CCMP1335
ref|XP_008797360.1|  PREDICTED: alanine aminotransferase 2-like       92.0    2e-18   Phoenix dactylifera
ref|XP_008869166.1|  hypothetical protein H310_06043                  91.7    2e-18   Aphanomyces invadans
ref|XP_010917379.1|  PREDICTED: alanine aminotransferase 2-like i...  91.7    3e-18   Elaeis guineensis
gb|AGG11473.1|  hypothetical protein                                  91.7    3e-18   Paratrypanosoma confusum
ref|XP_010917378.1|  PREDICTED: alanine aminotransferase 2-like i...  91.7    3e-18   Elaeis guineensis
ref|XP_005825112.1|  hypothetical protein GUITHDRAFT_77426            91.3    3e-18   Guillardia theta CCMP2712
gb|ESL10912.1|  alanine aminotransferase                              91.3    3e-18   Trypanosoma rangeli SC58
gb|KFV83100.1|  Alanine aminotransferase 2                            91.3    4e-18   Struthio camelus australis
ref|XP_001769989.1|  predicted protein                                90.9    4e-18   
ref|XP_003724792.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  91.3    4e-18   
tpg|DAA63614.1|  TPA: hypothetical protein ZEAMMB73_898222            87.4    4e-18   
gb|EKG02048.1|  alanine aminotransferase, putative                    88.6    4e-18   Trypanosoma cruzi
ref|XP_002304255.2|  hypothetical protein POPTR_0003s07020g           90.9    5e-18   
ref|WP_012096788.1|  aminotransferase class I/II                      90.5    5e-18   Anaeromyxobacter sp. Fw109-5
ref|XP_010937250.1|  PREDICTED: alanine aminotransferase 2            90.9    5e-18   Elaeis guineensis
ref|XP_008460349.1|  PREDICTED: alanine aminotransferase 1, mitoc...  90.1    6e-18   Cucumis melo [Oriental melon]
ref|XP_003055208.1|  predicted protein                                90.1    8e-18   Micromonas pusilla CCMP1545
ref|XP_009382959.1|  PREDICTED: alanine aminotransferase 2            90.1    9e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009826737.1|  hypothetical protein H257_04062                  90.1    9e-18   Aphanomyces astaci
emb|CBH09087.1|  alanine aminotransferase, putative                   90.1    9e-18   Trypanosoma brucei gambiense DAL972
ref|XP_004144444.1|  PREDICTED: alanine aminotransferase 2, mitoc...  90.1    1e-17   
gb|KGN58474.1|  hypothetical protein Csa_3G646610                     90.1    1e-17   Cucumis sativus [cucumbers]
ref|XP_001219089.1|  alanine aminotransferase                         90.1    1e-17   Trypanosoma brucei brucei TREU927
ref|XP_008460347.1|  PREDICTED: alanine aminotransferase 2-like i...  90.1    1e-17   Cucumis melo [Oriental melon]
ref|XP_003573850.1|  PREDICTED: alanine aminotransferase 2            89.7    1e-17   Brachypodium distachyon [annual false brome]
gb|ACJ85860.1|  unknown                                               89.7    1e-17   Medicago truncatula
gb|AGE89226.1|  cytosolic alanine aminotransferase                    86.3    1e-17   Dicentrarchus labrax [European sea bass]
ref|XP_004510570.1|  PREDICTED: alanine aminotransferase 2, mitoc...  89.7    1e-17   Cicer arietinum [garbanzo]
gb|AFK39904.1|  unknown                                               89.7    1e-17   Medicago truncatula
ref|XP_003627448.1|  Alanine aminotransferase                         89.7    1e-17   Medicago truncatula
ref|XP_003646187.1|  hypothetical protein Ecym_4307                   89.7    1e-17   Eremothecium cymbalariae DBVPG#7215
ref|XP_821936.1|  alanine aminotransferase                            89.4    1e-17   Trypanosoma cruzi strain CL Brener
ref|XP_009389580.1|  PREDICTED: alanine aminotransferase 2-like       89.4    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFH67262.1|  alanine transaminase                                  89.7    2e-17   Mortierella verticillata NRRL 6337
ref|XP_820876.1|  alanine aminotransferase                            89.4    2e-17   Trypanosoma cruzi strain CL Brener
ref|XP_820878.1|  alanine aminotransferase                            89.4    2e-17   Trypanosoma cruzi strain CL Brener
ref|XP_008380735.1|  PREDICTED: alanine aminotransferase 2            89.4    2e-17   Malus domestica [apple tree]
gb|AAC14084.1|  TcC31.28                                              88.2    2e-17   Trypanosoma cruzi
sp|P34106.1|ALA2_PANMI  RecName: Full=Alanine aminotransferase 2;...  89.0    2e-17   Panicum miliaceum [broom millet]
ref|XP_008654837.1|  PREDICTED: uncharacterized protein LOC100193...  89.0    2e-17   
ref|XP_006657960.1|  PREDICTED: alanine aminotransferase 2-like i...  89.0    2e-17   Oryza brachyantha
gb|ADB91976.1|  alanine aminotransferase                              89.0    2e-17   Branchiostoma belcheri
ref|XP_005838227.1|  hypothetical protein GUITHDRAFT_103164           88.6    3e-17   Guillardia theta CCMP2712
ref|XP_004983099.1|  PREDICTED: alanine aminotransferase 2-like       88.6    3e-17   Setaria italica
ref|XP_011079322.1|  PREDICTED: alanine aminotransferase 2-like       89.0    3e-17   Sesamum indicum [beniseed]
dbj|GAA97564.1|  hypothetical protein E5Q_04242                       89.0    3e-17   Mixia osmundae IAM 14324
ref|XP_455940.1|  hypothetical protein                                88.6    3e-17   Kluyveromyces lactis
ref|XP_010029516.1|  PREDICTED: alanine aminotransferase 2-like       89.0    3e-17   Eucalyptus grandis [rose gum]
ref|XP_008228107.1|  PREDICTED: alanine aminotransferase 2, mitoc...  88.6    3e-17   Prunus mume [ume]
ref|XP_011036545.1|  PREDICTED: alanine aminotransferase 2-like       88.6    3e-17   Populus euphratica
emb|CBI35796.3|  unnamed protein product                              88.2    3e-17   Vitis vinifera
gb|EEE67593.1|  hypothetical protein OsJ_25140                        88.6    3e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82447.1|  hypothetical protein OsI_26881                        88.6    3e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_007217248.1|  hypothetical protein PRUPE_ppa003850mg           88.6    3e-17   Prunus persica
ref|XP_002295840.1|  alanine aminotransferase, aminotransferase c...  88.2    4e-17   Thalassiosira pseudonana CCMP1335
ref|XP_002265294.2|  PREDICTED: alanine aminotransferase 2            88.6    4e-17   Vitis vinifera
ref|XP_006649511.1|  PREDICTED: alanine aminotransferase 2-like       88.2    4e-17   
emb|CDS30789.1|  gag pol polyprotein                                  88.2    4e-17   Hymenolepis microstoma
ref|XP_821938.1|  alanine aminotransferase                            88.2    4e-17   Trypanosoma cruzi strain CL Brener
ref|XP_010537653.1|  PREDICTED: alanine aminotransferase 2, mitoc...  88.2    5e-17   Tarenaya hassleriana [spider flower]
ref|XP_002499950.1|  alanine aminotransferase                         87.8    5e-17   Micromonas commoda
gb|KJB70038.1|  hypothetical protein B456_011G0552002                 83.2    5e-17   Gossypium raimondii
gb|EKG02049.1|  alanine aminotransferase, putative                    87.8    5e-17   Trypanosoma cruzi
gb|ESS66397.1|  alanine aminotransferase                              87.8    5e-17   Trypanosoma cruzi Dm28c
gb|EKF30498.1|  alanine aminotransferase, putative                    87.8    5e-17   Trypanosoma cruzi marinkellei
gb|EKF30500.1|  alanine aminotransferase, putative                    87.8    5e-17   Trypanosoma cruzi marinkellei
ref|XP_011072689.1|  PREDICTED: alanine aminotransferase 2            88.2    6e-17   Sesamum indicum [beniseed]
emb|CDQ82436.1|  unnamed protein product                              87.8    6e-17   Oncorhynchus mykiss
gb|AAC62456.1|  alanine aminotransferase                              87.4    6e-17   Zea mays [maize]
gb|AFW68850.1|  alanine aminotransferase                              87.4    6e-17   
ref|WP_005033524.1|  aminotransferase class I/II                      87.4    6e-17   Holophaga foetida
ref|XP_004155894.1|  PREDICTED: alanine aminotransferase 2, mitoc...  87.4    6e-17   
emb|CBN81871.1|  Alanine aminotransferase 2-like                      87.4    6e-17   Dicentrarchus labrax [European sea bass]
ref|XP_004141733.1|  PREDICTED: alanine aminotransferase 2, mitoc...  87.4    7e-17   Cucumis sativus [cucumbers]
ref|NP_001149227.1|  LOC100282849                                     87.4    7e-17   
ref|XP_005526439.1|  PREDICTED: alanine aminotransferase 2 isofor...  87.8    7e-17   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005052721.1|  PREDICTED: alanine aminotransferase 2 isofor...  87.8    7e-17   Ficedula albicollis
ref|XP_010939849.1|  PREDICTED: alanine aminotransferase 2 isofor...  87.4    8e-17   Elaeis guineensis
ref|XP_002430215.1|  Alanine aminotransferase, putative               87.4    8e-17   Pediculus humanus corporis [human body lice]
gb|KFO69634.1|  Alanine aminotransferase 2                            87.4    8e-17   Cuculus canorus
ref|XP_006775215.1|  PREDICTED: alanine aminotransferase 1            85.5    8e-17   Myotis davidii
ref|XP_002194653.1|  PREDICTED: alanine aminotransferase 2            87.8    8e-17   Taeniopygia guttata
gb|KFW64540.1|  Alanine aminotransferase 2                            87.4    8e-17   Pygoscelis adeliae
ref|XP_008637027.1|  PREDICTED: alanine aminotransferase 2            87.8    8e-17   Corvus brachyrhynchos
gb|KDP40629.1|  hypothetical protein JCGZ_24628                       87.4    8e-17   Jatropha curcas
gb|AIT69925.1|  alanine transaminase                                  87.4    8e-17   Saccharina sculpera
ref|XP_008499534.1|  PREDICTED: alanine aminotransferase 2            87.4    8e-17   Calypte anna
gb|KFO63157.1|  Alanine aminotransferase 2                            87.4    8e-17   Corvus brachyrhynchos
emb|CDO97792.1|  unnamed protein product                              87.4    8e-17   Coffea canephora [robusta coffee]
gb|KFM05788.1|  Alanine aminotransferase 2                            87.4    8e-17   Aptenodytes forsteri
gb|AIT69927.1|  alanine transaminase                                  87.4    8e-17   Saccharina japonica
emb|CDO96247.1|  unnamed protein product                              87.4    9e-17   Kluyveromyces dobzhanskii CBS 2104
gb|KFP06658.1|  Alanine aminotransferase 2                            87.4    9e-17   Calypte anna
gb|KFQ95766.1|  Alanine aminotransferase 2                            87.4    9e-17   Nipponia nippon
ref|XP_006369083.1|  alanine aminotransferas family protein           87.0    1e-16   Populus trichocarpa [western balsam poplar]
gb|EMS19811.1|  1-aminocyclopropane-1-carboxylate synthase            87.0    1e-16   Rhodotorula toruloides NP11
ref|XP_002430266.1|  Alanine aminotransferase, putative               87.0    1e-16   Pediculus humanus corporis [human body lice]
gb|EGU11111.1|  putative Alanine aminotransferase                     87.0    1e-16   Rhodotorula toruloides ATCC 204091
ref|XP_003967921.1|  PREDICTED: alanine aminotransferase 2-like       86.7    1e-16   
ref|XP_008305774.1|  PREDICTED: alanine aminotransferase 1            86.7    1e-16   Cynoglossus semilaevis [half-smooth tongue sole]
gb|KDO53769.1|  hypothetical protein CISIN_1g009517mg                 85.5    1e-16   Citrus sinensis [apfelsine]
ref|XP_007409910.1|  hypothetical protein MELLADRAFT_43385            86.7    1e-16   Melampsora larici-populina 98AG31
gb|ETK83887.1|  hypothetical protein L915_11052                       83.2    1e-16   Phytophthora parasitica
ref|XP_011140986.1|  PREDICTED: alanine aminotransferase 1 isofor...  87.0    1e-16   Harpegnathos saltator
ref|XP_002906656.1|  alanine aminotransferase 2                       86.7    1e-16   Phytophthora infestans T30-4
ref|XP_010273809.1|  PREDICTED: alanine aminotransferase 2-like       86.7    1e-16   Nelumbo nucifera [Indian lotus]
ref|NP_001237553.1|  alanine aminotransferase 1                       86.7    1e-16   
gb|EMT23015.1|  Alanine aminotransferase 2                            86.7    1e-16   
ref|XP_009051124.1|  hypothetical protein LOTGIDRAFT_114341           86.7    2e-16   Lottia gigantea
ref|XP_005865158.1|  PREDICTED: alanine aminotransferase 1            84.3    2e-16   Myotis brandtii
gb|ETL90462.1|  hypothetical protein L917_10858                       83.6    2e-16   Phytophthora parasitica
ref|XP_010884157.1|  PREDICTED: alanine aminotransferase 1 isofor...  86.3    2e-16   Esox lucius
ref|XP_006342898.1|  PREDICTED: alanine aminotransferase 2, mitoc...  86.3    2e-16   Solanum tuberosum [potatoes]
ref|XP_003760591.1|  PREDICTED: alanine aminotransferase 1            86.3    2e-16   
gb|KHN39571.1|  Alanine aminotransferase 2, mitochondrial             86.7    2e-16   
gb|ETM43767.1|  hypothetical protein L914_10885                       84.0    2e-16   
ref|XP_008653343.1|  PREDICTED: alanine aminotransferase 2            86.7    2e-16   
ref|XP_002463187.1|  hypothetical protein SORBIDRAFT_02g039340        86.3    2e-16   
gb|AIT69923.1|  alanine transaminase                                  86.3    2e-16   
ref|XP_003528736.1|  PREDICTED: alanine aminotransferase 2, mitoc...  86.3    2e-16   
gb|AIT69918.1|  alanine transaminase                                  86.3    2e-16   
ref|XP_005852218.1|  hypothetical protein CHLNCDRAFT_29318            86.3    2e-16   
ref|XP_010318453.1|  PREDICTED: alanine aminotransferase 2, mitoc...  85.9    2e-16   
ref|XP_008460348.1|  PREDICTED: alanine aminotransferase 2, mitoc...  86.3    2e-16   
ref|XP_008462239.1|  PREDICTED: alanine aminotransferase 1, mitoc...  85.9    2e-16   
ref|XP_004600748.1|  PREDICTED: alanine aminotransferase 2            86.3    2e-16   
gb|AGE89227.1|  mitochondrial alanine aminotransferase                82.0    3e-16   
ref|XP_006794722.1|  PREDICTED: alanine aminotransferase 2-like       85.9    3e-16   
ref|XP_004235528.1|  PREDICTED: alanine aminotransferase 2, mitoc...  85.9    3e-16   
gb|KDO53768.1|  hypothetical protein CISIN_1g009517mg                 85.5    3e-16   
ref|XP_010318452.1|  PREDICTED: alanine aminotransferase 2, mitoc...  85.9    3e-16   
ref|XP_005289905.1|  PREDICTED: alanine aminotransferase 2            85.9    3e-16   
ref|XP_009783410.1|  PREDICTED: alanine aminotransferase 2, mitoc...  85.9    3e-16   
ref|XP_007059708.1|  PREDICTED: alanine aminotransferase 2            85.9    3e-16   
ref|XP_006357426.1|  PREDICTED: alanine aminotransferase 2, mitoc...  85.9    3e-16   
ref|XP_004303756.1|  PREDICTED: alanine aminotransferase 2            85.9    3e-16   
ref|XP_008436808.1|  PREDICTED: alanine aminotransferase 1            85.5    3e-16   
gb|KFV72169.1|  Alanine aminotransferase 2                            85.9    3e-16   
emb|CDY26256.1|  BnaA06g11610D                                        85.9    3e-16   
emb|CDY48485.1|  BnaC05g13450D                                        85.9    3e-16   
ref|XP_009149177.1|  PREDICTED: alanine aminotransferase 1, mitoc...  85.9    3e-16   
ref|XP_006342897.1|  PREDICTED: alanine aminotransferase 2, mitoc...  85.9    3e-16   
ref|XP_009904992.1|  PREDICTED: alanine aminotransferase 2            85.5    3e-16   
gb|KJB57088.1|  hypothetical protein B456_009G147700                  85.5    3e-16   
ref|XP_006641441.1|  PREDICTED: alanine aminotransferase 2-like       85.9    3e-16   
ref|XP_006426797.1|  hypothetical protein CICLE_v10025334mg           85.9    3e-16   
gb|KJB57091.1|  hypothetical protein B456_009G147700                  85.9    3e-16   
ref|XP_009627254.1|  PREDICTED: alanine aminotransferase 2-like       85.9    3e-16   
emb|CDS05712.1|  hypothetical protein LRAMOSA08240                    85.5    4e-16   
ref|XP_010096539.1|  Alanine aminotransferase 2                       85.9    4e-16   
ref|XP_002906651.1|  alanine aminotransferase 2                       85.5    4e-16   
ref|XP_008620886.1|  alanine transaminase                             85.5    4e-16   
ref|XP_005775483.1|  alanine aminotransferase                         85.5    4e-16   
gb|KJB57090.1|  hypothetical protein B456_009G147700                  85.5    4e-16   
ref|XP_004664888.1|  PREDICTED: alanine aminotransferase 2            85.5    4e-16   
gb|AIT69928.1|  alanine transaminase                                  85.5    4e-16   
ref|XP_004235527.1|  PREDICTED: alanine aminotransferase 2-like       85.5    4e-16   
ref|XP_010733467.1|  PREDICTED: alanine aminotransferase 1            85.1    4e-16   
ref|XP_010685211.1|  PREDICTED: alanine aminotransferase 2            85.5    4e-16   
dbj|BAO40163.1|  probable alanine aminotransferase                    85.5    4e-16   
ref|XP_005912151.1|  PREDICTED: alanine aminotransferase 2-like i...  85.5    4e-16   
dbj|BAP71656.1|  probable alanine aminotransferase                    85.5    4e-16   
emb|CDQ76371.1|  unnamed protein product                              85.1    4e-16   
gb|EUB57099.1|  Alanine aminotransferase 2                            85.5    4e-16   
ref|XP_001919896.1|  PREDICTED: alanine aminotransferase 1            85.1    4e-16   
ref|XP_004618719.1|  PREDICTED: alanine aminotransferase 1            85.1    4e-16   
ref|XP_002931716.1|  PREDICTED: alanine aminotransferase 2-like       85.5    5e-16   
ref|XP_004690373.1|  PREDICTED: alanine aminotransferase 2            85.5    5e-16   
ref|XP_005912152.1|  PREDICTED: alanine aminotransferase 2-like i...  85.1    5e-16   
gb|AIT69919.1|  alanine transaminase                                  85.1    5e-16   
gb|EPX73451.1|  alanine aminotransferase                              85.1    5e-16   
emb|CDS24338.1|  alanine aminotransferase 2                           85.5    5e-16   
gb|AIT69916.1|  alanine transaminase                                  85.1    5e-16   
ref|XP_006416720.1|  hypothetical protein EUTSA_v10007290mg           85.1    5e-16   
ref|XP_011304772.1|  PREDICTED: alanine aminotransferase 1            85.1    5e-16   
ref|XP_009798100.1|  PREDICTED: alanine aminotransferase 2-like       85.1    5e-16   
ref|XP_003429759.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  85.1    5e-16   
ref|XP_008068165.1|  PREDICTED: alanine aminotransferase 1            85.1    5e-16   
gb|KDO53767.1|  hypothetical protein CISIN_1g009517mg                 85.1    5e-16   
ref|XP_006465804.1|  PREDICTED: alanine aminotransferase 2, mitoc...  85.1    6e-16   
ref|XP_004546617.1|  PREDICTED: alanine aminotransferase 2-like i...  85.1    6e-16   
ref|XP_004959833.1|  PREDICTED: alanine aminotransferase 2, mitoc...  85.1    6e-16   
ref|XP_006634237.1|  PREDICTED: alanine aminotransferase 2-like       84.7    6e-16   
ref|XP_006426798.1|  hypothetical protein CICLE_v10025334mg           85.1    6e-16   
ref|XP_004546618.1|  PREDICTED: alanine aminotransferase 2-like i...  84.7    6e-16   
ref|XP_003443544.1|  PREDICTED: alanine aminotransferase 2-like i...  84.7    6e-16   
ref|XP_005722569.1|  PREDICTED: alanine aminotransferase 2-like       84.7    6e-16   
ref|XP_003682412.1|  hypothetical protein TDEL_0F03900                85.1    6e-16   
ref|XP_008682329.1|  PREDICTED: alanine aminotransferase 1            81.6    7e-16   
ref|XP_005471814.1|  PREDICTED: alanine aminotransferase 2-like i...  84.7    7e-16   
ref|XP_011485336.1|  PREDICTED: alanine aminotransferase 2-like i...  84.7    7e-16   
ref|XP_011373236.1|  PREDICTED: alanine aminotransferase 1            84.3    7e-16   
emb|CCW70276.1|  unnamed protein product                              84.7    7e-16   
ref|XP_004079476.1|  PREDICTED: alanine aminotransferase 2-like i...  84.7    8e-16   
gb|EYU21272.1|  hypothetical protein MIMGU_mgv1a003837mg              84.7    8e-16   
emb|CDI98892.1|  alanine aminotransferase 2                           84.7    8e-16   
ref|XP_004241856.1|  PREDICTED: alanine aminotransferase 2-like       84.7    8e-16   
ref|NP_001136246.1|  alanine aminotransferase 2-like                  84.3    9e-16   
ref|XP_007024768.1|  Alanine aminotransferase 2                       84.3    9e-16   
ref|XP_006110043.1|  PREDICTED: LOW QUALITY PROTEIN: glutamic-pyr...  84.7    9e-16   
gb|AIT69920.1|  alanine transaminase                                  84.3    9e-16   
ref|XP_008157904.1|  PREDICTED: alanine aminotransferase 1            84.3    9e-16   
gb|AAH61955.1|  Gpt2l protein                                         84.3    9e-16   
ref|XP_009555221.1|  PREDICTED: alanine aminotransferase 2            84.3    9e-16   
ref|XP_005526440.1|  PREDICTED: alanine aminotransferase 2 isofor...  84.0    9e-16   
ref|XP_008302267.1|  PREDICTED: alanine aminotransferase 1            84.3    1e-15   
ref|XP_004342401.1|  alanine aminotransferase, mitochondrial, put...  84.3    1e-15   
ref|XP_004704756.1|  PREDICTED: alanine aminotransferase 2            84.3    1e-15   
gb|ELK11760.1|  Alanine aminotransferase 1                            84.3    1e-15   
ref|XP_009461778.1|  PREDICTED: alanine aminotransferase 2 isofor...  84.0    1e-15   
gb|KDO24164.1|  hypothetical protein SPRG_10592                       84.3    1e-15   
gb|ENN78579.1|  hypothetical protein YQE_04947                        84.3    1e-15   
ref|XP_007230448.1|  PREDICTED: alanine aminotransferase 2            84.3    1e-15   
ref|XP_006872626.1|  PREDICTED: alanine aminotransferase 2            84.3    1e-15   
ref|XP_006913061.1|  PREDICTED: alanine aminotransferase 1 isofor...  84.0    1e-15   
ref|XP_007537771.1|  PREDICTED: alanine aminotransferase 2 isofor...  84.3    1e-15   
ref|XP_006913060.1|  PREDICTED: alanine aminotransferase 1 isofor...  84.0    1e-15   
ref|XP_011169171.1|  PREDICTED: alanine aminotransferase 2-like i...  84.0    1e-15   
gb|AET06148.1|  PLP-dependent aminotransferase                        84.0    1e-15   
sp|Q6NYL5.2|ALAT2_DANRE  RecName: Full=Alanine aminotransferase 2...  84.3    1e-15   
ref|XP_007091606.1|  PREDICTED: alanine aminotransferase 1            82.0    1e-15   
gb|AIT69926.1|  alanine transaminase                                  84.0    1e-15   
ref|XP_003222977.1|  PREDICTED: alanine aminotransferase 2            84.3    1e-15   
ref|XP_009515719.1|  hypothetical protein PHYSODRAFT_477603           84.0    1e-15   
ref|XP_004166923.1|  PREDICTED: alanine aminotransferase 2, mitoc...  84.0    1e-15   
gb|AIT69921.1|  alanine transaminase                                  84.0    1e-15   
emb|CDX96776.1|  BnaA08g23190D                                        84.0    1e-15   
gb|ETK83879.1|  hypothetical protein L915_11047                       80.1    1e-15   
gb|KHG05613.1|  Alanine aminotransferase 2, mitochondrial -like p...  83.6    1e-15   
gb|AIT69922.1|  alanine transaminase                                  83.6    1e-15   
gb|EPB88721.1|  alanine transaminase                                  84.0    1e-15   
gb|AIT69930.1|  alanine transaminase                                  83.6    2e-15   
gb|AIT69931.1|  alanine transaminase                                  83.6    2e-15   
ref|XP_004362319.1|  alanine transaminase                             83.6    2e-15   
dbj|GAN09782.1|  alanine transaminase                                 83.6    2e-15   
gb|EYU45916.1|  hypothetical protein MIMGU_mgv1a005454mg              83.6    2e-15   
gb|ETI43749.1|  hypothetical protein F443_11362                       83.6    2e-15   
ref|XP_006661735.1|  PREDICTED: alanine aminotransferase 2-like       83.6    2e-15   
ref|XP_009110415.1|  PREDICTED: alanine aminotransferase 1, mitoc...  83.6    2e-15   
emb|CDX83914.1|  BnaC08g17310D                                        83.6    2e-15   
ref|XP_006559494.1|  PREDICTED: alanine aminotransferase 2-like       83.6    2e-15   
gb|EMT05433.1|  Alanine aminotransferase 2                            83.6    2e-15   
ref|XP_004212634.1|  PREDICTED: uncharacterized protein LOC101238311  82.0    2e-15   
ref|XP_006014678.1|  PREDICTED: LOW QUALITY PROTEIN: glutamic pyr...  83.6    2e-15   
gb|AAR05449.1|  alanine aminotransferase                              83.2    2e-15   
ref|XP_003230304.2|  PREDICTED: alanine aminotransferase 2-like       82.4    2e-15   
ref|XP_010896061.1|  PREDICTED: alanine aminotransferase 2            83.6    2e-15   
ref|XP_006121251.1|  PREDICTED: alanine aminotransferase 2            83.6    2e-15   
ref|XP_004479736.1|  PREDICTED: alanine aminotransferase 2 isoform 2  83.2    2e-15   
ref|XP_004479735.1|  PREDICTED: alanine aminotransferase 2 isoform 1  83.2    2e-15   
gb|EFN75006.1|  Alanine aminotransferase 2                            83.6    2e-15   
ref|XP_008907369.1|  hypothetical protein PPTG_13440                  83.2    2e-15   
gb|ETO72417.1|  hypothetical protein F444_11427                       81.3    2e-15   
gb|ETP41623.1|  hypothetical protein F442_11247                       83.2    2e-15   
gb|ETP13560.1|  hypothetical protein F441_11279                       83.2    2e-15   
gb|AHW58022.1|  alanine aminotransferase 1                            83.2    2e-15   
ref|XP_011260421.1|  PREDICTED: alanine aminotransferase 1            83.2    2e-15   
gb|EPZ32571.1|  Aminotransferase, class I/classII domain-containi...  80.9    3e-15   
ref|XP_005664519.1|  PREDICTED: alanine aminotransferase 2 isofor...  83.2    3e-15   
ref|XP_003127043.1|  PREDICTED: alanine aminotransferase 2 isofor...  83.2    3e-15   
ref|XP_006607395.1|  PREDICTED: alanine aminotransferase 2-like i...  83.2    3e-15   
ref|NP_986750.1|  AGR085Wp                                            83.2    3e-15   
gb|ETM43759.1|  hypothetical protein L914_10880                       80.5    3e-15   
gb|AIT69929.1|  alanine transaminase                                  82.8    3e-15   
ref|XP_003692587.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  83.2    3e-15   
gb|AEY98906.1|  FAGR085Wp                                             83.2    3e-15   
gb|AAP42512.1|  mitochondrial alanine aminotransferase                83.2    3e-15   
dbj|BAK07780.1|  predicted protein                                    83.2    3e-15   
ref|XP_011127540.1|  hypothetical protein AOL_s00215g36               82.8    3e-15   
ref|XP_010948490.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  83.2    3e-15   
ref|XP_001681668.1|  alanine aminotransferase                         82.8    3e-15   
gb|EPS60556.1|  hypothetical protein M569_14246                       82.8    3e-15   
ref|XP_010980943.1|  PREDICTED: alanine aminotransferase 2            83.2    3e-15   
ref|XP_009216889.1|  hypothetical protein GGTG_00873                  82.8    3e-15   
ref|NP_595176.1|  alanine aminotransferase (predicted)                82.8    3e-15   
ref|XP_006307188.1|  hypothetical protein CARUB_v10008780mg           82.8    3e-15   
ref|XP_007547926.1|  PREDICTED: alanine aminotransferase 1            82.8    3e-15   
ref|XP_002890217.1|  alanine aminotransferase                         82.8    3e-15   
ref|XP_003802370.1|  PREDICTED: alanine aminotransferase 1            82.8    3e-15   
ref|XP_005141728.1|  PREDICTED: alanine aminotransferase 2            82.4    3e-15   
ref|XP_009606549.1|  PREDICTED: alanine aminotransferase 2            82.8    3e-15   
ref|XP_008432758.1|  PREDICTED: alanine aminotransferase 2-like       82.8    3e-15   
ref|XP_003228933.1|  PREDICTED: alanine aminotransferase 1-like       82.8    4e-15   
ref|XP_003757274.1|  PREDICTED: alanine aminotransferase 2            82.4    4e-15   
ref|XP_003955983.1|  hypothetical protein KAFR_0B05530                82.8    4e-15   
gb|AGT02697.1|  alanine transaminase                                  82.4    4e-15   
gb|AAG51787.1|AC067754_3  alanine aminotransferase, putative, 3' ...  79.7    4e-15   
ref|XP_003489354.1|  PREDICTED: alanine aminotransferase 2-like       82.8    4e-15   
ref|XP_004081051.1|  PREDICTED: alanine aminotransferase 2-like       82.4    4e-15   
gb|AIT69917.1|  alanine transaminase                                  82.4    4e-15   
gb|ABC59812.1|  cytosolic alanine aminotransferase 2                  82.8    4e-15   
ref|XP_007135364.1|  hypothetical protein PHAVU_010G123200g           82.8    4e-15   
gb|AAP42511.1|  cytosolic alanine aminotransferase                    82.4    4e-15   
ref|XP_011109633.1|  hypothetical protein H072_3664                   82.4    4e-15   
emb|CDX81815.1|  BnaC08g37860D                                        82.8    4e-15   
ref|NP_001064504.1|  Os10g0390500                                     82.4    4e-15   
emb|CDY21752.1|  BnaA09g45030D                                        82.8    4e-15   
ref|XP_008569975.1|  PREDICTED: alanine aminotransferase 1            80.5    4e-15   
gb|EGA61365.1|  Alt1p                                                 82.8    4e-15   
ref|XP_009117710.1|  PREDICTED: alanine aminotransferase 1, mitoc...  82.8    4e-15   
ref|XP_002970914.1|  hypothetical protein SELMODRAFT_94316            82.4    4e-15   
gb|AAK64147.2|  putative alanine aminotransferase                     82.8    4e-15   
gb|EIW08706.1|  Alt1p                                                 82.8    4e-15   
ref|NP_013190.1|  alanine transaminase ALT1                           82.8    4e-15   
ref|XP_005897946.1|  PREDICTED: alanine aminotransferase 1-like       79.7    4e-15   
ref|NP_173173.3|  alanine aminotransferase                            82.4    4e-15   
ref|XP_003975367.1|  PREDICTED: alanine aminotransferase 2-like       82.8    4e-15   
emb|CAY81325.1|  Alt1p                                                82.8    4e-15   
ref|XP_010476874.1|  PREDICTED: alanine aminotransferase 1, mitoc...  82.4    4e-15   
gb|AAF82782.1|AF275372_1  alanine aminotransferase                    82.4    4e-15   
gb|KFK43924.1|  hypothetical protein AALP_AA1G191800                  82.4    4e-15   
ref|XP_002492709.1|  Putative alanine transaminase (glutamic pyru...  82.4    4e-15   
ref|XP_011289880.1|  PREDICTED: alanine aminotransferase 1            81.6    5e-15   
ref|XP_011337890.1|  PREDICTED: alanine aminotransferase 1 isofor...  82.8    5e-15   
ref|XP_003403160.1|  PREDICTED: alanine aminotransferase 2-like       82.4    5e-15   
gb|EGA81832.1|  Alt1p                                                 82.4    5e-15   
gb|EGA77892.1|  Alt1p                                                 82.4    5e-15   
ref|XP_008524431.1|  PREDICTED: alanine aminotransferase 1            82.4    5e-15   
gb|EGA85809.1|  Alt1p                                                 82.4    5e-15   
gb|AAV64199.1|  putative alanine aminotransferase                     82.4    5e-15   
gb|KDE04574.1|  hypothetical protein MVLG_05042                       82.4    5e-15   
ref|XP_006830849.1|  PREDICTED: alanine aminotransferase 1            82.4    5e-15   
gb|AAV64237.1|  putative alanine aminotransferase                     82.4    5e-15   
ref|XP_002969652.1|  hypothetical protein SELMODRAFT_91640            82.0    5e-15   
ref|XP_005800011.1|  PREDICTED: alanine aminotransferase 2-like i...  82.4    5e-15   
gb|KFH70378.1|  alanine transaminase                                  82.0    5e-15   
ref|XP_007418305.1|  hypothetical protein MELLADRAFT_95696            82.0    5e-15   
ref|XP_003873167.1|  putative alanine aminotransferase                82.0    5e-15   
gb|KHG30536.1|  Alanine aminotransferase 2, mitochondrial -like p...  82.0    5e-15   
emb|CDQ55986.1|  unnamed protein product                              80.5    5e-15   
ref|XP_008120969.1|  PREDICTED: alanine aminotransferase 1-like       82.0    6e-15   
ref|XP_005800010.1|  PREDICTED: alanine aminotransferase 2-like i...  82.4    6e-15   
gb|AIT69937.1|  alanine transaminase                                  82.0    6e-15   
ref|XP_007488862.1|  PREDICTED: alanine aminotransferase 1 isofor...  82.0    6e-15   



>ref|XP_006357614.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=481

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/98 (98%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAIARAKQFL MTSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKQFLGMTSGGLGAY  103



>ref|XP_004239121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Solanum 
lycopersicum]
Length=481

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/98 (98%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAIARAKQFL MTSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKQFLGMTSGGLGAY  103



>emb|CDP13207.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/99 (96%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYENLN+NVK+CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNKNVKECQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGLVFPADAIARAK  LSMTSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLVFPADAIARAKHLLSMTSGGLGAY  103



>gb|EPS68501.1| hypothetical protein M569_06265, partial [Genlisea aurea]
Length=481

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/99 (94%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  3    PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  62

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK ++S+TSGGLGAY
Sbjct  63   LCQAPFLLDDPNVGLLFPADAIARAKHYISLTSGGLGAY  101



>ref|XP_009623844.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
tomentosiformis]
Length=481

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/99 (94%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDY+NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYDNLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVG +FPADAIARAK +L+MTSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGFLFPADAIARAKHYLAMTSGGLGAY  103



>ref|XP_009765091.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
sylvestris]
Length=481

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/99 (94%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDY+NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYDNLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVG +FPADAIARAK +L+MTSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGFLFPADAIARAKHYLAMTSGGLGAY  103



>ref|XP_009624740.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625366.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/99 (94%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+ SGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLNSGGLGAY  103



>ref|XP_009759837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/99 (94%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+ SGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLNSGGLGAY  103



>ref|XP_006416098.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34451.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=357

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LDYDALNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  63   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAY  100



>ref|XP_010682426.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682427.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/98 (95%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYELLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGLVFPADAIARAK +L+MTSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLAMTSGGLGAY  103



>ref|XP_010552672.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Tarenaya 
hassleriana]
Length=481

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAY  103



>gb|EYU28421.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
 gb|EYU28422.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
Length=480

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            +DYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  5    MDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  64

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPF+LDDPNVGL+FPADAIA+AK +LS+TSGGLGAY
Sbjct  65   CQAPFMLDDPNVGLLFPADAIAKAKHYLSLTSGGLGAY  102



>ref|XP_004489787.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Cicer arietinum]
Length=481

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAKQ+LS+TSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLIFPADAIARAKQYLSLTSGGLGAY  103



>ref|XP_004489786.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAKQ+LS+TSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLIFPADAIARAKQYLSLTSGGLGAY  103



>ref|XP_009115544.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
 emb|CDY44130.1| BnaA09g31220D [Brassica napus]
 emb|CDY04729.1| BnaC05g18600D [Brassica napus]
Length=478

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            L+YE+LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYESLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  63   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAY  100



>ref|NP_001031083.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19579.1| AT1G23310 [Arabidopsis thaliana]
 gb|AEE30371.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=441

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_006307377.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
 gb|EOA40275.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
Length=481

 Score =   194 bits (492),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_002887312.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63571.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=482

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPN+G++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNIGMIFPADAIARAKHYLSLTSGGLGAY  103



>gb|AAK25905.1|AF360195_1 putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAY  103



>ref|NP_564192.2| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q9LR30.1|GGT1_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 1; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT1; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT1; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis 
thaliana]
 gb|AAF87015.1|AC005292_24 F26F24.16 [Arabidopsis thaliana]
 gb|AAN62332.1|AF479639_1 glutamate:glyoxylate aminotransferase 1 [Arabidopsis thaliana]
 gb|AAL08235.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAN12918.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AEE30370.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_011071137.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Sesamum 
indicum]
Length=481

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFL+DDPNVG +F ADAIARAK +LSMTSGGLGAY
Sbjct  66   CQAPFLMDDPNVGTLFHADAIARAKHYLSMTSGGLGAY  103



>gb|AAL24255.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAO11559.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
Length=481

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAY  103



>ref|NP_177215.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_974122.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031262.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031263.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9S7E9.1|GGT2_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 2; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT2; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT2; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis 
thaliana]
 gb|AAG52344.1|AC011663_23 putative alanine aminotransferase; 91367-88744 [Arabidopsis thaliana]
 gb|AAG52480.1|AC010796_19 putative alanine aminotransferase; 63135-65758 [Arabidopsis thaliana]
 gb|AAN62333.1|AF479640_1 glutamate:glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AAK59635.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AAL34156.1| putative alanine aminotransferase [Arabidopsis thaliana]
 dbj|BAH19506.1| AT1G70580 [Arabidopsis thaliana]
 gb|AEE35082.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35083.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35084.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35085.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
Length=481

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV++L
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVSL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAY  103



>dbj|BAH20108.1| AT1G70580 [Arabidopsis thaliana]
Length=481

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV++L
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVSL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_003613139.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96097.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=481

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAKQ+LS TSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKQYLSFTSGGLGAY  103



>ref|XP_002893277.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69536.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=481

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_010477627.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Camelina 
sativa]
Length=481

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLL+DPNVG+VFPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLEDPNVGMVFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_003613140.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96098.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=474

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAKQ+LS TSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKQYLSFTSGGLGAY  103



>emb|CBI23368.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGLVFPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTSGGLGAY  103



>emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera]
Length=481

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGLVFPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTSGGLGAY  103



>ref|NP_001268094.1| uncharacterized protein LOC100261274 [Vitis vinifera]
 gb|AAZ43369.1| AlaT1 [Vitis vinifera]
Length=484

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGLVFPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_010927963.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Elaeis guineensis]
Length=481

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +LSMTSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSMTSGGLGAY  103



>ref|XP_010427837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Camelina 
sativa]
Length=479

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_010471056.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_010415743.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_006378236.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|ERP56033.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=335

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAIA+AK +L+MT+GGLGAY
Sbjct  66   CQAPFLLDDPNVGLLFPADAIAKAKHYLAMTTGGLGAY  103



>ref|XP_006300456.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
 gb|EOA33354.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
Length=481

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_004228555.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
lycopersicum]
Length=473

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVG +FPADAIA+AK +LS+ SGGLGAY
Sbjct  65   LCQAPFLLDDPNVGQLFPADAIAKAKHYLSLNSGGLGAY  103



>ref|XP_006416099.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416100.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416101.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34452.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34453.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34454.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=478

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LDYDALNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  63   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAY  100



>ref|XP_006438273.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51513.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=398

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+AL
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG+VFPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGIVFPADAIARAKHYLSLTSGGLGAY  103



>gb|AAZ43368.1| AlaT1 [Vitis labrusca]
Length=477

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGLVFPADAIARAK +LS+T+GGLGAY
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTTGGLGAY  103



>gb|KDP26646.1| hypothetical protein JCGZ_17804 [Jatropha curcas]
Length=481

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE+LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLMFPADAIARAKYYLSLTSGGLGAY  103



>ref|XP_006390865.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390866.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390867.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390868.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28151.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28152.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28153.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28154.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
Length=481

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDNPNVGMIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_010498838.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498839.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498840.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLL+DPNVG++FPADAIARA+ +LS+TSGGLGAY
Sbjct  66   CQAPFLLEDPNVGMIFPADAIARARHYLSLTSGGLGAY  103



>emb|CDY61225.1| BnaC06g43710D [Brassica napus]
Length=481

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDNPNVGMIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_010251104.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251105.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251106.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
Length=481

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE++NENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_010460118.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLL+DPNVG++FPADAIARA+ +LS+TSGGLGAY
Sbjct  66   CQAPFLLEDPNVGMIFPADAIARARHYLSLTSGGLGAY  103



>gb|KHG15331.1| Glutamate--glyoxylate aminotransferase 2 -like protein [Gossypium 
arboreum]
Length=481

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_009105727.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Brassica rapa]
Length=481

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDNPNVGMIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_002527918.1| alanine aminotransferase, putative [Ricinus communis]
 gb|EEF34475.1| alanine aminotransferase, putative [Ricinus communis]
Length=452

 Score =   191 bits (485),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_010023477.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
 ref|XP_010023478.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
Length=481

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAIARAK +LS+T+GGLGAY
Sbjct  66   CQAPFLLDDPNVGLLFPADAIARAKHYLSLTTGGLGAY  103



>gb|KDO82251.1| hypothetical protein CISIN_1g041151mg [Citrus sinensis]
Length=463

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+AL
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG+VFPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGIVFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_006658210.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Oryza 
brachyantha]
Length=494

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  15   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  74

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +LSM  GGLGAY
Sbjct  75   LCQAPFLLDDPNVGLIFPADAIARAKHYLSMAPGGLGAY  113



>ref|XP_006348507.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=476

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPF LDDPNVG +FPADAIA+AK +LS+ SGGLGAY
Sbjct  65   LCQAPFFLDDPNVGQLFPADAIAKAKHYLSLNSGGLGAY  103



>ref|XP_010100388.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
 gb|EXB82522.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
Length=481

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINENVKKTQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAY  103



>emb|CDY66294.1| BnaAnng22050D [Brassica napus]
Length=481

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLD+PNVG++FPADAI+RAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDNPNVGMIFPADAISRAKHYLSLTSGGLGAY  103



>ref|XP_006438274.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438275.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438276.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438277.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438278.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006483938.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483939.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483940.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X3 [Citrus sinensis]
 gb|ESR51514.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51515.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51516.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51517.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51518.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=481

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+AL
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG+VFPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGIVFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_004955317.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X2 [Setaria italica]
Length=478

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+ +GGLGAY
Sbjct  65   LCQAPFLLDDPNVGLMFPADAIARAKHYLSLATGGLGAY  103



>ref|XP_004309987.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457416.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLLFPADAISRAKHYLSVTSGGLGAY  103



>ref|XP_009359228.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Pyrus x 
bretschneideri]
Length=481

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLLFPADAISRAKHYLSITSGGLGAY  103



>ref|XP_008340115.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
 ref|XP_008340116.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
Length=481

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLLFPADAISRAKHYLSITSGGLGAY  103



>gb|AAO84040.1| alanine aminotransferase [Oryza sativa Indica Group]
Length=484

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  11   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  70

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +L+M  GGLGAY
Sbjct  71   LCQAPFLLDDPNVGLIFPADAIARAKHYLAMAPGGLGAY  109



>ref|NP_001058716.1| Os07g0108300 [Oryza sativa Japonica Group]
 dbj|BAD30627.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF20630.1| Os07g0108300 [Oryza sativa Japonica Group]
 gb|EAZ02507.1| hypothetical protein OsI_24612 [Oryza sativa Indica Group]
 gb|EAZ38438.1| hypothetical protein OsJ_22816 [Oryza sativa Japonica Group]
 dbj|BAG90568.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  12   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  71

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +L+M  GGLGAY
Sbjct  72   LCQAPFLLDDPNVGLIFPADAIARAKHYLAMAPGGLGAY  110



>gb|KJB31174.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=395

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNP ALGQKPLTFPRQV+AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_006840828.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
 gb|ERN02503.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
Length=481

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKSVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARA  +L+MTSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARATHYLAMTSGGLGAY  103



>gb|AAM61453.1| putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVK CQYAVRGELYLRASELQKE KKIIFTNVGNPHALGQKPLTFPRQV++L
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKECKKIIFTNVGNPHALGQKPLTFPRQVVSL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAY  103



>emb|CDY41452.1| BnaA08g20540D [Brassica napus]
Length=478

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            L+Y+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYDLLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  63   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAY  100



>ref|XP_007044762.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044763.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044764.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00594.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00595.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00596.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
Length=481

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LD+E+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDHESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_009110107.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Brassica 
rapa]
Length=478

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            L+Y+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYDLLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  63   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAY  100



>ref|XP_008446998.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
melo]
Length=234

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE++NE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINETVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGLGAY
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKSYLSLIPGGLGAY  103



>ref|XP_002315675.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|EEF01846.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=481

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAIA+AK +L+MT+GGLGAY
Sbjct  66   CQAPFLLDDPNVGLLFPADAIAKAKHYLAMTTGGLGAY  103



>ref|XP_009103182.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
Length=478

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLGAY
Sbjct  63   CQAPFLLDNPNVGMLFPADAIARAKHYLSLTSGGLGAY  100



>ref|XP_004955316.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X1 [Setaria italica]
Length=539

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+ +GGLGAY
Sbjct  65   LCQAPFLLDDPNVGLMFPADAIARAKHYLSLATGGLGAY  103



>ref|XP_008789746.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
 ref|XP_008789747.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
Length=481

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE+LNENVKK  YAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRAAELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAI+RA+ +LSMTSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLLFPADAISRARHYLSMTSGGLGAY  103



>ref|XP_009413361.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413362.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAI RAK +LS+TSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIDRAKHYLSLTSGGLGAY  103



>ref|XP_008221924.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221925.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221927.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
Length=481

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKK+IFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKVIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+T+GGLGAY
Sbjct  66   CQAPFLLDDPNVGLIFPADAISRAKHYLSITAGGLGAY  103



>ref|XP_009406515.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406516.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDP+VG++FPADAIARAK +LS+TSGGLGAY
Sbjct  65   LCQAPFLLDDPHVGILFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_003557680.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Brachypodium 
distachyon]
Length=479

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVAL  66

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAIARAK +LSM  GGLGAY
Sbjct  67   CQAPFLLDDPNVGLIFPADAIARAKHYLSMAPGGLGAY  104



>ref|XP_007222799.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
 gb|EMJ23998.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
Length=481

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+T+GGLGAY
Sbjct  66   CQAPFLLDDPNVGLIFPADAISRAKHYLSITTGGLGAY  103



>ref|XP_003519649.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
2 [Glycine max]
 gb|KHN00386.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   189 bits (479),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAY  103



>ref|NP_001237581.1| alanine aminotransferase 3 [Glycine max]
 gb|ABW17198.1| alanine aminotransferase 3 [Glycine max]
Length=480

 Score =   189 bits (479),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAY  103



>ref|NP_001237567.1| alanine aminotransferase 2 [Glycine max]
 gb|ABW17197.1| alanine aminotransferase 2 [Glycine max]
Length=481

 Score =   188 bits (478),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAY  103



>gb|KHN14541.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   188 bits (478),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAY  103



>gb|KJB31170.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31171.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31172.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31173.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=481

 Score =   188 bits (478),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNP ALGQKPLTFPRQV+AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_011014669.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Populus euphratica]
 ref|XP_011014670.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Populus euphratica]
Length=481

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG +FPADAIA+AK +L+MT+GGLGAY
Sbjct  66   CQAPFLLDDPNVGFLFPADAIAKAKHYLAMTTGGLGAY  103



>gb|AET06145.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=480

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LD+E LNENVK  QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+AL
Sbjct  5    LDHETLNENVKNVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVAL  64

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGLVFPADAIARAK +LS+TSGGLGAY
Sbjct  65   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTSGGLGAY  102



>ref|XP_008389735.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Malus 
domestica]
Length=481

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNEKVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+TSGGLGAY
Sbjct  66   CQAPFLLDDPNVGLLFPADAISRAKHYLSITSGGLGAY  103



>ref|XP_010928898.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
 ref|XP_010928907.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
Length=481

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE+LNENVKK  YAVRGELY RASELQKEGKKIIFT+VGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYFRASELQKEGKKIIFTDVGNPHALGQKPLSFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARA+ +LSMTSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARARHYLSMTSGGLGAY  103



>ref|NP_001151209.1| alanine aminotransferase 2 [Zea mays]
 gb|ACG41981.1| alanine aminotransferase 2 [Zea mays]
Length=478

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE LNENVK+ QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYEELNENVKRVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDP+VGL+FPADAIARAK +L+M  GGLGAY
Sbjct  65   LCQAPFLLDDPHVGLMFPADAIARAKHYLAMAPGGLGAY  103



>ref|XP_007158412.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
 gb|ESW30406.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
Length=481

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLD+  +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+A
Sbjct  5    PLDHALINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  65   LCQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAY  103



>ref|XP_009105726.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Brassica rapa]
Length=509

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLG  512
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLG
Sbjct  66   CQAPFLLDNPNVGMIFPADAIARAKHYLSLTSGGLG  101



>emb|CDY12474.1| BnaC07g13140D [Brassica napus]
Length=537

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  68   LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  127

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG++F ADAI RAK +LS+TSGGLGAY
Sbjct  128  CQAPFLLDDPNVGMLFSADAIERAKHYLSLTSGGLGAY  165



>ref|XP_002312679.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
 gb|EEE90046.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
Length=481

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL FPADAI++AK +L+MT GGLGAY
Sbjct  66   CQAPFLLDDPNVGLFFPADAISKAKHYLAMTIGGLGAY  103



>gb|EMT29455.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=523

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL+FPADAIARAK +LS+  GGLGAY
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKHYLSLAPGGLGAY  103



>ref|XP_008447004.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=334

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGL AY
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKSYLSLIPGGLVAY  103



>ref|XP_002968244.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
 ref|XP_002976136.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ23041.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ30498.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
Length=481

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LD +N+NENVKKC YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDPDNINENVKKCVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFL+DDPNVGL+FP DA+ARAK +LSMTSGG+GAY
Sbjct  66   CQAPFLMDDPNVGLLFPPDAVARAKHYLSMTSGGVGAY  103



>ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
Length=460

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGLGAY
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKHYLSLIPGGLGAY  103



>gb|KGN51765.1| hypothetical protein Csa_5G598730 [Cucumis sativus]
Length=481

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGLGAY
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKHYLSLIPGGLGAY  103



>ref|XP_004155366.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Cucumis sativus]
Length=481

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGLGAY
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKHYLSLIPGGLGAY  103



>gb|KGN51767.1| hypothetical protein Csa_5G598750 [Cucumis sativus]
Length=474

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLL+DPNVGL+FPADAI RAK +LS+  GGLGAY
Sbjct  66   CQAPFLLEDPNVGLIFPADAIERAKSYLSLIPGGLGAY  103



>ref|NP_001183048.1| uncharacterized protein LOC100501386 [Zea mays]
 gb|ACR35540.1| unknown [Zea mays]
Length=479

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            P+DYE LNE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  65

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FP DAI RAK++L+M  GGLGAY
Sbjct  66   LCQAPFLLDDPNVGLMFPPDAIVRAKRYLAMAPGGLGAY  104



>ref|XP_008444367.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=473

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE++NEN+KK +YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYESINENMKKVEYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVG +FP DAI RAK +LSM  GGLGAY
Sbjct  65   LCQAPFLLDDPNVGQLFPPDAIVRAKHYLSMIGGGLGAY  103



>ref|XP_001782822.1| predicted protein [Physcomitrella patens]
 gb|EDQ52399.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            +D ENLNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    MDPENLNENVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  66

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFL+DDP+VGL+FPADAIA+AK +LSMTSGG+GAY
Sbjct  67   CQAPFLMDDPHVGLLFPADAIAKAKHYLSMTSGGVGAY  104



>tpg|DAA42658.1| TPA: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Zea mays]
Length=479

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            P+DYE LNE VKK QYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  65

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FP DAI RAK++L+M  GGLGAY
Sbjct  66   LCQAPFLLDDPNVGLMFPPDAIVRAKRYLAMAPGGLGAY  104



>tpg|DAA42656.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
 tpg|DAA42657.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
Length=483

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            P+DYE LNE VKK QYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  65

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAPFLLDDPNVGL+FP DAI RAK++L+M  GGLGAY
Sbjct  66   LCQAPFLLDDPNVGLMFPPDAIVRAKRYLAMAPGGLGAY  104



>ref|XP_001777071.1| predicted protein [Physcomitrella patens]
 gb|EDQ58064.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            +D +NLNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    MDPDNLNENVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  66

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFL+DDP+VGL+FPADAIA+AK +L+MTSGG+GAY
Sbjct  67   CQAPFLMDDPHVGLLFPADAIAKAKHYLAMTSGGVGAY  104



>gb|EMS58349.1| Alanine aminotransferase 2 [Triticum urartu]
Length=478

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPN  L  PADAIARAK +LS+  GGLGAY
Sbjct  66   CQAPFLLDDPNAALSSPADAIARAKHYLSLAPGGLGAY  103



>gb|KJB31175.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=495

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 94/112 (84%), Gaps = 14/112 (13%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------------IIFTNVGNPHAL  362
            LDYE +NENVKK QYAVRGELYLRASELQKEGKK              IIFTNVGNP AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKYMKSTVCWGSMHFHIIFTNVGNPQAL  65

Query  363  GQKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            GQKPLTFPRQV+ALCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAY
Sbjct  66   GQKPLTFPRQVVALCQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAY  117



>ref|XP_001763950.1| predicted protein [Physcomitrella patens]
 gb|EDQ71354.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            +D ENLN NVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    MDPENLNLNVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  66

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFL+DDP+VGL+FP DAIARAK +L+MTSGG+GAY
Sbjct  67   CQAPFLMDDPHVGLLFPEDAIARAKHYLAMTSGGVGAY  104



>ref|XP_004142968.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 ref|XP_004161062.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 gb|KGN62316.1| hypothetical protein Csa_2G349020 [Cucumis sativus]
Length=473

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYE++NEN+KK +YAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQ PLTFPRQVIAL
Sbjct  6    LDYESINENMKKVEYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQMPLTFPRQVIAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVG +FP DAI RAK +LSM  GGLGAY
Sbjct  66   CQAPFLLDDPNVGQLFPPDAIVRAKHYLSMIGGGLGAY  103



>ref|XP_011086618.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Sesamum indicum]
Length=478

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 90/98 (92%), Gaps = 3/98 (3%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQAPFLLDDPNVGL       A+AK +L+MTSGGLGAY
Sbjct  66   CQAPFLLDDPNVGL---XXXXAKAKHYLAMTSGGLGAY  100



>gb|ABK25444.1| unknown [Picea sitchensis]
 gb|ABR16321.1| unknown [Picea sitchensis]
 gb|ABR17158.1| unknown [Picea sitchensis]
 gb|ACN40300.1| unknown [Picea sitchensis]
Length=480

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDYE +NENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNP ALGQ+PLTFPRQV+A
Sbjct  5    PLDYECINENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQRPLTFPRQVMA  64

Query  402  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LCQAP L+DDPNV ++FPAD IARAK +L+MT+GGLGAY
Sbjct  65   LCQAPMLMDDPNVSILFPADVIARAKHYLAMTTGGLGAY  103



>ref|XP_002947519.1| alanine aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ51567.1| alanine aminotransferase [Volvox carteri f. nagariensis]
Length=522

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  419
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTFPRQV+ALC APF
Sbjct  60   LNENVMKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFPRQVLALCAAPF  119

Query  420  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LLD P V  +FPADAIARAK+ LS   GG+GAY
Sbjct  120  LLDHPRVEELFPADAIARAKKILSAFKGGVGAY  152



>ref|XP_001698518.1| alanine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP08011.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  419
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTF RQV+ALC APF
Sbjct  59   LNENVVKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFTRQVLALCAAPF  118

Query  420  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LLD P V  +FPADAIARAK+ L+   GG+GAY
Sbjct  119  LLDHPKVEDMFPADAIARAKKILASFKGGVGAY  151



>gb|AAB01685.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  419
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTF RQV+ALC APF
Sbjct  59   LNENVVKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFTRQVLALCAAPF  118

Query  420  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LLD P V  +FPADAIARAK+ L+   GG+GAY
Sbjct  119  LLDHPKVEDMFPADAIARAKKILASFKGGVGAY  151



>gb|KIZ04988.1| alanine transaminase [Monoraphidium neglectum]
Length=242

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  419
            LNEN++K QYAVRGELYL+A EL+  GK IIFTNVGNPH LG KP+TF RQVIALC APF
Sbjct  58   LNENMRKTQYAVRGELYLKAEELKNAGKPIIFTNVGNPHNLGAKPITFTRQVIALCAAPF  117

Query  420  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LL  P V  +FPADAI RAK+ L   SGG+GAY
Sbjct  118  LLQHPKVAELFPADAIERAKKLLGAFSGGIGAY  150



>emb|CBJ25743.1| nicotinanamine aminotransferase A [Ectocarpus siliculosus]
Length=490

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            L Y+ + E VK CQYAVRGE+YL A+E  K GK++IFTNVGNPH LGQKPLTF RQV+AL
Sbjct  9    LTYDTIAECVKDCQYAVRGEIYLAATERIKAGKEVIFTNVGNPHGLGQKPLTFLRQVMAL  68

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
              APFLL+DP V  +FP DAIARA+++L    GG GAY
Sbjct  69   VMAPFLLEDPRVSDMFPGDAIARAREYLVHVKGGFGAY  106



>ref|XP_005651940.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE27396.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  419
            LNEN+ + +YAVRGELYLR  EL+K+GK+IIFTNVGNPH LGQKPLTF RQV++L  +P 
Sbjct  62   LNENLVRAEYAVRGELYLRGEELRKQGKEIIFTNVGNPHVLGQKPLTFNRQVLSLIASPA  121

Query  420  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LL+ P VG +FP+DAIARAKQ L+   GG+GAY
Sbjct  122  LLEHPEVGRLFPSDAIARAKQVLTYFPGGMGAY  154



>gb|KIY95165.1| alanine transaminase [Monoraphidium neglectum]
Length=227

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  419
            +N N+ K QYAVRGELYLRA ++++EG+ IIFTN+GNPH LG +P TF RQ++ALC AP+
Sbjct  77   INPNILKTQYAVRGELYLRADKMRREGRDIIFTNIGNPHNLGAQPKTFTRQLVALCAAPW  136

Query  420  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LLDDP    +FP+D + RA++ L   +GG+GAY
Sbjct  137  LLDDPRAAELFPSDVMQRARKLLGTFTGGIGAY  169



>gb|AFK37995.1| unknown [Lotus japonicus]
Length=83

 Score =   122 bits (305),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  401
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYVSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  402  LCQA  413
            LC  
Sbjct  65   LCHV  68



>gb|EWM24220.1| alanine-2-oxoglutarate aminotransferase 2 [Nannochloropsis gaditana]
Length=593

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            L+Y++L ++VK C+YAVRGELY  A+E    GK++IFTNVGNPH LGQKP+TF RQV AL
Sbjct  52   LNYDSLPDHVKHCEYAVRGELYRAATERVAAGKEVIFTNVGNPHGLGQKPITFIRQVFAL  111

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
              APFLL+ P+V  +FP D IARAK ++    GG+GAY
Sbjct  112  VSAPFLLEHPDVHRIFPRDVIARAKAYMKAAPGGIGAY  149



>emb|CDY25781.1| BnaA07g10010D [Brassica napus]
Length=58

 Score =   109 bits (273),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  389
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFP 
Sbjct  3    LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPH  57



>ref|XP_001745052.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90285.1| predicted protein [Monosiga brevicollis MX1]
Length=480

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  419
            +N NV    YAVRG++Y  A + + EGKK+I TNVGNPH+LGQ  +TFPRQV+AL   P 
Sbjct  13   INANVLAATYAVRGKIYEMAMQRKAEGKKVILTNVGNPHSLGQPAITFPRQVLALMNYPA  72

Query  420  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LLD PNVG +FPAD IARA+ +L    GG GAY
Sbjct  73   LLDAPNVGDLFPADVIARARTYLEAFPGGTGAY  105



>ref|XP_004992298.1| alanine aminotransferase [Salpingoeca rosetta]
 gb|EGD75245.1| alanine aminotransferase [Salpingoeca rosetta]
Length=481

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  419
            +N+ V    YAVRG +Y+ A + +  GK++IFTN+GNP +LGQKP+TFPRQVI+L   P 
Sbjct  16   INQFVIASHYAVRGTIYIEAQKRKASGKEVIFTNIGNPQSLGQKPITFPRQVISLVTCPQ  75

Query  420  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LL+ P+VG +FP DAIARAK++L    GG GAY
Sbjct  76   LLEHPDVGKLFPEDAIARAKKYLDNLPGGSGAY  108



>gb|KIZ07569.1| alanine transaminase [Monoraphidium neglectum]
Length=621

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 14/107 (13%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQ---------  392
            +N N+ K QYAVRGELYL+A E+++ G+ +IFTN+GNPH LG KP TF RQ         
Sbjct  116  VNPNIIKTQYAVRGELYLKAEEMRRAGRDVIFTNIGNPHNLGAKPKTFTRQAGRGPPRPG  175

Query  393  -----VIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
                 VIALC AP LLD P    +FP D +ARA++ LS  +GG+G+Y
Sbjct  176  PLGRVVIALCAAPDLLDSPQAAGLFPHDTVARARKLLSSFTGGVGSY  222



>ref|XP_005847240.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
 gb|EFN55138.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
Length=529

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  419
            LNE++ K +YAVRGELY +A ELQK+G+++IFTNVGNP  LGQ+P+TF R V +L  APF
Sbjct  67   LNEDLLKAEYAVRGELYNKAMELQKQGRELIFTNVGNPQQLGQQPITFNRMVTSLVAAPF  126

Query  420  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            L+  P+   +FPAD + RAK+   M  G LGAY
Sbjct  127  LMGHPSAPSMFPADVLERAKKINGMFGGALGAY  159



>ref|XP_007510961.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66521.1| predicted protein [Bathycoccus prasinos]
Length=480

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 70/108 (65%), Gaps = 9/108 (8%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  374
            P++   +N+NV   +YAVRG + +RA EL  + KK         I+  N+GNP +LGQKP
Sbjct  4    PVNANTINQNVLTAEYAVRGPIVVRAGELALQLKKDPSSLPFEDIVLCNIGNPQSLGQKP  63

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            +TF RQ++A+C  P LLD P    +FP D IAR+K+ L+ T+GG GAY
Sbjct  64   ITFYRQIMAICDYPDLLDSPECSKIFPEDVIARSKEVLANTAGGTGAY  111



>emb|CAO02585.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02586.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02587.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02588.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02589.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02590.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02591.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02592.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02593.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02594.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02595.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02596.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02597.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02598.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02599.1| alanine amino-transferase, partial [Medicago truncatula var. 
longiaculeata]
 emb|CAO02600.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02601.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02602.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02603.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02604.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02605.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02606.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02607.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02608.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02609.1| alanine amino-transferase [Medicago tornata]
 emb|CAO02610.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02611.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02612.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02613.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02614.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02615.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
Length=48

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  246  ENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  389
            E VKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  1    EXVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPR  48



>ref|XP_009041360.1| hypothetical protein AURANDRAFT_67623 [Aureococcus anophagefferens]
 gb|EGB03935.1| hypothetical protein AURANDRAFT_67623 [Aureococcus anophagefferens]
Length=1156

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 51/105 (49%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEG----KKIIFTNVGNPHALGQKPLTFPRQ  392
            ++  N+++ ++K QYAVRGE+ ++A  L++EG    K+I++TNVGNPH++GQKPLTF RQ
Sbjct  146  INASNMSQALRKMQYAVRGEVVMKADALEQEGREQRKEILYTNVGNPHSVGQKPLTFFRQ  205

Query  393  VIALCQAP--FLLDDPNVGLVFPADAIARAKQF-LSMTSGGLGAY  518
            V+ALC  P    +D PN   +FPADAIARA+    ++   G G+Y
Sbjct  206  VLALCDLPAEHGVDHPNASAMFPADAIARARDMRAAIGDAGTGSY  250



>ref|XP_005648726.1| alanine aminotransferase 2 [Coccomyxa subellipsoidea C-169]
 gb|EIE24182.1| alanine aminotransferase 2 [Coccomyxa subellipsoidea C-169]
Length=505

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 68/107 (64%), Gaps = 8/107 (7%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPL  377
            PL  EN+N  V K QYAVRGE+ +RA EL+ +          KI++ N+GNP  LGQ P+
Sbjct  19   PLALENINPKVVKAQYAVRGEIVIRAKELEDKLHAGEKLPFDKILYCNIGNPQQLGQHPV  78

Query  378  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            TF RQV+A+C  P LL+      +FP D +ARAK++L+   GG GAY
Sbjct  79   TFYRQVLAICDYPELLESAEAKSIFPPDVLARAKKYLAAIPGGTGAY  125



>ref|XP_002176328.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC42720.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=464

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 69/96 (72%), Gaps = 3/96 (3%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  419
            +++++++ QYAVRGE+ L+A +L  EG+KI +TNVGNPHA+GQ+P+TF RQV+ALC  P 
Sbjct  1    MSQSLRRMQYAVRGEVVLKADKLAAEGRKITYTNVGNPHAVGQQPITFYRQVLALCDLPA  60

Query  420  L--LDDPNVGLVFPADAIARAKQFLSMTS-GGLGAY  518
               +D PN   +FP D + RA++   +   GG G+Y
Sbjct  61   SCGVDHPNASQLFPLDVLERARELRGIVGKGGTGSY  96



>gb|EJK48082.1| hypothetical protein THAOC_33157 [Thalassiosira oceanica]
Length=613

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 74/98 (76%), Gaps = 3/98 (3%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQA  413
            + +++++++ QYAVRGE+ + A EL+ EG++IIFTNVGNPHA+GQK +T+ RQV+ALC  
Sbjct  127  DTMSQSLRRMQYAVRGEVVMLAEELKAEGREIIFTNVGNPHAVGQKCITYYRQVLALCDL  186

Query  414  P--FLLDDPNVGLVFPADAIARAKQFL-SMTSGGLGAY  518
            P    +D P+V  +FP D IARA+ +  ++ +GG G+Y
Sbjct  187  PDECGVDHPDVERLFPKDVIARARLYKDAIGTGGTGSY  224



>ref|XP_011398130.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25238.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
Length=487

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  419
            LN+N+ K QYAVRGELY RA EL K G ++I+TN+GNP  LGQ+PL F RQV+AL  APF
Sbjct  24   LNDNILKTQYAVRGELYTRAQELAKSGGEVIYTNIGNPQQLGQEPLVFNRQVLALLLAPF  83

Query  420  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LLD P+   +FP +AI RA++ L+   G +GAY
Sbjct  84   LLDHPSASALFPREAIDRARELLAAFGGRMGAY  116



>ref|XP_002175263.1| alanine aminotransferase [Schizosaccharomyces japonicus yFS275]
 gb|EEB08970.1| alanine aminotransferase [Schizosaccharomyces japonicus yFS275]
Length=486

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 72/107 (67%), Gaps = 11/107 (10%)
 Frame = +3

Query  228  DYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPLT  380
            D E LN+NV   QYAVRG L +RA EL+ + K+         II  N+GNPH +GQ PLT
Sbjct  12   DPEQLNQNVFAAQYAVRGPLAVRAEELRAQLKEKPDSLPFTEIINANIGNPHQMGQIPLT  71

Query  381  FPRQVIALCQAPFLLDDPNVGL-VFPADAIARAKQFLSMTSGGLGAY  518
            F RQV+ALCQ P L+++  +   +FP+DAIARAK+ L  T GG+GAY
Sbjct  72   FIRQVLALCQYPALIENAEITQKLFPSDAIARAKELLEET-GGIGAY  117



>gb|KDD76740.1| aminotransferase [Helicosporidium sp. ATCC 50920]
Length=485

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  419
            +N  + K +YAVRGELY RA EL  +G++II+TNVGNPH LG KPLTF R+VI+L  +P+
Sbjct  24   MNPAILKAEYAVRGELYNRAMELAAQGREIIYTNVGNPHQLGGKPLTFNREVISLMLSPW  83

Query  420  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            LLD P    +F  + I RA++      G  GAY
Sbjct  84   LLDLPQTQEMFRPEVIERAREMSGFFGGAAGAY  116



>gb|EJK50290.1| hypothetical protein THAOC_30762 [Thalassiosira oceanica]
Length=570

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 69/96 (72%), Gaps = 3/96 (3%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  419
            +++N+++ QYAVRGE+ ++A  + K+GKKII+TN+GNPHA+GQKP+T+ RQVI+LC  P 
Sbjct  118  MSQNLRRMQYAVRGEVVIKADAMAKKGKKIIYTNIGNPHAVGQKPITYYRQVISLCDLPA  177

Query  420  L--LDDPNVGLVFPADAIARAKQFL-SMTSGGLGAY  518
               + +P +  VFP D + RA +   ++   G GAY
Sbjct  178  ECGIANPTISSVFPEDVVVRAIEMREAIGPAGTGAY  213



>gb|AGT02519.1| alanine transaminase [Herpetomonas muscarum]
Length=495

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 69/102 (68%), Gaps = 9/102 (9%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKE---GK------KIIFTNVGNPHALGQKPLTFPRQ  392
            +N +V   +YAVRG +  RA E++ E   GK      K+++ N+GNP +L QKPLTF RQ
Sbjct  14   INPSVLAAEYAVRGLIPTRAGEIEAEIASGKDNHPFQKLVYCNIGNPQSLKQKPLTFNRQ  73

Query  393  VIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            V++L  APFLLD+P V   FPADA+ARA+++L+    G GAY
Sbjct  74   VMSLIDAPFLLDNPKVVAEFPADAVARAREYLTHIGSGTGAY  115



>ref|WP_026853156.1| aminotransferase class I/II [Geothrix fermentans]
Length=451

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 68/95 (72%), Gaps = 4/95 (4%)
 Frame = +3

Query  237  NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAP  416
            +L + V + +YAVRG +  RA+EL+K+G++II+ N+GNP +LGQKPLT+ RQ++ALC+ P
Sbjct  7    DLGKAVLETEYAVRGPIVARAAELEKQGREIIYCNIGNPQSLGQKPLTWNRQILALCEYP  66

Query  417  FLLD-DPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
             L+D  P     FPAD +  A+  L+ T  GLGAY
Sbjct  67   DLMDLAPG---AFPADVVETARAILAGTRHGLGAY  98



>ref|XP_003291733.1| alanine transaminase [Dictyostelium purpureum]
 gb|EGC31753.1| alanine transaminase [Dictyostelium purpureum]
Length=530

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 13/111 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASEL-------QKEGKK------IIFTNVGNPHALG  365
            +  +N+ +NV+  QYAVRGEL +RA  +       +KEG K      I++ N+GNP  L 
Sbjct  50   MTIDNICQNVRNAQYAVRGELVIRAESISHQLEKQKKEGSKVLPFDEIVYCNIGNPQQLK  109

Query  366  QKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            QKPLTF RQV++L + P LLD+P +  ++PAD IARA++ L   +   GAY
Sbjct  110  QKPLTFFRQVVSLTECPELLDNPYIEKIYPADVIARAREILGSINNTTGAY  160



>gb|KIZ01751.1| alanine transaminase [Monoraphidium neglectum]
Length=351

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 67/103 (65%), Gaps = 9/103 (9%)
 Frame = +3

Query  237  NLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPLTFPR  389
            ++   + + +YAVRGE+  RA E+ ++ +K         +++ N+GNP  LGQKP+T+ R
Sbjct  3    SIRPRIVQVEYAVRGEIVRRAQEIAEDLEKGHGEHPFDKVVWCNIGNPQILGQKPITYFR  62

Query  390  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            QV+ LC+ P LL  P V  +FPAD I RA+QFL+   GGLGAY
Sbjct  63   QVLCLCEYPELLKHPEVTALFPADVIKRAEQFLAEIPGGLGAY  105



>emb|CCW65758.1| unnamed protein product [Phytomonas sp. isolate EM1]
Length=499

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 9/103 (9%)
 Frame = +3

Query  237  NLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFPR  389
            ++N  V K QYAVRG +  RA E+QKE           ++++ N+GNP AL QKPLTFPR
Sbjct  18   HVNPRVVKAQYAVRGLIPTRAKEIQKEIMDGSTKYPFSELVWCNIGNPQALSQKPLTFPR  77

Query  390  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            QV++L  APFLLD P V   +P DA+ARA+++L       GAY
Sbjct  78   QVMSLFDAPFLLDIPAVLEHYPPDAVARAREYLKDVKNVTGAY  120



>gb|ACF86318.1| unknown [Zea mays]
Length=72

 Score = 89.4 bits (220),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  442  PTFGSSSKNGAWQRAITWRGKVRGFCPRAWGLPTFVKMIFFPSF*SSEARRYSSPLTAY  266
            PT+GSS +NGAW  A TWRGKV GF PRA GLPT VKMIF PSF SSEARRYSSP TAY
Sbjct  3    PTWGSSRRNGAWHSATTWRGKVSGFWPRACGLPTLVKMIFLPSFCSSEARRYSSPRTAY  61



>ref|XP_010939848.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Elaeis guineensis]
Length=518

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 70/109 (64%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            PL ++++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  40   PLTFDSINPKVLKCEYAVRGEIVSHAQRLQQELQTKPGSYPFDEILYCNIGNPQSLGQQP  99

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +LD      +F +DAIARA+Q L +  G   GAY
Sbjct  100  VTFFREVLALCDHPSILDKSEAHALFSSDAIARARQILDLIPGRATGAY  148



>ref|XP_002946490.1| hypothetical protein VOLCADRAFT_120326 [Volvox carteri f. nagariensis]
 gb|EFJ52417.1| hypothetical protein VOLCADRAFT_120326 [Volvox carteri f. nagariensis]
Length=840

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 69/108 (64%), Gaps = 9/108 (8%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQK---EGK------KIIFTNVGNPHALGQKP  374
            PL  + +N+ V   +YAVRGE+   A ++ +   EGK      K+++ N+GNP  LGQKP
Sbjct  294  PLSIDTINKRVINSEYAVRGEIVQLAQKIARDLEEGKGSHPFDKVVWCNIGNPQILGQKP  353

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            +T+ RQV+ALC+ P LLD P +  +FP D IARA+  +    GGLGAY
Sbjct  354  ITYFRQVLALCECPQLLDHPQIRELFPDDVIARAQLLVKAIPGGLGAY  401



>sp|P52894.1|ALA2_HORVU RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Hordeum vulgare]
 emb|CAA81231.1| alanine aminotransferase [Hordeum vulgare subsp. vulgare]
Length=482

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 69/105 (66%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  386
            +NLN  V KC+YAVRGE+ + A  LQ++ K         +I++ N+GNP +LGQ+P+TF 
Sbjct  8    DNLNPKVLKCEYAVRGEIVIHAQRLQEQLKTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P LL    +  +F AD+I+RAKQ L+M  G   GAY
Sbjct  68   REVLALCDHPDLLQREEIKTLFSADSISRAKQILAMIPGRATGAY  112



>pdb|3TCM|A Chain A, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
 pdb|3TCM|B Chain B, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
Length=500

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 69/105 (66%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  386
            +NLN  V KC+YAVRGE+ + A  LQ++ K         +I++ N+GNP +LGQ+P+TF 
Sbjct  26   DNLNPKVLKCEYAVRGEIVIHAQRLQEQLKTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  85

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P LL    +  +F AD+I+RAKQ L+M  G   GAY
Sbjct  86   REVLALCDHPDLLQREEIKTLFSADSISRAKQILAMIPGRATGAY  130



>ref|XP_001622550.1| hypothetical protein NEMVEDRAFT_v1g236165 [Nematostella vectensis]
 gb|EDO30450.1| predicted protein [Nematostella vectensis]
Length=496

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 70/103 (68%), Gaps = 13/103 (13%)
 Frame = +3

Query  237  NLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLTFPRQ  392
            ++N  VK+ +YAVRG + +RASEL+KE         K+++  N+G+ HALG KPL FPRQ
Sbjct  24   SMNPYVKQIEYAVRGAIVIRASELEKELQQGHEKPFKEVVKANIGDAHALGMKPLKFPRQ  83

Query  393  VIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            V+ALC  P LLDDP+    FP+DA  RA++ L+ T G  +GAY
Sbjct  84   VLALCVNPALLDDPS----FPSDAKDRARRILNSTRGFSMGAY  122



>ref|XP_011048627.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Populus 
euphratica]
Length=481

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 67/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+  + +N  V KCQYAVRGE+   A  +Q+E K         +I++ N+GNP +LGQ+P
Sbjct  3    PVSLDTINPKVLKCQYAVRGEIVTLAQAVQEELKSKPGSRPFDEILYCNIGNPQSLGQQP  62

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            LTF R+V+ALC  PF+LD      +F ADAI RA+Q L    G   GAY
Sbjct  63   LTFFREVLALCDHPFILDKSETRGLFSADAIERARQILDQIPGSATGAY  111



>ref|XP_009380146.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  374
            P+  + +N+ V KC+YAVRGE+   A  LQ+E          ++I++ N+GNP +LGQ+P
Sbjct  45   PVALDTINQKVLKCEYAVRGEIVTHAQRLQQELQSKPGSHPFEEILYCNIGNPQSLGQQP  104

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAY  518
            +TF R+V+ALC  P LLD      +F ADAIARA Q L    GG  GAY
Sbjct  105  ITFFREVLALCDHPPLLDKSETHALFSADAIARAWQILDAIPGGATGAY  153



>ref|XP_637993.1| alanine transaminase [Dictyostelium discoideum AX4]
 sp|Q54MJ7.1|ALAM_DICDI RecName: Full=Probable alanine aminotransferase, mitochondrial; 
Short=ALT; AltName: Full=Glutamate pyruvate transaminase; 
Short=GPT; AltName: Full=Glutamic--alanine transaminase; AltName: 
Full=Glutamic--pyruvic transaminase; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL64484.1| alanine transaminase [Dictyostelium discoideum AX4]
Length=534

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 71/111 (64%), Gaps = 13/111 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRAS----ELQK---EGKK------IIFTNVGNPHALG  365
            +  +N+ +NV+  QYAVRGEL +RA     +LQK   EG K      I++ N+GNP  L 
Sbjct  54   MTIDNICQNVRNAQYAVRGELVIRAEAISHQLQKQKTEGTKTLPFEEIVYCNIGNPQQLK  113

Query  366  QKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            QKPLT+ RQV++L + P LLD+P V  ++PAD I+RAK+ L   +   GAY
Sbjct  114  QKPLTYFRQVVSLVECPDLLDNPYVEKIYPADVISRAKEILGSINNTTGAY  164



>ref|XP_005833147.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
 gb|EKX46167.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
Length=473

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 65/103 (63%), Gaps = 8/103 (8%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLTFPR  389
            +++N  V + QYAVRG L LRA + ++  ++        I++ N+GNPH L QKP+TF R
Sbjct  6    DSINPKVLEAQYAVRGALVLRAMQHERALQQKQTLPFNEILYCNIGNPHQLKQKPITFFR  65

Query  390  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            QV+AL   P LLD      VFPADAIARAK F   T GG GAY
Sbjct  66   QVLALTDYPDLLDMQGCSEVFPADAIARAKDFHKNTPGGTGAY  108



>ref|XP_008783332.1| PREDICTED: alanine aminotransferase 2 [Phoenix dactylifera]
Length=526

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 9/106 (8%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+ ++++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  48   PVTFDSINPKVLKCEYAVRGEIVSHAQRLQQELQTKPGSRPFDEILYCNIGNPQSLGQQP  107

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLG  512
            +TF R+V+ALC  P +LD      +F ADAIARA Q L +  G  G
Sbjct  108  ITFFREVLALCDHPSILDKSETHALFSADAIARAWQILDLIPGRAG  153



>ref|XP_008800517.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 69/109 (63%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+ + ++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  52   PVTFASINPKVLKCEYAVRGEIVSHAQRLQQELQTKPDSHPFDEILYCNIGNPQSLGQQP  111

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +LD      +F +DAIARA+Q L +  G   GAY
Sbjct  112  VTFFREVLALCDHPSILDKSETHALFSSDAIARARQILDLIPGRATGAY  160



>gb|EFA80185.1| alanine transaminase [Polysphondylium pallidum PN500]
Length=599

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 71/111 (64%), Gaps = 14/111 (13%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASEL-------QKEGKK------IIFTNVGNPHALG  365
            L  +N+   VK  QYAVRGEL +RA  +       +KEG K      I++ N+GNP  L 
Sbjct  120  LTLDNMCPTVKTAQYAVRGELVIRAENIAHLLEKQKKEGTKLLPFNEIVYCNIGNPQQLK  179

Query  366  QKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            Q+P++F RQV+ALC+ P LL+  +V  VFPADAIARA++ ++ + G  GAY
Sbjct  180  QQPISFFRQVLALCECPELLNSAHVDKVFPADAIARARELMA-SIGNTGAY  229



>ref|NP_001132269.1| uncharacterized protein LOC100193705 [Zea mays]
 gb|ACF81046.1| unknown [Zea mays]
Length=176

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  386
            ENLN  V KC+YAVRGE+ + A  LQ++           +I+F N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILFCNIGNPQSLGQQPVTFF  67

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P LL+      +F ADAI+RAKQ L+   G   GAY
Sbjct  68   REVLALCDHPCLLEKEETKSLFSADAISRAKQILATIPGRATGAY  112



>gb|KDR12685.1| Alanine aminotransferase 2 [Zootermopsis nevadensis]
Length=538

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 69/104 (66%), Gaps = 13/104 (13%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLTFPR  389
            EN+N  +K+ +YAVRG L +RASE++KE ++        +I  N+G+ HA+GQKPLTF R
Sbjct  68   ENMNPCLKRMEYAVRGPLVIRASEIEKELQEGVKKPFSEVIKANIGDCHAMGQKPLTFIR  127

Query  390  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAY  518
            QV+AL   P LLDDP     FP DA ARAK  L+   GG +G+Y
Sbjct  128  QVLALVSYPALLDDPR----FPTDAKARAKDILAGCRGGSVGSY  167



>ref|XP_001563113.2| alanine aminotransferase [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM37436.2| alanine aminotransferase [Leishmania braziliensis MHOM/BR/75/M2904]
Length=497

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 66/103 (64%), Gaps = 9/103 (9%)
 Frame = +3

Query  237  NLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFPR  389
            +LN  V + +YAVRG +  RA E++ +          + +++ N+GNP +LGQ PLTF R
Sbjct  15   HLNPRVIEAEYAVRGLIPSRADEIKADLAAGRGSYSFQSLVYCNIGNPQSLGQMPLTFCR  74

Query  390  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            QV+AL  APFLL+DP +    P DA+ARA++FL+    G GAY
Sbjct  75   QVMALVDAPFLLEDPEIVARLPVDAVARAREFLAEIGTGTGAY  117



>dbj|BAF93199.1| putative alanine aminotransferase [Hordeum vulgare]
Length=55

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  378  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            TFPRQV+ALCQAPFLLDDPNV L+FPADAIARAK +LS+  GGLGAY
Sbjct  1    TFPRQVVALCQAPFLLDDPNVCLIFPADAIARAKHYLSLAPGGLGAY  47



>emb|CCC89394.1| putative alanine aminotransferase [Trypanosoma congolense IL3000]
Length=505

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 69/105 (66%), Gaps = 11/105 (10%)
 Frame = +3

Query  237  NLNENVKKCQYAVRGELYLRASELQKE-------GK----KIIFTNVGNPHALGQKPLTF  383
            ++N  V K QYAVRG + +RA E+++E       GK    ++++ N+GNP AL Q+PLTF
Sbjct  20   HINPRVLKAQYAVRGLVPMRADEIKREIQSGNGNGKFSFDELVYCNIGNPQALEQRPLTF  79

Query  384  PRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
             RQV++L  APFLL+D +V   +P+DA+ARA  +L     G GAY
Sbjct  80   HRQVMSLVDAPFLLEDADVISRYPSDAVARACSYLGHIGNGTGAY  124



>ref|XP_010697044.1| alanine aminotransferase [Leishmania panamensis]
 gb|AIN96391.1| alanine aminotransferase [Leishmania panamensis]
Length=497

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 66/103 (64%), Gaps = 9/103 (9%)
 Frame = +3

Query  237  NLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFPR  389
            +LN  V + +YAVRG +  RA E++ +          + +++ N+GNP +LGQ PLTF R
Sbjct  15   HLNPRVIEAEYAVRGLIPSRADEIKADLAAGRGSYSFQSLVYCNIGNPQSLGQMPLTFYR  74

Query  390  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            QV+AL  APFLL+DP +    P DA+ARA++FL+    G GAY
Sbjct  75   QVMALVDAPFLLEDPEIVARLPVDAVARAREFLAEIGTGTGAY  117



>ref|XP_009315638.1| alanine aminotransferase [Trypanosoma grayi]
 gb|KEG06131.1| alanine aminotransferase [Trypanosoma grayi]
Length=493

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 68/105 (65%), Gaps = 11/105 (10%)
 Frame = +3

Query  237  NLNENVKKCQYAVRGELYLRASELQK-----EGK------KIIFTNVGNPHALGQKPLTF  383
            ++N  V + QYAVRG + +RA E++      EGK       +++ N+GNP AL QKPLTF
Sbjct  9    HINPRVVEAQYAVRGLIPMRADEIKNALATPEGKGKYPFSSLVYCNIGNPQALEQKPLTF  68

Query  384  PRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
             RQV++L  APFLLD+  +   +PADA+ARA+++LS      GAY
Sbjct  69   NRQVMSLVDAPFLLDNAAIKAQYPADAVARAQEYLSHIGNRTGAY  113



>ref|XP_010917381.1| PREDICTED: alanine aminotransferase 2-like isoform X4 [Elaeis 
guineensis]
Length=470

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 67/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMT-SGGLGAY  518
            +TF R+V+ALC  P LLD      +F +DAIARA + L +      GAY
Sbjct  112  ITFFREVLALCDYPALLDRDETHALFSSDAIARAWEILDLIPDRATGAY  160



>ref|XP_010917380.1| PREDICTED: alanine aminotransferase 2-like isoform X3 [Elaeis 
guineensis]
Length=488

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 67/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMT-SGGLGAY  518
            +TF R+V+ALC  P LLD      +F +DAIARA + L +      GAY
Sbjct  112  ITFFREVLALCDYPALLDRDETHALFSSDAIARAWEILDLIPDRATGAY  160



>ref|XP_010261672.1| PREDICTED: alanine aminotransferase 2-like [Nelumbo nucifera]
Length=528

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 66/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+  E LN  V KCQYAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  50   PVTAETLNPKVLKCQYAVRGEIVTHAQRLQQELQSKPSSHPFNEILYCNIGNPQSLGQQP  109

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P LL+      +F ADAI RA+Q L    G   GAY
Sbjct  110  ITFFREVLALCDHPALLNKSETQGLFSADAIQRAQQILDQIPGRATGAY  158



>gb|AGT60040.1| aminotransferase [uncultured bacterium]
Length=462

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            + + NLN+ +   +YAVRG++  RA EL+K GKKI + N+GNPHA  QKPL++ R+V++L
Sbjct  2    ITFNNLNQKLIDAEYAVRGKIVTRAQELEKTGKKITYCNIGNPHAFAQKPLSYVREVLSL  61

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
             + P LL+     L F +D+I RA+  L     G+GAY
Sbjct  62   LEFPDLLERDLTNL-FHSDSIERARYILRQIPEGVGAY  98



>ref|XP_002289904.1| alanine aminotransferase [Thalassiosira pseudonana CCMP1335]
 gb|EED93441.1| alanine aminotransferase [Thalassiosira pseudonana CCMP1335]
Length=444

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  264  QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPFL--LDDPN  437
            QYAVRGE+ +RA  +  EG+KII+TN+GNPHA+GQKP+T+ RQV++LC  P    +D+  
Sbjct  2    QYAVRGEVVIRADAMAAEGRKIIYTNIGNPHAVGQKPITYYRQVLSLCDLPAECGVDNTQ  61

Query  438  VGLVFPADAIARAKQFL-SMTSGGLGAY  518
            V   FP+D I RA +   ++   G GAY
Sbjct  62   VAAAFPSDVIERAIEMRDAIGPAGTGAY  89



>ref|XP_008797360.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 67/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  374
            P+  E +N  VKKC+YAVRGE+   A  LQ+E          ++I++ N+GNP ALGQ+P
Sbjct  52   PITVETINPKVKKCEYAVRGEIVSHAQRLQQELQTKPRSHPFEEILYCNIGNPQALGQQP  111

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMT-SGGLGAY  518
            +TF R+V+ALC  P LLD      +F +DAIA+A + L +      GAY
Sbjct  112  ITFFREVLALCNYPALLDRDETHALFSSDAIAKAWEILDLIPDRATGAY  160



>ref|XP_008869166.1| hypothetical protein H310_06043 [Aphanomyces invadans]
 gb|ETW02561.1| hypothetical protein H310_06043 [Aphanomyces invadans]
Length=486

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 8/106 (8%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  380
            L  + +N  V + +YAVRG L L++ ELQK           KII  N+GNP +LGQKP+ 
Sbjct  15   LTKKTINPRVVEAEYAVRGPLVLKSIELQKRLSAGEKLPFDKIISCNIGNPQSLGQKPIQ  74

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            F R+V+AL   P L+D P+   +F  DAIARAK++L    GG GAY
Sbjct  75   FHREVLALVNMPGLVDHPSAPSIFKPDAIARAKRYLQRIPGGTGAY  120



>ref|XP_010917379.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Elaeis 
guineensis]
Length=516

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 67/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMT-SGGLGAY  518
            +TF R+V+ALC  P LLD      +F +DAIARA + L +      GAY
Sbjct  112  ITFFREVLALCDYPALLDRDETHALFSSDAIARAWEILDLIPDRATGAY  160



>gb|AGG11473.1| hypothetical protein, partial [Trypanosomatidae sp. TS-2013]
Length=510

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 67/105 (64%), Gaps = 11/105 (10%)
 Frame = +3

Query  237  NLNENVKKCQYAVRGELYLRASELQKEGKK-----------IIFTNVGNPHALGQKPLTF  383
            ++N  V + QYAVRG + LRA E++KE ++           +++ N+GNP AL QKPLTF
Sbjct  26   HINPRVIEAQYAVRGLIPLRAGEIEKELQRADGAAKYPFDSLVYCNIGNPQALKQKPLTF  85

Query  384  PRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
             RQV++L  APFLLD+P     +P+DA+ RAK +LS      GAY
Sbjct  86   FRQVMSLIDAPFLLDNPAAVSGYPSDAVERAKLYLSHIGDKTGAY  130



>ref|XP_010917378.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Elaeis 
guineensis]
Length=534

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 67/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMT-SGGLGAY  518
            +TF R+V+ALC  P LLD      +F +DAIARA + L +      GAY
Sbjct  112  ITFFREVLALCDYPALLDRDETHALFSSDAIARAWEILDLIPDRATGAY  160



>ref|XP_005825112.1| hypothetical protein GUITHDRAFT_77426 [Guillardia theta CCMP2712]
 gb|EKX38132.1| hypothetical protein GUITHDRAFT_77426 [Guillardia theta CCMP2712]
Length=482

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 9/107 (8%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  377
            L  +N+N+N+ + QYAVRG + + A  +QKE          K++++ N+GNPH++GQKP+
Sbjct  11   LTKKNINQNLVEMQYAVRGLVPITAERIQKEILNGDTSKPFKEVLYCNIGNPHSVGQKPI  70

Query  378  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            TF R+V+AL   P LL+   V  +F  D I RAK+ + +  GG GAY
Sbjct  71   TFYREVLALVDCPMLLEREGVEKLFKPDVIKRAKELIGLIKGGTGAY  117



>gb|ESL10912.1| alanine aminotransferase [Trypanosoma rangeli SC58]
Length=498

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 67/105 (64%), Gaps = 11/105 (10%)
 Frame = +3

Query  237  NLNENVKKCQYAVRGELYLRASELQK-----EGK------KIIFTNVGNPHALGQKPLTF  383
            +LN  V   QYAVRG + +RA E+++     EGK       +++ N+GNP AL Q+PLTF
Sbjct  14   HLNPRVVAAQYAVRGLIPMRADEIKRALATPEGKAKYPFSSLVYCNIGNPQALEQRPLTF  73

Query  384  PRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
             RQV++L  APFLL+   V   +PADA+ARA+++L     G GAY
Sbjct  74   FRQVMSLVDAPFLLESEQVTSQYPADAVARAREYLGHIGKGTGAY  118



>gb|KFV83100.1| Alanine aminotransferase 2, partial [Struthio camelus australis]
Length=501

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 67/104 (64%), Gaps = 10/104 (10%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFT-----NVGNPHALGQKPLTFPR  389
            L  E++N  VK  +YAVRG + L+A E++KEG K  FT     N+G+ HA+GQ+P+TF R
Sbjct  29   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKEGIKKPFTEVIKANIGDAHAMGQRPITFLR  88

Query  390  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            QV+ALC  P LLD P+    FP DA  RA++ L    G  LG+Y
Sbjct  89   QVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSY  128



>ref|XP_001769989.1| predicted protein [Physcomitrella patens]
 gb|EDQ65165.1| predicted protein [Physcomitrella patens]
Length=484

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+  +++N  V   +YAVRGE+ +RA  L +E K         +II+ N+GNP +LGQKP
Sbjct  6    PVSIQSINPKVLNAEYAVRGEIVIRAQALAEELKSNPGSHPFDEIIYCNIGNPQSLGQKP  65

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P LLD P    +F +DAI+RA + ++   G   GAY
Sbjct  66   ITFFREVVALCDHPSLLDKPETHALFSSDAISRASRIINKIPGQTTGAY  114



>ref|XP_003724792.1| PREDICTED: LOW QUALITY PROTEIN: alanine aminotransferase 2-like 
[Strongylocentrotus purpuratus]
Length=552

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 70/107 (65%), Gaps = 13/107 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  380
            L  E +N +++  +YAVRG +  RA+++QKE +K        +I  N+G+ HA+GQKP+T
Sbjct  55   LSLETMNPHIRVMEYAVRGPIVQRATQIQKELEKGVSKPFPSVIKCNIGDAHAMGQKPMT  114

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAY  518
            F RQVIALC  P LLDD N    FP+DA  RA++ L+   GG LG+Y
Sbjct  115  FLRQVIALCTYPALLDDSN----FPSDAKQRAQRILNGCKGGSLGSY  157



>tpg|DAA63614.1| TPA: hypothetical protein ZEAMMB73_898222, partial [Zea mays]
Length=175

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 64/109 (59%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  374
            P+    +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  63   PVSVATINPKVLKCEYAVRGEIVTHAQNLQQELQKNPESLPFDEILYCNIGNPQSLGQQP  122

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +T+ R+V++LC  P LLD      ++ +DAI RA Q L    G   GAY
Sbjct  123  VTYFREVLSLCDHPALLDKSETHALYSSDAIERAWQILEKIPGRATGAY  171



>gb|EKG02048.1| alanine aminotransferase, putative, partial [Trypanosoma cruzi]
Length=235

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQK-----EGK------KIIFTNVGNPHALGQKPLTFP  386
            +N  V   +YAVRG L +RA E++      EGK       I++ N+GNP AL QKPLTF 
Sbjct  108  INPRVVAAEYAVRGMLPMRADEIRAALATPEGKAKYPFSSIVYCNIGNPQALEQKPLTFF  167

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            RQV++L  APFLL++  V   +PADA+ARA+++L       GAY
Sbjct  168  RQVMSLIDAPFLLENEKVTSQYPADAVARAREYLRHIGDRTGAY  211



>ref|XP_002304255.2| hypothetical protein POPTR_0003s07020g [Populus trichocarpa]
 gb|EEE79234.2| hypothetical protein POPTR_0003s07020g [Populus trichocarpa]
Length=481

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 66/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+  +N+N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  3    PVSLDNINPKVLKCEYAVRGEIVTLAQALQEELKSKPGSHPFDEILYCNIGNPQSLGQQP  62

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAY
Sbjct  63   ITFFREVLALCDHPSILDRSETQGLFSADAIERAWQILDQIPGRATGAY  111



>ref|WP_012096788.1| aminotransferase class I/II [Anaeromyxobacter sp. Fw109-5]
 gb|ABS26209.1| aminotransferase class I and II [Anaeromyxobacter sp. Fw109-5]
Length=457

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 67/95 (71%), Gaps = 1/95 (1%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQA  413
            E++   V++ QYAVRG +  RA EL+++G+++I+ N+GNP +LGQ+PL++ RQV+A+ + 
Sbjct  6    EDVAPVVREAQYAVRGPIVARAQELERQGREVIYCNIGNPQSLGQRPLSWVRQVLAIAEW  65

Query  414  PFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            P LL+    G  F AD +A A++ L  +  GLGAY
Sbjct  66   PELLERVPAG-TFAADVVAVAREVLRGSEHGLGAY  99



>ref|XP_010937250.1| PREDICTED: alanine aminotransferase 2 [Elaeis guineensis]
Length=526

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+  +++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +L Q+P
Sbjct  48   PVTLDSINPKVIKCEYAVRGEIVSHAQRLQQELQTKPGAHPFDEILYCNIGNPQSLAQQP  107

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +LD      +F ADAIARA Q L +  G   GAY
Sbjct  108  ITFFREVLALCDHPSILDKSETHALFSADAIARAWQILDLIPGRATGAY  156



>ref|XP_008460349.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X3 [Cucumis melo]
 ref|XP_008460350.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X4 [Cucumis melo]
 ref|XP_008460351.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X5 [Cucumis melo]
Length=436

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  374
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  52   PLSVATINDKVLKCEYAVRGEIVTLAQKLQEELSAKPGLHPFDEILYCNIGNPQSLGQQP  111

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +LD      +F  DAIARA Q L    G   GAY
Sbjct  112  ITFFREVLALCDHPAILDRSETQGLFSTDAIARAWQILDQIPGRATGAY  160



>ref|XP_003055208.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60460.1| predicted protein [Micromonas pusilla CCMP1545]
Length=477

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 63/104 (61%), Gaps = 9/104 (9%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  386
            +N+N  V++ QYAVRG +  RA E++   K         K+++ N+GNP +LGQKP++F 
Sbjct  7    DNINAKVREMQYAVRGAIVQRAGEIEDGLKADPSKYPFDKVVYCNIGNPQSLGQKPISFF  66

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            RQV+ALC  P LL  P +   FP D    AK  L  T+GG GAY
Sbjct  67   RQVLALCDYPDLLLAPGIEKTFPEDVRKIAKDILDNTTGGTGAY  110



>ref|XP_009382959.1| PREDICTED: alanine aminotransferase 2 [Musa acuminata subsp. 
malaccensis]
Length=522

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 65/105 (62%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  386
            + +N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P+TF 
Sbjct  48   DTINPKVLKCEYAVRGEIVSHAQRLQQELQDKPGSHPFDEILYCNIGNPQSLGQQPVTFF  107

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P LLD      +F ADAIARA Q L +  G   GAY
Sbjct  108  REVLALCDHPSLLDKSETHALFSADAIARAWQILDVIPGRATGAY  152



>ref|XP_009826737.1| hypothetical protein H257_04062 [Aphanomyces astaci]
 gb|ETV83307.1| hypothetical protein H257_04062 [Aphanomyces astaci]
Length=486

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 8/106 (8%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  380
            L  + +N  + + +YAVRG L L++ ELQK           KII  N+GNP +LGQKP+ 
Sbjct  15   LTKKTINPRIVEAEYAVRGPLVLKSIELQKRLSAGEKLPFDKIISCNIGNPQSLGQKPIQ  74

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            F R+V+AL   P L+D P+   +F  DAI+RAK++L    GG GAY
Sbjct  75   FHREVLALVNMPGLVDHPSAPSIFKPDAISRAKRYLKRIPGGTGAY  120



>emb|CBH09087.1| alanine aminotransferase, putative [Trypanosoma brucei gambiense 
DAL972]
Length=504

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 69/105 (66%), Gaps = 11/105 (10%)
 Frame = +3

Query  237  NLNENVKKCQYAVRGELYLRASELQKE-----GK------KIIFTNVGNPHALGQKPLTF  383
            ++N  VKK QYAVRG + +RA E+++E     GK      ++++ N+GNP AL QKPLTF
Sbjct  20   HINPRVKKAQYAVRGLVPMRADEIREEIRSGTGKSKFSFNELVYCNIGNPQALEQKPLTF  79

Query  384  PRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
             RQV++L  APFLL+D  V   +P+DA++RA+ +L       GAY
Sbjct  80   HRQVMSLIDAPFLLEDNAVVSRYPSDAVSRARLYLGHIGQRTGAY  124



>ref|XP_004144444.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=528

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  374
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  50   PLSIATINDKVLKCEYAVRGEIVTLAQKLQEELSVKPGSHPFDEILYCNIGNPQSLGQQP  109

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +LD      +F  DAIARA Q L    G   GAY
Sbjct  110  ITFFREVLALCDHPAILDKSETQGLFSTDAIARAWQILDQIPGRATGAY  158



>gb|KGN58474.1| hypothetical protein Csa_3G646610 [Cucumis sativus]
Length=535

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  374
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  57   PLSIATINDKVLKCEYAVRGEIVTLAQKLQEELSVKPGSHPFDEILYCNIGNPQSLGQQP  116

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +LD      +F  DAIARA Q L    G   GAY
Sbjct  117  ITFFREVLALCDHPAILDKSETQGLFSTDAIARAWQILDQIPGRATGAY  165



>ref|XP_001219089.1| alanine aminotransferase [Trypanosoma brucei brucei TREU927]
 emb|CAJ16602.1| alanine aminotransferase, putative [Trypanosoma brucei brucei 
TREU927]
Length=569

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 69/105 (66%), Gaps = 11/105 (10%)
 Frame = +3

Query  237  NLNENVKKCQYAVRGELYLRASELQKE-----GK------KIIFTNVGNPHALGQKPLTF  383
            ++N  VKK QYAVRG + +RA E+++E     GK      ++++ N+GNP AL QKPLTF
Sbjct  85   HINPRVKKAQYAVRGLVPMRADEIREEIRSGTGKSKFSFNELVYCNIGNPQALEQKPLTF  144

Query  384  PRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
             RQV++L  APFLL+D  V   +P+DA++RA+ +L       GAY
Sbjct  145  HRQVMSLIDAPFLLEDNAVVSRYPSDAVSRARLYLGHIGQRTGAY  189



>ref|XP_008460347.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Cucumis 
melo]
Length=530

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  374
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  52   PLSVATINDKVLKCEYAVRGEIVTLAQKLQEELSAKPGLHPFDEILYCNIGNPQSLGQQP  111

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +LD      +F  DAIARA Q L    G   GAY
Sbjct  112  ITFFREVLALCDHPAILDRSETQGLFSTDAIARAWQILDQIPGRATGAY  160



>ref|XP_003573850.1| PREDICTED: alanine aminotransferase 2 [Brachypodium distachyon]
Length=481

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 69/105 (66%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  386
            ENLN  V KC+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQNQPGSLPFHEILYCNIGNPQSLGQQPVTFF  67

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P+LL    +  +F AD+I+RAKQ L++  G   GAY
Sbjct  68   REVLALCDHPYLLQREEIKSLFSADSISRAKQILALIPGRATGAY  112



>gb|ACJ85860.1| unknown [Medicago truncatula]
Length=524

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 64/109 (59%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQK---------EGKKIIFTNVGNPHALGQKP  374
            P+  +N+N  V KCQYAVRGE+   A  LQK            +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P LLD      +F AD+I RA Q +    G   GAY
Sbjct  106  ITFFREVLALCDYPALLDKSETQGLFSADSIERAWQLVDQIPGRATGAY  154



>gb|AGE89226.1| cytosolic alanine aminotransferase, partial [Dicentrarchus labrax]
Length=186

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 66/107 (62%), Gaps = 13/107 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  380
            L  + +N NVK+ +YAVRG +  RA +++KE K+        +I  N+G+ HA+GQKP+T
Sbjct  1    LTVDTMNPNVKRVEYAVRGPIVQRAVQIEKELKEGVKKPFSEVIKANIGDAHAMGQKPIT  60

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            F RQV+ALC  P LL+D      FP DA  RAK+ L    G  +GAY
Sbjct  61   FLRQVLALCSYPELLEDNK----FPEDAKKRAKRILQACGGHSIGAY  103



>ref|XP_004510570.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cicer 
arietinum]
Length=531

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+  +N+N  V +CQYAVRGE+   A  LQK+ +         +II+ N+GNP +LGQ+P
Sbjct  53   PVTAQNINPQVLQCQYAVRGEIVTLAQNLQKDLQANPGSHSFDEIIYCNIGNPQSLGQQP  112

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P LLD      +F AD+I RA Q +    G   GAY
Sbjct  113  ITFFREVLALCDYPALLDKSETQGLFSADSIERAWQIVEQIPGRATGAY  161



>gb|AFK39904.1| unknown [Medicago truncatula]
Length=524

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 64/109 (59%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQK---------EGKKIIFTNVGNPHALGQKP  374
            P+  +N+N  V KCQYAVRGE+   A  LQK            +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P LLD      +F AD+I RA Q +    G   GAY
Sbjct  106  ITFFREVLALCDYPALLDKSETQGLFSADSIERAWQLVDQIPGRATGAY  154



>ref|XP_003627448.1| Alanine aminotransferase [Medicago truncatula]
 gb|AET01924.1| alanine aminotransferase [Medicago truncatula]
Length=524

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 64/109 (59%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQK---------EGKKIIFTNVGNPHALGQKP  374
            P+  +N+N  V KCQYAVRGE+   A  LQK            +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P LLD      +F AD+I RA Q +    G   GAY
Sbjct  106  ITFFREVLALCDYPALLDKSETQGLFSADSIERAWQIVDQIPGRATGAY  154



>ref|XP_003646187.1| hypothetical protein Ecym_4307 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET39370.1| hypothetical protein Ecym_4307 [Eremothecium cymbalariae DBVPG#7215]
Length=534

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 47/110 (43%), Positives = 70/110 (64%), Gaps = 11/110 (10%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  374
            PL  E+LN NV + +YAVRG++  RA EL+++          KKII+ N+GNP  LGQKP
Sbjct  55   PLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKP  114

Query  375  LTFPRQVIALCQAPFLLDDPN--VGLVFPADAIARAKQFLSMTSGGLGAY  518
            L+F R+V++L ++P LL  P   + L++  DA+ RAK+ +      +GAY
Sbjct  115  LSFSREVLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAY  164



>ref|XP_821936.1| alanine aminotransferase [Trypanosoma cruzi strain CL Brener]
 gb|EAO00085.1| alanine aminotransferase, putative [Trypanosoma cruzi]
Length=493

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQK-----EGK------KIIFTNVGNPHALGQKPLTFP  386
            +N  V   +YAVRG L +RA E++      EGK       I++ N+GNP AL QKPLTF 
Sbjct  10   INPRVVAAEYAVRGMLPMRADEIRAALATPEGKAKYPFSSIVYCNIGNPQALEQKPLTFF  69

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            RQV++L  APFLL++  V   FPADA+ARA+++L       GAY
Sbjct  70   RQVMSLIDAPFLLENEKVTSQFPADAVARAREYLRHIGDRTGAY  113



>ref|XP_009389580.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=487

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 66/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+  + +N  V KCQYAVRG +   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  9    PVSIDTINPKVLKCQYAVRGAIVSHAQRLQQELQTSQGSLPFDEILYCNIGNPQSLGQQP  68

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P LL   N+  +F  DAI RA++ L +  G   GAY
Sbjct  69   ITFFREVLALCDHPALLGKSNIDALFSKDAIGRAQKILDLIPGRATGAY  117



>gb|KFH67262.1| alanine transaminase [Mortierella verticillata NRRL 6337]
Length=540

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 12/109 (11%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  380
            L  +N+NE V+K +YAVRGEL +R+ EL+ E         K+++  N+GNP AL QKP+T
Sbjct  62   LTSKNMNEQVRKAEYAVRGELAIRSEELKNELAKGVKLPFKRVVGCNIGNPQALDQKPIT  121

Query  381  FPRQVIALCQAPFLLDDPNVGL---VFPADAIARAKQFLSMTSGGLGAY  518
            F RQV +L + P LL D N  L   ++P+DAI RAK  L    G +GAY
Sbjct  122  FFRQVASLTEYPELLKDENRELALKIYPSDAIDRAKLLLKHI-GSVGAY  169



>ref|XP_820876.1| alanine aminotransferase [Trypanosoma cruzi strain CL Brener]
 gb|EAN99025.1| alanine aminotransferase, putative [Trypanosoma cruzi]
Length=493

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQK-----EGK------KIIFTNVGNPHALGQKPLTFP  386
            +N  V   +YAVRG L +RA E++      EGK       I++ N+GNP AL QKPLTF 
Sbjct  10   INPRVVAAEYAVRGMLPMRADEIRAALATPEGKAKYPFSSIVYCNIGNPQALEQKPLTFF  69

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            RQV++L  APFLL++  V   FPADA+ARA+++L       GAY
Sbjct  70   RQVMSLIDAPFLLENEKVTSQFPADAVARAREYLRHIGDRTGAY  113



>ref|XP_820878.1| alanine aminotransferase [Trypanosoma cruzi strain CL Brener]
 gb|EAN99027.1| alanine aminotransferase, putative [Trypanosoma cruzi]
Length=497

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQK-----EGK------KIIFTNVGNPHALGQKPLTFP  386
            +N  V   +YAVRG L +RA E++      EGK       I++ N+GNP AL QKPLTF 
Sbjct  14   INPRVVAAEYAVRGMLPMRADEIRAALATPEGKAKYPFSSIVYCNIGNPQALEQKPLTFF  73

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            RQV++L  APFLL++  V   FPADA+ARA+++L       GAY
Sbjct  74   RQVMSLIDAPFLLENEKVTSQFPADAVARAREYLRHIGDRTGAY  117



>ref|XP_008380735.1| PREDICTED: alanine aminotransferase 2 [Malus domestica]
Length=543

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+  +N+N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  65   PVTLQNINPKVLKCEYAVRGEIVTLAQRLQEELKANPGSHPFDEILYCNIGNPQSLGQQP  124

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+++ALC  P +LD      +F ADAI RA + L    G   GAY
Sbjct  125  ITFFREILALCDHPAILDKSETQGLFSADAIERAWEILDQIPGRATGAY  173



>gb|AAC14084.1| TcC31.28 [Trypanosoma cruzi]
Length=409

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQK-----EGK------KIIFTNVGNPHALGQKPLTFP  386
            +N  V   +YAVRG L +RA E++      EGK       I++ N+GNP AL QKPLTF 
Sbjct  10   INPRVVAAEYAVRGMLPMRADEIRAALATPEGKAKYPFSSIVYCNIGNPQALEQKPLTFF  69

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            RQV++L  APFLL++  V   +PADA+ARA+++L       GAY
Sbjct  70   RQVMSLIDAPFLLENEKVTSQYPADAVARAREYLRHIGDRTGAY  113



>sp|P34106.1|ALA2_PANMI RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Panicum miliaceum]
 emb|CAA49199.1| alanine aminotransferase [Panicum miliaceum]
Length=482

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  386
            ENLN  V KC+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQHLQQQLQTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P LL+      +F ADAI+RAKQ LS   G   GAY
Sbjct  68   REVLALCDHPCLLEKEETKSLFSADAISRAKQILSTIPGRATGAY  112



>ref|XP_008654837.1| PREDICTED: uncharacterized protein LOC100193705 isoform X1 [Zea 
mays]
Length=482

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  386
            ENLN  V KC+YAVRGE+ + A  LQ++           +I+F N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILFCNIGNPQSLGQQPVTFF  67

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P LL+      +F ADAI+RAKQ L+   G   GAY
Sbjct  68   REVLALCDHPCLLEKEETKSLFSADAISRAKQILATIPGRATGAY  112



>ref|XP_006657960.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Oryza 
brachyantha]
Length=491

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 65/109 (60%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  374
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  13   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPESLPFDEILYCNIGNPQSLGQQP  72

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V++LC  P LLD      ++ +DAI RA Q L    G   GAY
Sbjct  73   VTFFREVLSLCDHPALLDKSETHALYSSDAIERAWQILDKIPGRATGAY  121



>gb|ADB91976.1| alanine aminotransferase [Branchiostoma belcheri]
Length=500

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 70/107 (65%), Gaps = 13/107 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  380
            L  +++N  VKK +YAVRG +  RA+EL+KE         K++I  N+G+ HA+GQKP+T
Sbjct  26   LTIDSMNPLVKKVEYAVRGPIVARATELEKELERGVPKPFKQVIKANIGDAHAMGQKPIT  85

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAY  518
            F RQVI+LC  P LLD+ +    FPADA  RA++ L    GG LG+Y
Sbjct  86   FLRQVISLCVNPDLLDNES----FPADARERARRILQGCKGGSLGSY  128



>ref|XP_005838227.1| hypothetical protein GUITHDRAFT_103164 [Guillardia theta CCMP2712]
 gb|EKX51247.1| hypothetical protein GUITHDRAFT_103164 [Guillardia theta CCMP2712]
Length=483

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 62/106 (58%), Gaps = 8/106 (8%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  380
            L  E +N  V   QYA+RG L LRA + ++  K+        II+ N+GNP  L QKP+T
Sbjct  13   LTAETINPKVLDAQYAIRGALVLRAMQHERNLKESVRMPFDEIIYCNIGNPQQLNQKPIT  72

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            F RQV+AL   P L++ P    +FP DAI RA+ F S   GG GAY
Sbjct  73   FFRQVLALMDYPDLVEMPKAKKLFPEDAIERARMFFSNIPGGTGAY  118



>ref|XP_004983099.1| PREDICTED: alanine aminotransferase 2-like [Setaria italica]
Length=482

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 68/105 (65%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  386
            ENLN  V KC+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQNQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P LL+   +  +F ADAI+RAKQ L+   G   GAY
Sbjct  68   REVLALCDHPCLLEKEEIKSLFSADAISRAKQILATIPGRATGAY  112



>ref|XP_011079322.1| PREDICTED: alanine aminotransferase 2-like [Sesamum indicum]
Length=542

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            PL  + +N  V +C+YAVRGE+ + A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  64   PLTLDTINPKVLECEYAVRGEIVILAQRLQEELKNNPNAHPFDEILYCNIGNPQSLGQQP  123

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P LLD      +F AD+I RA + L    G   GAY
Sbjct  124  ITFFREVLALCDHPALLDKAETRGLFSADSIERASEILHQIPGRATGAY  172



>dbj|GAA97564.1| hypothetical protein E5Q_04242 [Mixia osmundae IAM 14324]
 gb|KEI42010.1| hypothetical protein L969DRAFT_91476 [Mixia osmundae IAM 14324]
Length=574

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 67/108 (62%), Gaps = 11/108 (10%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK----------IIFTNVGNPHALGQKP  374
            L  +++N NVK  +YAVRG + LRA EL+ + +K          ++  N+GNP  LGQ P
Sbjct  98   LTLDSINHNVKTAEYAVRGAIALRAEELRVKTQKGDTKDLNFKEVVSCNIGNPQQLGQTP  157

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            +TF RQV ALC+ P LLD+P    +F  DAI RA++++    G +GAY
Sbjct  158  ITFFRQVAALCECPDLLDNPLAPKLFAQDAIDRAREYIKAI-GSVGAY  204



>ref|XP_455940.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAG98648.1| KLLA0F19162p [Kluyveromyces lactis]
Length=528

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 69/109 (63%), Gaps = 11/109 (10%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPL  377
            L  +++NENV K +YAVRG + +RA EL+ + KK         II  N+GNP  L QKPL
Sbjct  49   LSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPL  108

Query  378  TFPRQVIALCQAPFLLDDPNVGL--VFPADAIARAKQFLSMTSGGLGAY  518
            TF R+V++L Q P LL++ +  L  ++  D+I RAK+ LS   G +GAY
Sbjct  109  TFYREVLSLLQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAY  157



>ref|XP_010029516.1| PREDICTED: alanine aminotransferase 2-like [Eucalyptus grandis]
 gb|KCW56436.1| hypothetical protein EUGRSUZ_I02163 [Eucalyptus grandis]
Length=539

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  374
            P+  + +N  V KC+YAVRGE+   A  LQ+E K+         I++ N+GNP +LGQ+P
Sbjct  61   PVTLDTINPKVLKCEYAVRGEIVSIAQRLQQELKENPGSHPFDEILYCNIGNPQSLGQQP  120

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAY
Sbjct  121  ITFFREVLALCDHPSILDKSETQGLFSADAIERAWQILDQIPGRATGAY  169



>ref|XP_008228107.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Prunus 
mume]
Length=544

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 64/109 (59%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  374
            P+  +N+N  + KC+YAVRGE+   A  LQ+E           +I++ N+GNP +LGQ P
Sbjct  66   PVTLQNINPKILKCEYAVRGEIVTLAQRLQEELLANPGSHPFDEILYCNIGNPQSLGQHP  125

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAY
Sbjct  126  ITFFREVLALCDHPSILDKSETQGLFSADAIERAWQILDQIPGRATGAY  174



>ref|XP_011036545.1| PREDICTED: alanine aminotransferase 2-like [Populus euphratica]
Length=533

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 64/105 (61%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  386
            +N+N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P+TF 
Sbjct  59   DNINPKVLKCEYAVRGEIVTLAQALQEELKSKPGSHPFDEILYCNIGNPQSLGQQPITFF  118

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P +LD      +F ADAI RA Q L    G   GAY
Sbjct  119  REVLALCDHPSILDRSETQGLFSADAIERAWQILDQIPGRATGAY  163



>emb|CBI35796.3| unnamed protein product [Vitis vinifera]
Length=482

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  374
            P+  E +N  V +C+YAVRGE+   A  LQ+E ++         I++ N+GNP +LGQ+P
Sbjct  4    PVTLETINPKVLECEYAVRGEIVTLAQRLQQELQEKPGSLPFDEILYCNIGNPQSLGQQP  63

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+VIALC  P +LD      +F ADAI RA Q L    G   GAY
Sbjct  64   ITFFREVIALCDHPPILDKSETQGLFSADAIERAWQILDQIPGRATGAY  112



>gb|EEE67593.1| hypothetical protein OsJ_25140 [Oryza sativa Japonica Group]
Length=546

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 65/109 (60%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  374
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  68   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPDSLPFDEILYCNIGNPQSLGQQP  127

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V++LC  P LLD      ++ +DAI RA Q L    G   GAY
Sbjct  128  VTFFREVLSLCDHPALLDKSETHALYSSDAIERAWQILDKIPGRATGAY  176



>gb|EEC82447.1| hypothetical protein OsI_26881 [Oryza sativa Indica Group]
Length=546

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 65/109 (60%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  374
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  68   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPDSLPFDEILYCNIGNPQSLGQQP  127

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V++LC  P LLD      ++ +DAI RA Q L    G   GAY
Sbjct  128  VTFFREVLSLCDHPALLDKSETHALYSSDAIERAWQILDKIPGRATGAY  176



>ref|XP_007217248.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
 gb|EMJ18447.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
Length=544

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 64/109 (59%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  374
            P+  +N+N  + KC+YAVRGE+   A  LQ+E           +I++ N+GNP +LGQ P
Sbjct  66   PVTLQNINPKILKCEYAVRGEIVTLAQRLQEELLANPGSHPFDEILYCNIGNPQSLGQHP  125

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAY
Sbjct  126  ITFFREVLALCDHPSILDKSETQGLFSADAIERAWQILDQIPGRATGAY  174



>ref|XP_002295840.1| alanine aminotransferase, aminotransferase class I [Thalassiosira 
pseudonana CCMP1335]
 gb|ACI64557.1| alanine aminotransferase, aminotransferase class I [Thalassiosira 
pseudonana CCMP1335]
Length=485

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 69/111 (62%), Gaps = 13/111 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK----------IIFTNVGNPHALGQKP  374
            L  + +++N+K  +YAVRG++ + A  + +E K           II TN+GNPHA+ QK 
Sbjct  3    LSIDTISDNLKAMEYAVRGKIAIEADRITEELKSSTDNKYPFDHIIMTNIGNPHAVQQKA  62

Query  375  LTFPRQVIALCQ--APFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            LT+PRQV+AL Q   P  +D P+   +FP DAIARAK+  +   G G+GAY
Sbjct  63   LTWPRQVMALLQLPDPLGIDHPSANALFPEDAIARAKEMKAALGGHGIGAY  113



>ref|XP_002265294.2| PREDICTED: alanine aminotransferase 2 [Vitis vinifera]
Length=526

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  374
            P+  E +N  V +C+YAVRGE+   A  LQ+E ++         I++ N+GNP +LGQ+P
Sbjct  48   PVTLETINPKVLECEYAVRGEIVTLAQRLQQELQEKPGSLPFDEILYCNIGNPQSLGQQP  107

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+VIALC  P +LD      +F ADAI RA Q L    G   GAY
Sbjct  108  ITFFREVIALCDHPPILDKSETQGLFSADAIERAWQILDQIPGRATGAY  156



>ref|XP_006649511.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=482

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 69/105 (66%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  386
            EN+N  V +C+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQKP+TF 
Sbjct  8    ENINPKVLRCEYAVRGEISIHAQHLQQQLQAQPGSLPFDEILYCNIGNPQSLGQKPITFF  67

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P LLD   +  +F ADAIARAK+ L++  G   GAY
Sbjct  68   REVLALCDHPKLLDREEIKSLFSADAIARAKKILALIPGRATGAY  112



>emb|CDS30789.1| gag pol polyprotein [Hymenolepis microstoma]
Length=485

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 13/107 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPLT  380
            L    +N NV + QYAVRG + +R+ EL+KE K         ++  N+G+ HA GQKP+T
Sbjct  8    LTLATINPNVVQMQYAVRGPIVIRSQELEKELKDGQKKKFEHVVKCNIGDCHATGQKPIT  67

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAY  518
            F RQVIALC  P LLDDPN    FP DA  RA+  L+  +G  +G+Y
Sbjct  68   FLRQVIALCSYPTLLDDPN----FPEDAKDRARGILAGCAGASVGSY  110



>ref|XP_821938.1| alanine aminotransferase [Trypanosoma cruzi strain CL Brener]
 gb|AAC14082.1| TcC31.26 [Trypanosoma cruzi]
 gb|EAO00087.1| alanine aminotransferase, putative [Trypanosoma cruzi]
Length=497

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQK-----EGK------KIIFTNVGNPHALGQKPLTFP  386
            +N  V   +YAVRG L +RA E++      EGK       I++ N+GNP AL QKPLTF 
Sbjct  14   INPRVVAAEYAVRGMLPMRADEIRAALATPEGKAKYPFPSIVYCNIGNPQALEQKPLTFF  73

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            RQV++L  APFLL++  V   +PADA+ARA+++L       GAY
Sbjct  74   RQVMSLIDAPFLLENEKVTSQYPADAVARAREYLRHIGDRTGAY  117



>ref|XP_010537653.1| PREDICTED: alanine aminotransferase 2, mitochondrial [Tarenaya 
hassleriana]
Length=540

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  374
            P+  +++N  V KC+YAVRGE+   A  LQ++ K         +II+ N+GNP +LGQ+P
Sbjct  62   PVTVQSINPKVLKCEYAVRGEIVSIAQRLQEDLKVNKDAYPFDEIIYCNIGNPQSLGQQP  121

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +T+ R+V+ALC  P LLD+     +F ADAI RA + L    G   GAY
Sbjct  122  ITYFREVLALCDHPALLDESQTHGLFSADAIGRAWKILDQIPGRATGAY  170



>ref|XP_002499950.1| alanine aminotransferase [Micromonas sp. RCC299]
 gb|ACO61208.1| alanine aminotransferase [Micromonas sp. RCC299]
Length=463

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 58/94 (62%), Gaps = 9/94 (10%)
 Frame = +3

Query  264  QYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPLTFPRQVIALCQAP  416
            +YAVRG +  RA EL+ + KK         I+  N+GNP ++GQKP+TF RQV+AL   P
Sbjct  2    EYAVRGAIVTRAGELEAQLKKDPASLPFDKIVMCNIGNPQSVGQKPITFYRQVLALTDYP  61

Query  417  FLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
             L+D P  G +FP+D I+ AK  L    GG GAY
Sbjct  62   QLMDAPEAGKLFPSDVISTAKHILGNMKGGTGAY  95



>gb|KJB70038.1| hypothetical protein B456_011G0552002, partial [Gossypium raimondii]
Length=116

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 65/105 (62%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFP  386
            +++N  V +CQYAVRGE+ + A +LQ+E          ++I++ N+GNP +LGQK +TF 
Sbjct  8    DSINPKVIECQYAVRGEIVILAQKLQQEIQAKPEAYPFQEILYCNIGNPQSLGQKSITFF  67

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P +L       +F AD+I RA++ L    G   GAY
Sbjct  68   REVLALCDHPAILAKSETQALFSADSIERARKILDQIPGKATGAY  112



>gb|EKG02049.1| alanine aminotransferase, putative [Trypanosoma cruzi]
Length=497

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQK-----EGK------KIIFTNVGNPHALGQKPLTFP  386
            +N  V   +YAVRG L +RA E++      EGK       I++ N+GNP AL QKPLTF 
Sbjct  14   INPRVVAAEYAVRGMLPMRADEIRAALATPEGKAKYPFSSIVYCNIGNPQALEQKPLTFF  73

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            RQV++L  APFLL++  V   +PADA+ARA+++L       GAY
Sbjct  74   RQVMSLIDAPFLLENEKVTSQYPADAVARAREYLRHIGDRTGAY  117



>gb|ESS66397.1| alanine aminotransferase [Trypanosoma cruzi Dm28c]
Length=500

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQK-----EGK------KIIFTNVGNPHALGQKPLTFP  386
            +N  V   +YAVRG L +RA E++      EGK       I++ N+GNP AL QKPLTF 
Sbjct  17   INPRVVAAEYAVRGMLPMRADEIRAALATPEGKAKYPFSSIVYCNIGNPQALEQKPLTFF  76

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            RQV++L  APFLL++  V   +PADA+ARA+++L       GAY
Sbjct  77   RQVMSLIDAPFLLENEKVTSQYPADAVARAREYLRHIGDRTGAY  120



>gb|EKF30498.1| alanine aminotransferase, putative [Trypanosoma cruzi marinkellei]
Length=497

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQK-----EGK------KIIFTNVGNPHALGQKPLTFP  386
            +N  V   +YAVRG L +RA E++      EGK       I++ N+GNP AL QKPLTF 
Sbjct  14   INPRVVAAEYAVRGMLPMRADEIRAALATPEGKAKYPFPSIVYCNIGNPQALEQKPLTFF  73

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            RQV++L  APFLL++  V   +PADA+ARAK++L       GAY
Sbjct  74   RQVMSLIDAPFLLENEKVISQYPADAVARAKEYLRHIGDRTGAY  117



>gb|EKF30500.1| alanine aminotransferase, putative [Trypanosoma cruzi marinkellei]
Length=493

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQK-----EGK------KIIFTNVGNPHALGQKPLTFP  386
            +N  V   +YAVRG L +RA E++      EGK       I++ N+GNP AL QKPLTF 
Sbjct  10   INPRVVAAEYAVRGVLPMRADEIRAALATPEGKAKYPFPSIVYCNIGNPQALEQKPLTFF  69

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            RQV++L  APFLL++  V   +PADA+ARAK++L       GAY
Sbjct  70   RQVMSLIDAPFLLENEKVISQYPADAVARAKEYLRHIGDRTGAY  113



>ref|XP_011072689.1| PREDICTED: alanine aminotransferase 2 [Sesamum indicum]
Length=547

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  374
            P+  +++N  V +C+YAVRGE+   A +LQ+E KK         I++ N+GNP +LGQ+P
Sbjct  69   PVKLDSINPKVLECEYAVRGEIVTLAQKLQEELKKNPGSHPFDEILYCNIGNPQSLGQQP  128

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +LD      +F AD+I RA Q L    G   GAY
Sbjct  129  ITFFREVLALCDHPAILDKAETQGLFSADSIERAFQILDQIPGRATGAY  177



>emb|CDQ82436.1| unnamed protein product [Oncorhynchus mykiss]
Length=534

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 69/107 (64%), Gaps = 13/107 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  380
            L+ + +N NVK+ +YAVRG +  RA +++KE K+        +I  N+G+ HA+GQKP+T
Sbjct  59   LNMDTMNPNVKRVEYAVRGPIVQRALQIEKELKEGVEKPFTEVIKANIGDAHAMGQKPIT  118

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAY  518
            F RQV+ALC  P LL+D      FP DA +RA++ L    GG +GAY
Sbjct  119  FLRQVVALCVYPDLLEDDK----FPEDAKSRARRILQACGGGSIGAY  161



>gb|AAC62456.1| alanine aminotransferase [Zea mays]
Length=482

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 66/105 (63%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  386
            ENLN  V KC+YAVRGE+ + A   Q++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRRQQQLQTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P LL+      +F ADAI+RAKQ L+   G   GAY
Sbjct  68   REVLALCDHPCLLEKEETKSLFSADAISRAKQILATIPGRATGAY  112



>gb|AFW68850.1| alanine aminotransferase [Zea mays]
Length=482

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  386
            ENLN  V KC+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P LL+      +F ADAI+RAKQ L+   G   GAY
Sbjct  68   REVLALCDHPCLLEKEETKSLFSADAISRAKQILATIPGRATGAY  112



>ref|WP_005033524.1| aminotransferase class I/II [Holophaga foetida]
Length=451

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 65/98 (66%), Gaps = 2/98 (2%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  404
            +  ++L + V + QYAVRG +  +A ++++EG++II+ N+GNP AL QKPLT+ RQ +AL
Sbjct  3    MQLKDLGKAVLETQYAVRGPIVAKAQDMEREGREIIYCNIGNPQALEQKPLTYLRQTLAL  62

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAY  518
            CQ P L+       +FPAD +  +++ L     G+GAY
Sbjct  63   CQYPELIQ--QAAHLFPADVLENSQRLLVGIEHGMGAY  98



>ref|XP_004155894.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=488

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 65/109 (60%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  374
            P+   N+N  V KC+YAVRGE+   A  LQ+E          ++I++ N+GNP +LGQ+P
Sbjct  10   PISIHNINPKVLKCEYAVRGEIVALAQTLQEELLTNPGSRPFEEILYCNIGNPQSLGQQP  69

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +L+   V  +F  DAI RA Q L    G   GAY
Sbjct  70   ITFFREVLALCDYPSILERKEVEGLFSEDAIKRASQILKQIPGKATGAY  118



>emb|CBN81871.1| Alanine aminotransferase 2-like [Dicentrarchus labrax]
Length=491

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 67/107 (63%), Gaps = 13/107 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  380
            L  +N+N NVK+ +YAVRG +  RA +++KE K+        +I  N+G+ HA+GQKP+T
Sbjct  16   LTLDNMNPNVKRVEYAVRGPIVQRAVQIEKELKEGVKKPFSEVIKANIGDAHAMGQKPIT  75

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            F RQV+ALC  P LL+D      FP DA  RAK+ L    G  +GAY
Sbjct  76   FLRQVLALCSYPELLEDNK----FPEDAKKRAKRILQACGGHSIGAY  118



>ref|XP_004141733.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
 gb|KGN45438.1| hypothetical protein Csa_7G448000 [Cucumis sativus]
Length=488

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 65/109 (60%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  374
            P+   N+N  V KC+YAVRGE+   A  LQ+E          ++I++ N+GNP +LGQ+P
Sbjct  10   PISIHNINPKVLKCEYAVRGEIVALAQTLQEELLTNPGSRPFEEILYCNIGNPQSLGQQP  69

Query  375  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            +TF R+V+ALC  P +L+   V  +F  DAI RA Q L    G   GAY
Sbjct  70   ITFFREVLALCDYPSILERKEVEGLFSEDAIKRASQILKQIPGKATGAY  118



>ref|NP_001149227.1| LOC100282849 [Zea mays]
 gb|ACG34631.1| alanine aminotransferase 2 [Zea mays]
Length=482

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = +3

Query  234  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  386
            ENLN  V KC+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  387  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            R+V+ALC  P LL+      +F ADAI+RAKQ L+   G   GAY
Sbjct  68   REVLALCDYPCLLEKEETKSLFSADAISRAKQILATIPGRATGAY  112



>ref|XP_005526439.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Pseudopodoces 
humilis]
Length=551

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 67/107 (63%), Gaps = 13/107 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  380
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  76   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  135

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+Y
Sbjct  136  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSY  178



>ref|XP_005052721.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Ficedula albicollis]
 ref|XP_005052722.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Ficedula albicollis]
Length=549

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 67/107 (63%), Gaps = 13/107 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  380
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  74   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  133

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+Y
Sbjct  134  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSY  176



>ref|XP_010939849.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Elaeis guineensis]
Length=475

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 63/99 (64%), Gaps = 10/99 (10%)
 Frame = +3

Query  252  VKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFPRQVIAL  404
            V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P+TF R+V+AL
Sbjct  7    VLKCEYAVRGEIVSHAQRLQQELQTKPGSYPFDEILYCNIGNPQSLGQQPVTFFREVLAL  66

Query  405  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            C  P +LD      +F +DAIARA+Q L +  G   GAY
Sbjct  67   CDHPSILDKSEAHALFSSDAIARARQILDLIPGRATGAY  105



>ref|XP_002430215.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
 gb|EEB17477.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
Length=482

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 67/102 (66%), Gaps = 13/102 (13%)
 Frame = +3

Query  240  LNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLTFPRQV  395
            +N+N+K  +YAVRG L +RA EL+K+         KK+I  N+G+ HA+GQKPLTF RQV
Sbjct  1    MNKNIKTMEYAVRGPLLVRAIELEKQLEAGEKKPFKKVIKANLGDAHAMGQKPLTFYRQV  60

Query  396  IALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAY  518
            +AL   P LL D +    FP+D I RA++ LS   GG +G+Y
Sbjct  61   LALVSYPELLKDSS----FPSDTICRAEELLSACKGGSVGSY  98



>gb|KFO69634.1| Alanine aminotransferase 2, partial [Cuculus canorus]
Length=482

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 67/107 (63%), Gaps = 13/107 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  380
            L  E++N  VK  +YAVRG + L+A E++KE ++        +I  N+G+ HA+GQ+P+T
Sbjct  7    LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRRGIKKPFTEVIKANIGDAHAMGQRPIT  66

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            F RQV+ALC  P LLD P+    FP DA  RAK+ L    G  LG+Y
Sbjct  67   FLRQVVALCTYPNLLDSPS----FPEDAKKRAKRILQGCGGNSLGSY  109



>ref|XP_006775215.1| PREDICTED: alanine aminotransferase 1 [Myotis davidii]
Length=307

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 66/107 (62%), Gaps = 13/107 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  380
            L  + +N  VK+ +YAVRG + LRA EL++E ++        +I  N+G+ HA+GQKP+T
Sbjct  21   LTLDTMNACVKRVEYAVRGPIVLRALELEQELRQGVKKPFTEVIHANIGDAHAMGQKPIT  80

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            F RQV+ALC  P LL+ P+    FP DA  RA+  L    G  LGAY
Sbjct  81   FLRQVLALCVHPDLLNSPD----FPEDAKRRAENILQACRGHSLGAY  123



>ref|XP_002194653.1| PREDICTED: alanine aminotransferase 2 [Taeniopygia guttata]
Length=552

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 67/107 (63%), Gaps = 13/107 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  380
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  77   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  136

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+Y
Sbjct  137  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSY  179



>gb|KFW64540.1| Alanine aminotransferase 2, partial [Pygoscelis adeliae]
Length=539

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 67/107 (63%), Gaps = 13/107 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  380
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  64   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  123

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+Y
Sbjct  124  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSY  166



>ref|XP_008637027.1| PREDICTED: alanine aminotransferase 2 [Corvus brachyrhynchos]
Length=551

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 67/107 (63%), Gaps = 13/107 (12%)
 Frame = +3

Query  225  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  380
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  76   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  135

Query  381  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAY  518
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+Y
Sbjct  136  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSY  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000