BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF012M06

Length=465
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57281.1|  protein kinase family protein                          109   2e-25   Ipomoea nil [qian niu]



>dbj|BAO57281.1| protein kinase family protein [Ipomoea nil]
Length=401

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  307  MDLRTSVDGGEVPKGDYSGHPEGELGSKLKGPGSISDGNMAGKSPSKDMIFRA  465
            MDLRTSVDGGEVPKGDYSGHPEGELGSKLKGPGSISDGNMAGKSPSKDMIFRA
Sbjct  1    MDLRTSVDGGEVPKGDYSGHPEGELGSKLKGPGSISDGNMAGKSPSKDMIFRA  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559272306750