BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF012M05

Length=492
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357614.1|  PREDICTED: glutamate--glyoxylate aminotransf...    241   7e-74   Solanum tuberosum [potatoes]
ref|XP_004239121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    240   8e-74   Solanum lycopersicum
gb|EPS68501.1|  hypothetical protein M569_06265                         238   5e-73   Genlisea aurea
emb|CDP13207.1|  unnamed protein product                                238   7e-73   Coffea canephora [robusta coffee]
ref|XP_010682426.1|  PREDICTED: glutamate--glyoxylate aminotransf...    237   2e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009759837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    235   8e-72   Nicotiana sylvestris
ref|XP_009624740.1|  PREDICTED: glutamate--glyoxylate aminotransf...    235   1e-71   Nicotiana tomentosiformis
ref|XP_009765091.1|  PREDICTED: glutamate--glyoxylate aminotransf...    235   1e-71   Nicotiana sylvestris
ref|XP_006416098.1|  hypothetical protein EUTSA_v10007514mg             231   1e-71   
ref|XP_009623844.1|  PREDICTED: glutamate--glyoxylate aminotransf...    234   3e-71   Nicotiana tomentosiformis
ref|NP_001268094.1|  uncharacterized protein LOC100261274               234   4e-71   Vitis vinifera
emb|CAN62302.1|  hypothetical protein VITISV_023686                     233   4e-71   Vitis vinifera
emb|CBI23368.3|  unnamed protein product                                233   4e-71   Vitis vinifera
gb|EYU28421.1|  hypothetical protein MIMGU_mgv1a005535mg                233   4e-71   Erythranthe guttata [common monkey flower]
ref|XP_004489786.1|  PREDICTED: glutamate--glyoxylate aminotransf...    234   5e-71   
ref|XP_004489787.1|  PREDICTED: glutamate--glyoxylate aminotransf...    233   5e-71   Cicer arietinum [garbanzo]
ref|XP_010552672.1|  PREDICTED: glutamate--glyoxylate aminotransf...    233   7e-71   Tarenaya hassleriana [spider flower]
gb|AAZ43368.1|  AlaT1                                                   233   8e-71   Vitis labrusca [Concord grape]
ref|XP_009115544.1|  PREDICTED: glutamate--glyoxylate aminotransf...    232   1e-70   Brassica rapa
ref|NP_001031083.1|  glutamate:glyoxylate aminotransferase              231   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307377.1|  hypothetical protein CARUB_v10009003mg             232   1e-70   Capsella rubella
ref|XP_002887312.1|  alanine-2-oxoglutarate aminotransferase 2          232   2e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_010100388.1|  Glutamate--glyoxylate aminotransferase 2           232   2e-70   Morus notabilis
ref|XP_010023477.1|  PREDICTED: glutamate--glyoxylate aminotransf...    232   2e-70   Eucalyptus grandis [rose gum]
ref|XP_006416099.1|  hypothetical protein EUTSA_v10007514mg             231   2e-70   
gb|AAK25905.1|AF360195_1  putative alanine aminotransferase             231   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006438273.1|  hypothetical protein CICLE_v10031381mg             229   2e-70   
gb|AAL24255.1|  At1g23310/F26F24_4                                      231   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564192.2|  glutamate:glyoxylate aminotransferase                 231   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477627.1|  PREDICTED: glutamate--glyoxylate aminotransf...    231   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_004228555.1|  PREDICTED: glutamate--glyoxylate aminotransf...    231   2e-70   Solanum lycopersicum
ref|XP_002893277.1|  alanine-2-oxoglutarate aminotransferase 1          231   3e-70   
dbj|BAH20108.1|  AT1G70580                                              231   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177215.1|  glutamate--glyoxylate aminotransferase 2              231   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006378236.1|  hypothetical protein POPTR_0010s05530g             227   3e-70   
ref|XP_011071137.1|  PREDICTED: glutamate--glyoxylate aminotransf...    231   3e-70   
ref|XP_010415743.1|  PREDICTED: glutamate--glyoxylate aminotransf...    231   4e-70   Camelina sativa [gold-of-pleasure]
gb|KHG15331.1|  Glutamate--glyoxylate aminotransferase 2 -like pr...    231   4e-70   Gossypium arboreum [tree cotton]
ref|XP_010427837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    231   4e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010471056.1|  PREDICTED: glutamate--glyoxylate aminotransf...    231   5e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006300456.1|  hypothetical protein CARUB_v10020212mg             230   5e-70   
ref|XP_010927963.1|  PREDICTED: glutamate--glyoxylate aminotransf...    230   6e-70   Elaeis guineensis
ref|XP_006390865.1|  hypothetical protein EUTSA_v10018474mg             230   7e-70   
ref|XP_006348507.1|  PREDICTED: glutamate--glyoxylate aminotransf...    230   7e-70   
emb|CDY61225.1|  BnaC06g43710D                                          230   8e-70   Brassica napus [oilseed rape]
gb|KDO82251.1|  hypothetical protein CISIN_1g041151mg                   229   8e-70   Citrus sinensis [apfelsine]
ref|XP_009105727.1|  PREDICTED: glutamate--glyoxylate aminotransf...    230   9e-70   Brassica rapa
ref|XP_010460118.1|  PREDICTED: glutamate--glyoxylate aminotransf...    230   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006658210.1|  PREDICTED: glutamate--glyoxylate aminotransf...    230   1e-69   
ref|XP_009413361.1|  PREDICTED: glutamate--glyoxylate aminotransf...    229   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008446998.1|  PREDICTED: glutamate--glyoxylate aminotransf...    222   1e-69   
ref|XP_006438274.1|  hypothetical protein CICLE_v10031381mg             229   1e-69   Citrus clementina [clementine]
ref|XP_010498838.1|  PREDICTED: glutamate--glyoxylate aminotransf...    229   1e-69   Camelina sativa [gold-of-pleasure]
gb|KJB31174.1|  hypothetical protein B456_005G179600                    227   1e-69   Gossypium raimondii
gb|KDP26646.1|  hypothetical protein JCGZ_17804                         229   2e-69   Jatropha curcas
ref|XP_010251104.1|  PREDICTED: glutamate--glyoxylate aminotransf...    229   2e-69   Nelumbo nucifera [Indian lotus]
ref|XP_004955317.1|  PREDICTED: glutamate--glyoxylate aminotransf...    229   2e-69   Setaria italica
emb|CDY66294.1|  BnaAnng22050D                                          229   2e-69   Brassica napus [oilseed rape]
ref|NP_001058716.1|  Os07g0108300                                       229   2e-69   
ref|XP_002527918.1|  alanine aminotransferase, putative                 228   2e-69   
gb|AAO84040.1|  alanine aminotransferase                                229   2e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_004955316.1|  PREDICTED: glutamate--glyoxylate aminotransf...    230   3e-69   
ref|XP_008789746.1|  PREDICTED: glutamate--glyoxylate aminotransf...    228   3e-69   
ref|XP_003613140.1|  Alanine aminotransferase                           228   3e-69   
ref|XP_003613139.1|  Alanine aminotransferase                           228   4e-69   Medicago truncatula
gb|AAM61453.1|  putative alanine aminotransferase                       228   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003557680.1|  PREDICTED: glutamate--glyoxylate aminotransf...    228   4e-69   Brachypodium distachyon [annual false brome]
ref|XP_008221924.1|  PREDICTED: glutamate--glyoxylate aminotransf...    228   4e-69   Prunus mume [ume]
ref|XP_009110107.1|  PREDICTED: glutamate--glyoxylate aminotransf...    228   4e-69   Brassica rapa
emb|CDY41452.1|  BnaA08g20540D                                          228   4e-69   Brassica napus [oilseed rape]
ref|XP_006840828.1|  hypothetical protein AMTR_s00083p00031040          228   5e-69   Amborella trichopoda
ref|XP_009103182.1|  PREDICTED: glutamate--glyoxylate aminotransf...    228   5e-69   Brassica rapa
ref|XP_009359228.1|  PREDICTED: glutamate--glyoxylate aminotransf...    228   5e-69   Pyrus x bretschneideri [bai li]
ref|XP_008340115.1|  PREDICTED: glutamate--glyoxylate aminotransf...    228   5e-69   Malus domestica [apple tree]
ref|XP_002315675.1|  hypothetical protein POPTR_0010s05530g             228   5e-69   Populus trichocarpa [western balsam poplar]
ref|XP_007222799.1|  hypothetical protein PRUPE_ppa005017mg             228   6e-69   Prunus persica
ref|XP_007044762.1|  Alanine-2-oxoglutarate aminotransferase 2 is...    228   7e-69   
gb|KJB31170.1|  hypothetical protein B456_005G179600                    227   8e-69   Gossypium raimondii
ref|XP_010928898.1|  PREDICTED: glutamate--glyoxylate aminotransf...    227   1e-68   Elaeis guineensis
ref|XP_009406515.1|  PREDICTED: glutamate--glyoxylate aminotransf...    227   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011014669.1|  PREDICTED: glutamate--glyoxylate aminotransf...    226   2e-68   Populus euphratica
gb|AET06145.1|  PLP-dependent aminotransferase                          226   3e-68   Papaver somniferum
ref|NP_001237581.1|  alanine aminotransferase 3                         226   4e-68   Glycine max [soybeans]
ref|NP_001237567.1|  alanine aminotransferase 2                         226   4e-68   
ref|XP_003519649.1|  PREDICTED: glutamate--glyoxylate aminotransf...    226   4e-68   Glycine max [soybeans]
gb|KHN14541.1|  Glutamate--glyoxylate aminotransferase 2                226   4e-68   Glycine soja [wild soybean]
ref|XP_008447004.1|  PREDICTED: glutamate--glyoxylate aminotransf...    221   4e-68   
ref|XP_004309987.1|  PREDICTED: glutamate--glyoxylate aminotransf...    225   5e-68   Fragaria vesca subsp. vesca
ref|XP_008389735.1|  PREDICTED: glutamate--glyoxylate aminotransf...    225   5e-68   
ref|XP_007158412.1|  hypothetical protein PHAVU_002G150800g             225   6e-68   Phaseolus vulgaris [French bean]
ref|NP_001151209.1|  alanine aminotransferase 2                         225   8e-68   
ref|XP_004135487.1|  PREDICTED: glutamate--glyoxylate aminotransf...    224   1e-67   
gb|EMT29455.1|  Alanine aminotransferase 2                              224   3e-67   
ref|XP_004155366.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    223   3e-67   
gb|KGN51765.1|  hypothetical protein Csa_5G598730                       223   3e-67   Cucumis sativus [cucumbers]
ref|XP_002312679.2|  alanine-2-oxoglutarate aminotransferase 1 fa...    223   4e-67   Populus trichocarpa [western balsam poplar]
gb|KGN51767.1|  hypothetical protein Csa_5G598750                       223   4e-67   Cucumis sativus [cucumbers]
ref|XP_002968244.1|  hypothetical protein SELMODRAFT_145611             221   2e-66   Selaginella moellendorffii
ref|NP_001183048.1|  uncharacterized protein LOC100501386               219   1e-65   Zea mays [maize]
ref|XP_008444367.1|  PREDICTED: glutamate--glyoxylate aminotransf...    218   2e-65   Cucumis melo [Oriental melon]
tpg|DAA42656.1|  TPA: hypothetical protein ZEAMMB73_648980              218   3e-65   
tpg|DAA42658.1|  TPA: LOW QUALITY PROTEIN: alanine aminotransfera...    218   3e-65   
gb|KJB31175.1|  hypothetical protein B456_005G179600                    218   4e-65   Gossypium raimondii
ref|XP_001782822.1|  predicted protein                                  217   8e-65   
gb|EMS58349.1|  Alanine aminotransferase 2                              217   9e-65   Triticum urartu
ref|XP_011086618.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    215   5e-64   
ref|XP_009105726.1|  PREDICTED: glutamate--glyoxylate aminotransf...    215   7e-64   Brassica rapa
ref|XP_001777071.1|  predicted protein                                  214   8e-64   
gb|ABK25444.1|  unknown                                                 214   9e-64   Picea sitchensis
ref|XP_004142968.1|  PREDICTED: glutamate--glyoxylate aminotransf...    213   3e-63   Cucumis sativus [cucumbers]
ref|XP_001763950.1|  predicted protein                                  212   7e-63   
emb|CDY12474.1|  BnaC07g13140D                                          190   3e-54   Brassica napus [oilseed rape]
ref|XP_002947519.1|  alanine aminotransferase                           180   1e-50   Volvox carteri f. nagariensis
gb|AAB01685.1|  alanine aminotransferase                                175   1e-48   Chlamydomonas reinhardtii
ref|XP_001698518.1|  alanine aminotransferase                           175   1e-48   Chlamydomonas reinhardtii
ref|XP_005651940.1|  alanine aminotransferase                           166   2e-45   Coccomyxa subellipsoidea C-169
gb|KIZ04988.1|  alanine transaminase                                    159   4e-45   Monoraphidium neglectum
emb|CBJ25743.1|  nicotinanamine aminotransferase A                      164   6e-45   Ectocarpus siliculosus
gb|KIY95165.1|  alanine transaminase                                    154   3e-43   Monoraphidium neglectum
gb|EWM24220.1|  alanine-2-oxoglutarate aminotransferase 2               157   7e-42   Nannochloropsis gaditana
ref|XP_001745052.1|  hypothetical protein                               143   6e-37   Monosiga brevicollis MX1
ref|XP_005847240.1|  hypothetical protein CHLNCDRAFT_57929              141   3e-36   Chlorella variabilis
gb|KIZ07569.1|  alanine transaminase                                    141   3e-36   Monoraphidium neglectum
ref|XP_004992298.1|  alanine aminotransferase                           139   1e-35   Salpingoeca rosetta
gb|KDD76740.1|  aminotransferase                                        130   1e-32   Helicosporidium sp. ATCC 50920
gb|AFK37995.1|  unknown                                                 122   2e-32   Lotus japonicus
ref|XP_011398130.1|  putative alanine aminotransferase, mitochond...    127   3e-31   Auxenochlorella protothecoides
ref|XP_007510961.1|  predicted protein                                  126   6e-31   Bathycoccus prasinos
ref|XP_002175263.1|  alanine aminotransferase                           125   7e-31   Schizosaccharomyces japonicus yFS275
ref|XP_002176328.1|  predicted protein                                  123   7e-30   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005648726.1|  alanine aminotransferase 2                         122   2e-29   Coccomyxa subellipsoidea C-169
gb|EJK48082.1|  hypothetical protein THAOC_33157                        120   2e-28   Thalassiosira oceanica
ref|XP_003291733.1|  alanine transaminase                               119   2e-28   Dictyostelium purpureum
ref|XP_005833147.1|  hypothetical protein GUITHDRAFT_157749             118   4e-28   Guillardia theta CCMP2712
emb|CDY25781.1|  BnaA07g10010D                                          110   4e-28   Brassica napus [oilseed rape]
ref|XP_005825112.1|  hypothetical protein GUITHDRAFT_77426              117   7e-28   Guillardia theta CCMP2712
gb|EJK50290.1|  hypothetical protein THAOC_30762                        118   1e-27   Thalassiosira oceanica
ref|XP_637993.1|  alanine transaminase                                  117   2e-27   Dictyostelium discoideum AX4
gb|AIT69925.1|  alanine transaminase                                    116   2e-27   Saccharina sculpera
gb|AIT69927.1|  alanine transaminase                                    116   3e-27   Saccharina japonica
gb|KIZ01751.1|  alanine transaminase                                    115   3e-27   Monoraphidium neglectum
sp|P52894.1|ALA2_HORVU  RecName: Full=Alanine aminotransferase 2;...    115   3e-27   Hordeum vulgare [barley]
ref|WP_026853156.1|  aminotransferase class I/II                        115   3e-27   Geothrix fermentans
ref|XP_001622550.1|  hypothetical protein NEMVEDRAFT_v1g236165          115   3e-27   Nematostella vectensis
ref|XP_010939848.1|  PREDICTED: alanine aminotransferase 2 isofor...    116   3e-27   Elaeis guineensis
gb|KFH67262.1|  alanine transaminase                                    116   3e-27   Mortierella verticillata NRRL 6337
pdb|3TCM|A  Chain A, Crystal Structure Of Alanine Aminotransferas...    115   3e-27   Hordeum vulgare [barley]
gb|KDR12685.1|  Alanine aminotransferase 2                              115   5e-27   Zootermopsis nevadensis
ref|XP_009380146.1|  PREDICTED: alanine aminotransferase 2-like         115   6e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIT69928.1|  alanine transaminase                                    114   8e-27   Scytosiphon dotyi
gb|EFA80185.1|  alanine transaminase                                    115   9e-27   Heterostelium album PN500
gb|AIT69918.1|  alanine transaminase                                    114   9e-27   Desmarestia viridis
ref|XP_008800517.1|  PREDICTED: alanine aminotransferase 2-like         114   1e-26   
ref|XP_011048627.1|  PREDICTED: alanine aminotransferase 2, mitoc...    114   1e-26   Populus euphratica
gb|KFV83100.1|  Alanine aminotransferase 2                              114   2e-26   Struthio camelus australis
gb|AIT69920.1|  alanine transaminase                                    113   2e-26   Scytosiphon lomentaria
emb|CCW65758.1|  unnamed protein product                                113   2e-26   Phytomonas sp. isolate EM1
ref|XP_008783332.1|  PREDICTED: alanine aminotransferase 2              114   2e-26   Phoenix dactylifera
gb|EMS19811.1|  1-aminocyclopropane-1-carboxylate synthase              113   3e-26   Rhodotorula toruloides NP11
ref|NP_001132269.1|  uncharacterized protein LOC100193705               108   3e-26   
ref|XP_008797360.1|  PREDICTED: alanine aminotransferase 2-like         113   3e-26   Phoenix dactylifera
ref|XP_010917381.1|  PREDICTED: alanine aminotransferase 2-like i...    112   3e-26   Elaeis guineensis
gb|EPX73451.1|  alanine aminotransferase                                113   3e-26   Schizosaccharomyces octosporus yFS286
ref|XP_010917380.1|  PREDICTED: alanine aminotransferase 2-like i...    112   4e-26   Elaeis guineensis
gb|AGE89226.1|  cytosolic alanine aminotransferase                      108   4e-26   Dicentrarchus labrax [European sea bass]
ref|XP_002946490.1|  hypothetical protein VOLCADRAFT_120326             114   4e-26   Volvox carteri f. nagariensis
ref|XP_010917379.1|  PREDICTED: alanine aminotransferase 2-like i...    112   5e-26   Elaeis guineensis
ref|XP_003724792.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    113   5e-26   
ref|XP_010917378.1|  PREDICTED: alanine aminotransferase 2-like i...    112   5e-26   Elaeis guineensis
ref|WP_005033524.1|  aminotransferase class I/II                        112   6e-26   Holophaga foetida
ref|XP_006657960.1|  PREDICTED: alanine aminotransferase 2-like i...    112   6e-26   Oryza brachyantha
gb|AIT69929.1|  alanine transaminase                                    112   7e-26   Petalonia fascia
ref|XP_010261672.1|  PREDICTED: alanine aminotransferase 2-like         112   7e-26   Nelumbo nucifera [Indian lotus]
ref|XP_002430266.1|  Alanine aminotransferase, putative                 111   8e-26   Pediculus humanus corporis [human body lice]
emb|CDS30789.1|  gag pol polyprotein                                    111   8e-26   Hymenolepis microstoma
dbj|GAA97564.1|  hypothetical protein E5Q_04242                         112   9e-26   Mixia osmundae IAM 14324
ref|XP_007409910.1|  hypothetical protein MELLADRAFT_43385              111   9e-26   Melampsora larici-populina 98AG31
gb|EGU11111.1|  putative Alanine aminotransferase                       112   9e-26   Rhodotorula toruloides ATCC 204091
gb|ADB91976.1|  alanine aminotransferase                                111   1e-25   Branchiostoma belcheri
gb|AIT69923.1|  alanine transaminase                                    111   1e-25   Dictyopteris undulata
ref|XP_455940.1|  hypothetical protein                                  112   1e-25   Kluyveromyces lactis
ref|XP_010937250.1|  PREDICTED: alanine aminotransferase 2              111   1e-25   Elaeis guineensis
ref|XP_002430215.1|  Alanine aminotransferase, putative                 110   2e-25   Pediculus humanus corporis [human body lice]
gb|EEE67593.1|  hypothetical protein OsJ_25140                          111   2e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82447.1|  hypothetical protein OsI_26881                          111   2e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_002492709.1|  Putative alanine transaminase (glutamic pyru...    111   2e-25   Komagataella phaffii GS115
ref|XP_008460349.1|  PREDICTED: alanine aminotransferase 1, mitoc...    110   2e-25   Cucumis melo [Oriental melon]
gb|AGE89227.1|  mitochondrial alanine aminotransferase                  106   2e-25   Dicentrarchus labrax [European sea bass]
ref|XP_006649511.1|  PREDICTED: alanine aminotransferase 2-like         110   2e-25   
ref|XP_003646187.1|  hypothetical protein Ecym_4307                     111   2e-25   Eremothecium cymbalariae DBVPG#7215
gb|AGT60040.1|  aminotransferase                                        110   2e-25   uncultured bacterium
ref|XP_006775215.1|  PREDICTED: alanine aminotransferase 1              108   3e-25   Myotis davidii
ref|XP_005838227.1|  hypothetical protein GUITHDRAFT_103164             110   3e-25   Guillardia theta CCMP2712
gb|AIT69919.1|  alanine transaminase                                    110   3e-25   Sargassum vachellianum
ref|XP_002304255.2|  hypothetical protein POPTR_0003s07020g             110   3e-25   
gb|AIT69916.1|  alanine transaminase                                    110   3e-25   Sargassum henslowianum
ref|XP_008869166.1|  hypothetical protein H310_06043                    110   3e-25   Aphanomyces invadans
ref|XP_005865158.1|  PREDICTED: alanine aminotransferase 1              107   4e-25   Myotis brandtii
gb|KFO69634.1|  Alanine aminotransferase 2                              110   4e-25   Cuculus canorus
ref|XP_009382959.1|  PREDICTED: alanine aminotransferase 2              110   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBN81871.1|  Alanine aminotransferase 2-like                        110   4e-25   Dicentrarchus labrax [European sea bass]
gb|ACJ85860.1|  unknown                                                 110   4e-25   Medicago truncatula
gb|EPB88721.1|  alanine transaminase                                    110   4e-25   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN09782.1|  alanine transaminase                                   110   5e-25   Mucor ambiguus
ref|XP_008460347.1|  PREDICTED: alanine aminotransferase 2-like i...    110   5e-25   Cucumis melo [Oriental melon]
ref|XP_004510570.1|  PREDICTED: alanine aminotransferase 2, mitoc...    110   5e-25   Cicer arietinum [garbanzo]
ref|XP_009041360.1|  hypothetical protein AURANDRAFT_67623              112   5e-25   Aureococcus anophagefferens
ref|XP_003573850.1|  PREDICTED: alanine aminotransferase 2              109   5e-25   Brachypodium distachyon [annual false brome]
gb|KFW64540.1|  Alanine aminotransferase 2                              110   5e-25   Pygoscelis adeliae
gb|AFK39904.1|  unknown                                                 110   5e-25   Medicago truncatula
ref|XP_003627448.1|  Alanine aminotransferase                           110   5e-25   Medicago truncatula
emb|CDO96247.1|  unnamed protein product                                110   5e-25   Kluyveromyces dobzhanskii CBS 2104
sp|P34106.1|ALA2_PANMI  RecName: Full=Alanine aminotransferase 2;...    109   5e-25   Panicum miliaceum [broom millet]
gb|KFQ95766.1|  Alanine aminotransferase 2                              110   5e-25   Nipponia nippon
gb|KFM05788.1|  Alanine aminotransferase 2                              110   6e-25   Aptenodytes forsteri
dbj|BAF93199.1|  putative alanine aminotransferase                      102   6e-25   Hordeum vulgare [barley]
ref|XP_004144444.1|  PREDICTED: alanine aminotransferase 2, mitoc...    110   6e-25   
ref|XP_004212634.1|  PREDICTED: uncharacterized protein LOC101238311    108   6e-25   Hydra vulgaris
gb|KGN58474.1|  hypothetical protein Csa_3G646610                       110   6e-25   Cucumis sativus [cucumbers]
ref|XP_004983099.1|  PREDICTED: alanine aminotransferase 2-like         109   7e-25   Setaria italica
ref|XP_002295840.1|  alanine aminotransferase, aminotransferase c...    109   7e-25   Thalassiosira pseudonana CCMP1335
ref|XP_008653343.1|  PREDICTED: alanine aminotransferase 2              109   8e-25   Zea mays [maize]
gb|ETK83887.1|  hypothetical protein L915_11052                         105   8e-25   Phytophthora parasitica
ref|XP_008499534.1|  PREDICTED: alanine aminotransferase 2              108   8e-25   Calypte anna
ref|XP_008654837.1|  PREDICTED: uncharacterized protein LOC100193...    108   9e-25   
ref|XP_009389580.1|  PREDICTED: alanine aminotransferase 2-like         108   9e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004664888.1|  PREDICTED: alanine aminotransferase 2              109   1e-24   Jaculus jaculus
gb|AIT69930.1|  alanine transaminase                                    108   1e-24   Sargassum hemiphyllum var. chinense
gb|AIT69931.1|  alanine transaminase                                    108   1e-24   Sargassum thunbergii
gb|AIT69922.1|  alanine transaminase                                    108   1e-24   Sargassum fusiforme
ref|XP_008436808.1|  PREDICTED: alanine aminotransferase 1              108   1e-24   Poecilia reticulata
ref|XP_005052721.1|  PREDICTED: alanine aminotransferase 2 isofor...    109   1e-24   Ficedula albicollis
ref|XP_002289904.1|  alanine aminotransferase                           108   1e-24   Thalassiosira pseudonana CCMP1335
emb|CDO97792.1|  unnamed protein product                                108   1e-24   Coffea canephora [robusta coffee]
gb|AIT69921.1|  alanine transaminase                                    108   1e-24   Sargassum muticum
ref|XP_011485336.1|  PREDICTED: alanine aminotransferase 2-like i...    108   1e-24   Oryzias latipes [Japanese rice fish]
ref|XP_005526439.1|  PREDICTED: alanine aminotransferase 2 isofor...    109   1e-24   Pseudopodoces humilis [Tibetan ground-jay]
gb|KFP06658.1|  Alanine aminotransferase 2                              109   1e-24   Calypte anna
gb|KFH70378.1|  alanine transaminase                                    108   1e-24   Mortierella verticillata NRRL 6337
ref|WP_012096788.1|  aminotransferase class I/II                        108   1e-24   Anaeromyxobacter sp. Fw109-5
ref|XP_001919896.1|  PREDICTED: alanine aminotransferase 1              108   1e-24   Danio rerio [leopard danio]
gb|AIT69926.1|  alanine transaminase                                    108   1e-24   Sargassum horneri
ref|XP_008637027.1|  PREDICTED: alanine aminotransferase 2              109   1e-24   Corvus brachyrhynchos
gb|KFO63157.1|  Alanine aminotransferase 2                              108   1e-24   Corvus brachyrhynchos
dbj|BAP71656.1|  probable alanine aminotransferase                      109   1e-24   Kluyveromyces marxianus
dbj|BAO40163.1|  probable alanine aminotransferase                      109   1e-24   Kluyveromyces marxianus DMKU3-1042
ref|XP_002194653.1|  PREDICTED: alanine aminotransferase 2              109   1e-24   Taeniopygia guttata
emb|CDS05712.1|  hypothetical protein LRAMOSA08240                      108   1e-24   Lichtheimia ramosa
emb|CEG77871.1|  Putative Alanine transaminase                          105   1e-24   Rhizopus microsporus
gb|EPZ32571.1|  Aminotransferase, class I/classII domain-containi...    106   1e-24   Rozella allomycis CSF55
gb|ETL90462.1|  hypothetical protein L917_10858                         104   1e-24   Phytophthora parasitica
emb|CBJ31990.1|  Alanine transaminase                                   108   1e-24   Ectocarpus siliculosus
gb|EGA61365.1|  Alt1p                                                   109   1e-24   Saccharomyces cerevisiae FostersO
ref|XP_002463187.1|  hypothetical protein SORBIDRAFT_02g039340          108   1e-24   Sorghum bicolor [broomcorn]
ref|XP_005775483.1|  alanine aminotransferase                           108   1e-24   Emiliania huxleyi CCMP1516
emb|CAY81325.1|  Alt1p                                                  109   2e-24   Saccharomyces cerevisiae EC1118
gb|EIW08706.1|  Alt1p                                                   109   2e-24   Saccharomyces cerevisiae CEN.PK113-7D
ref|NP_013190.1|  alanine transaminase ALT1                             109   2e-24   Saccharomyces cerevisiae S288C
gb|AGT02519.1|  alanine transaminase                                    108   2e-24   Herpetomonas muscarum
gb|KDE04574.1|  hypothetical protein MVLG_05042                         109   2e-24   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_008380735.1|  PREDICTED: alanine aminotransferase 2              108   2e-24   Malus domestica [apple tree]
gb|EGA81832.1|  Alt1p                                                   108   2e-24   Saccharomyces cerevisiae Lalvin QA23
ref|XP_004079476.1|  PREDICTED: alanine aminotransferase 2-like i...    108   2e-24   Oryzias latipes [Japanese rice fish]
gb|EGA85809.1|  Alt1p                                                   108   2e-24   Saccharomyces cerevisiae VL3
gb|EGA77892.1|  Alt1p                                                   108   2e-24   Saccharomyces cerevisiae Vin13
ref|XP_009216889.1|  hypothetical protein GGTG_00873                    108   2e-24   Gaeumannomyces tritici R3-111a-1
ref|XP_011140986.1|  PREDICTED: alanine aminotransferase 1 isofor...    108   2e-24   Harpegnathos saltator
gb|AIT69924.1|  alanine transaminase                                    108   2e-24   Colpomenia sinuosa
ref|XP_002906656.1|  alanine aminotransferase 2                         108   2e-24   Phytophthora infestans T30-4
ref|NP_595176.1|  alanine aminotransferase (predicted)                  108   2e-24   Schizosaccharomyces pombe
gb|ETM43767.1|  hypothetical protein L914_10885                         105   2e-24   Phytophthora parasitica
gb|EIE85592.1|  hypothetical protein RO3G_10302                         107   2e-24   Rhizopus delemar RA 99-880
ref|XP_009826737.1|  hypothetical protein H257_04062                    107   2e-24   Aphanomyces astaci
ref|XP_006794722.1|  PREDICTED: alanine aminotransferase 2-like         107   2e-24   Neolamprologus brichardi [lyretail cichlid]
emb|CBI35796.3|  unnamed protein product                                107   2e-24   Vitis vinifera
ref|XP_008332649.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    108   2e-24   
ref|XP_011079322.1|  PREDICTED: alanine aminotransferase 2-like         108   2e-24   Sesamum indicum [beniseed]
ref|NP_986750.1|  AGR085Wp                                              108   2e-24   Eremothecium gossypii ATCC 10895
gb|AEY98906.1|  FAGR085Wp                                               108   2e-24   Eremothecium gossypii FDAG1
ref|XP_001769989.1|  predicted protein                                  107   3e-24   
ref|XP_009315638.1|  alanine aminotransferase                           107   3e-24   
ref|XP_004959833.1|  PREDICTED: alanine aminotransferase 2, mitoc...    108   3e-24   
ref|XP_002265294.2|  PREDICTED: alanine aminotransferase 2              108   3e-24   
ref|XP_011036545.1|  PREDICTED: alanine aminotransferase 2-like         108   3e-24   
ref|XP_004155894.1|  PREDICTED: alanine aminotransferase 2, mitoc...    107   3e-24   
ref|XP_003967921.1|  PREDICTED: alanine aminotransferase 2-like         107   3e-24   
ref|XP_010939849.1|  PREDICTED: alanine aminotransferase 2 isofor...    107   3e-24   
ref|XP_005289905.1|  PREDICTED: alanine aminotransferase 2              108   3e-24   
ref|XP_009904992.1|  PREDICTED: alanine aminotransferase 2              107   3e-24   
ref|XP_010029516.1|  PREDICTED: alanine aminotransferase 2-like         108   3e-24   
ref|XP_007217248.1|  hypothetical protein PRUPE_ppa003850mg             108   3e-24   
ref|XP_008157904.1|  PREDICTED: alanine aminotransferase 1              107   3e-24   
ref|XP_004141733.1|  PREDICTED: alanine aminotransferase 2, mitoc...    107   3e-24   
ref|XP_007059708.1|  PREDICTED: alanine aminotransferase 2              108   3e-24   
ref|XP_003682412.1|  hypothetical protein TDEL_0F03900                  108   3e-24   
ref|XP_010733467.1|  PREDICTED: alanine aminotransferase 1              107   3e-24   
gb|AIT69914.1|  alanine transaminase                                    107   3e-24   
ref|NP_001136246.1|  alanine aminotransferase 2-like                    107   3e-24   
emb|CEG68596.1|  Putative Alanine transaminase                          107   3e-24   
emb|CEI95237.1|  Putative Alanine transaminase                          107   4e-24   
gb|AFW68850.1|  alanine aminotransferase                                107   4e-24   
emb|CEG81302.1|  Putative Alanine transaminase                          104   4e-24   
gb|ENN78579.1|  hypothetical protein YQE_04947                          107   4e-24   
ref|XP_002906651.1|  alanine aminotransferase 2                         107   4e-24   
emb|CDQ82436.1|  unnamed protein product                                107   4e-24   
ref|XP_003055208.1|  predicted protein                                  107   4e-24   
gb|AAC62456.1|  alanine aminotransferase                                107   4e-24   
ref|NP_001149227.1|  LOC100282849                                       107   4e-24   
gb|AAH61955.1|  Gpt2l protein                                           107   4e-24   
ref|XP_011104474.1|  alt1p                                              108   4e-24   
ref|XP_011072689.1|  PREDICTED: alanine aminotransferase 2              107   4e-24   
gb|KFV72169.1|  Alanine aminotransferase 2                              107   5e-24   
ref|XP_006872626.1|  PREDICTED: alanine aminotransferase 2              107   5e-24   
ref|XP_003443544.1|  PREDICTED: alanine aminotransferase 2-like i...    107   5e-24   
ref|XP_009555221.1|  PREDICTED: alanine aminotransferase 2              106   5e-24   
ref|XP_005471814.1|  PREDICTED: alanine aminotransferase 2-like i...    107   5e-24   
gb|EMT23015.1|  Alanine aminotransferase 2                              107   5e-24   
ref|XP_009461778.1|  PREDICTED: alanine aminotransferase 2 isofor...    106   5e-24   
ref|XP_005912151.1|  PREDICTED: alanine aminotransferase 2-like i...    107   5e-24   
ref|XP_010273809.1|  PREDICTED: alanine aminotransferase 2-like         107   5e-24   
ref|XP_006342898.1|  PREDICTED: alanine aminotransferase 2, mitoc...    107   5e-24   
ref|XP_005912152.1|  PREDICTED: alanine aminotransferase 2-like i...    107   6e-24   
ref|XP_006634237.1|  PREDICTED: alanine aminotransferase 2-like         106   6e-24   
ref|XP_004618719.1|  PREDICTED: alanine aminotransferase 1              106   6e-24   
ref|XP_006110043.1|  PREDICTED: LOW QUALITY PROTEIN: glutamic-pyr...    107   6e-24   
ref|XP_004690373.1|  PREDICTED: alanine aminotransferase 2              107   6e-24   
sp|Q6NYL5.2|ALAT2_DANRE  RecName: Full=Alanine aminotransferase 2...    107   6e-24   
ref|XP_004704756.1|  PREDICTED: alanine aminotransferase 2              107   6e-24   
ref|XP_004546617.1|  PREDICTED: alanine aminotransferase 2-like i...    107   6e-24   
ref|XP_009051124.1|  hypothetical protein LOTGIDRAFT_114341             106   6e-24   
ref|XP_003760591.1|  PREDICTED: alanine aminotransferase 1              107   7e-24   
ref|XP_004546618.1|  PREDICTED: alanine aminotransferase 2-like i...    106   7e-24   
gb|EIE79350.1|  hypothetical protein RO3G_04055                         106   7e-24   
ref|XP_008305774.1|  PREDICTED: alanine aminotransferase 1              106   7e-24   
ref|XP_004600748.1|  PREDICTED: alanine aminotransferase 2              107   7e-24   
ref|XP_010884157.1|  PREDICTED: alanine aminotransferase 1 isofor...    106   7e-24   
emb|CCC89394.1|  putative alanine aminotransferase                      106   7e-24   
ref|XP_005722569.1|  PREDICTED: alanine aminotransferase 2-like         106   8e-24   
ref|XP_008228107.1|  PREDICTED: alanine aminotransferase 2, mitoc...    107   8e-24   
ref|XP_007537771.1|  PREDICTED: alanine aminotransferase 2 isofor...    107   8e-24   
ref|XP_008302267.1|  PREDICTED: alanine aminotransferase 1              106   8e-24   
gb|KDP40629.1|  hypothetical protein JCGZ_24628                         107   8e-24   
ref|XP_007548658.1|  PREDICTED: alanine aminotransferase 2-like i...    106   8e-24   
gb|EWG97184.1|  Alt2p                                                   106   8e-24   
ref|XP_010318453.1|  PREDICTED: alanine aminotransferase 2, mitoc...    106   8e-24   
ref|NP_001237553.1|  alanine aminotransferase 1                         106   9e-24   
gb|EGA57796.1|  Alt1p                                                   107   9e-24   
ref|XP_010537653.1|  PREDICTED: alanine aminotransferase 2, mitoc...    106   9e-24   
ref|XP_003975367.1|  PREDICTED: alanine aminotransferase 2-like         107   9e-24   
gb|AIT69917.1|  alanine transaminase                                    106   1e-23   
ref|XP_006830849.1|  PREDICTED: alanine aminotransferase 1              106   1e-23   
gb|AGG11473.1|  hypothetical protein                                    106   1e-23   
emb|CEI89079.1|  Putative Alanine transaminase                          106   1e-23   
emb|CEI89078.1|  Putative Alanine transaminase                          106   1e-23   
ref|XP_005526440.1|  PREDICTED: alanine aminotransferase 2 isofor...    105   1e-23   
emb|CEG76882.1|  Putative Alanine transaminase                          106   1e-23   
emb|CEG73119.1|  Putative Alanine transaminase                          106   1e-23   
gb|ETK83879.1|  hypothetical protein L915_11047                         101   1e-23   
ref|XP_010727540.1|  PREDICTED: alanine aminotransferase 2-like i...    105   1e-23   
gb|KIH88204.1|  alanine transaminase                                    105   1e-23   
gb|ERT01918.1|  hypothetical protein HMPREF1624_00213                   105   1e-23   
gb|AAU09694.1|  YDR111C                                                 106   1e-23   
ref|XP_006680648.1|  hypothetical protein BATDEDRAFT_20287              105   1e-23   
ref|XP_007548657.1|  PREDICTED: alanine aminotransferase 2-like i...    106   1e-23   
ref|XP_002499950.1|  alanine aminotransferase                           105   1e-23   
ref|XP_003230304.2|  PREDICTED: alanine aminotransferase 2-like         105   1e-23   
ref|XP_004235528.1|  PREDICTED: alanine aminotransferase 2, mitoc...    105   1e-23   
ref|XP_010318452.1|  PREDICTED: alanine aminotransferase 2, mitoc...    105   1e-23   
ref|XP_006369083.1|  alanine aminotransferas family protein             105   1e-23   
gb|EGA83515.1|  Alt2p                                                   106   1e-23   
ref|XP_004362319.1|  alanine transaminase                               106   1e-23   
ref|NP_010396.1|  alanine transaminase ALT2                             106   1e-23   
ref|XP_008462239.1|  PREDICTED: alanine aminotransferase 1, mitoc...    105   1e-23   
gb|KHN39571.1|  Alanine aminotransferase 2, mitochondrial               106   1e-23   
gb|EDN60454.1|  alanine transaminase                                    105   1e-23   
gb|EMT05433.1|  Alanine aminotransferase 2                              105   1e-23   
gb|EDZ73134.1|  YDR111Cp-like protein                                   105   1e-23   
ref|XP_010727539.1|  PREDICTED: alanine aminotransferase 2-like i...    106   1e-23   
gb|EEU09336.1|  Alt2p                                                   105   1e-23   
emb|CEG73120.1|  Putative Alanine transaminase                          105   1e-23   
gb|AJP37834.1|  Alt2p                                                   105   1e-23   
ref|XP_003757274.1|  PREDICTED: alanine aminotransferase 2              105   1e-23   
ref|XP_003222977.1|  PREDICTED: alanine aminotransferase 2              106   1e-23   
gb|AIT69937.1|  alanine transaminase                                    105   1e-23   
ref|XP_011304772.1|  PREDICTED: alanine aminotransferase 1              106   1e-23   
ref|XP_008460348.1|  PREDICTED: alanine aminotransferase 2, mitoc...    105   1e-23   
ref|XP_005800011.1|  PREDICTED: alanine aminotransferase 2-like i...    105   1e-23   
ref|XP_005852218.1|  hypothetical protein CHLNCDRAFT_29318              105   2e-23   
ref|XP_004479736.1|  PREDICTED: alanine aminotransferase 2 isoform 2    105   2e-23   
ref|XP_003717056.1|  hypothetical protein MGG_06503                     105   2e-23   
gb|KDO53769.1|  hypothetical protein CISIN_1g009517mg                   104   2e-23   
ref|XP_003528736.1|  PREDICTED: alanine aminotransferase 2, mitoc...    106   2e-23   
emb|CBH09087.1|  alanine aminotransferase, putative                     105   2e-23   
ref|XP_004479735.1|  PREDICTED: alanine aminotransferase 2 isoform 1    106   2e-23   
ref|XP_004241856.1|  PREDICTED: alanine aminotransferase 2-like         106   2e-23   
ref|XP_003127043.1|  PREDICTED: alanine aminotransferase 2 isofor...    105   2e-23   
ref|XP_005664519.1|  PREDICTED: alanine aminotransferase 2 isofor...    105   2e-23   
gb|AHW58022.1|  alanine aminotransferase 1                              105   2e-23   
emb|CCK71261.1|  hypothetical protein KNAG_0G02040                      106   2e-23   
ref|XP_006342897.1|  PREDICTED: alanine aminotransferase 2, mitoc...    105   2e-23   
ref|XP_011260421.1|  PREDICTED: alanine aminotransferase 1              105   2e-23   
ref|NP_001012057.1|  alanine aminotransferase 2                         105   2e-23   
gb|EFN75006.1|  Alanine aminotransferase 2                              105   2e-23   
dbj|BAC36035.1|  unnamed protein product                                105   2e-23   
ref|NP_776291.1|  alanine aminotransferase 2                            105   2e-23   
gb|KDO53768.1|  hypothetical protein CISIN_1g009517mg                   104   2e-23   
ref|XP_010727537.1|  PREDICTED: alanine aminotransferase 2-like i...    105   2e-23   
gb|KEQ94204.1|  hypothetical protein AUEXF2481DRAFT_41383               105   2e-23   
gb|AAH34219.1|  Glutamic pyruvate transaminase (alanine aminotran...    105   2e-23   
gb|KJB57088.1|  hypothetical protein B456_009G147700                    105   2e-23   
ref|XP_005800010.1|  PREDICTED: alanine aminotransferase 2-like i...    105   2e-23   
gb|AAV64199.1|  putative alanine aminotransferase                       105   2e-23   
ref|XP_006121251.1|  PREDICTED: alanine aminotransferase 2              105   2e-23   
gb|ETI43749.1|  hypothetical protein F443_11362                         105   2e-23   
gb|AAV64237.1|  putative alanine aminotransferase                       105   2e-23   
ref|XP_008068165.1|  PREDICTED: alanine aminotransferase 1              105   2e-23   
ref|XP_003228933.1|  PREDICTED: alanine aminotransferase 1-like         105   2e-23   
ref|XP_001219089.1|  alanine aminotransferase                           105   3e-23   
ref|XP_009627254.1|  PREDICTED: alanine aminotransferase 2-like         105   3e-23   
ref|XP_003438124.1|  PREDICTED: alanine aminotransferase 2-like i...    105   3e-23   
ref|XP_010685211.1|  PREDICTED: alanine aminotransferase 2              105   3e-23   
ref|XP_010980943.1|  PREDICTED: alanine aminotransferase 2              105   3e-23   
gb|ETM43759.1|  hypothetical protein L914_10880                         102   3e-23   
ref|XP_005476523.1|  PREDICTED: alanine aminotransferase 2-like i...    105   3e-23   
emb|CDQ88279.1|  unnamed protein product                                105   3e-23   
ref|XP_009783410.1|  PREDICTED: alanine aminotransferase 2, mitoc...    105   3e-23   
emb|CEG68597.1|  Putative Alanine transaminase                          104   3e-23   
dbj|BAK07780.1|  predicted protein                                      105   3e-23   
ref|XP_004235527.1|  PREDICTED: alanine aminotransferase 2-like         105   3e-23   
emb|CEI94294.1|  Putative Alanine transaminase                          105   3e-23   
ref|XP_010948490.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    105   3e-23   
gb|EDL11016.1|  glutamic pyruvate transaminase (alanine aminotran...    105   3e-23   
ref|XP_005476522.1|  PREDICTED: alanine aminotransferase 2-like i...    105   3e-23   
ref|XP_002931716.1|  PREDICTED: alanine aminotransferase 2-like         105   3e-23   
emb|CEI95238.1|  Putative Alanine transaminase                          104   3e-23   
ref|XP_005367071.1|  PREDICTED: alanine aminotransferase 2              105   3e-23   
ref|XP_007091606.1|  PREDICTED: alanine aminotransferase 1              103   3e-23   
ref|XP_008827852.1|  PREDICTED: alanine aminotransferase 2 isofor...    105   3e-23   
emb|CEI86172.1|  Putative Alanine transaminase                          104   3e-23   
gb|KJB57090.1|  hypothetical protein B456_009G147700                    105   3e-23   
ref|XP_004303756.1|  PREDICTED: alanine aminotransferase 2              105   3e-23   
ref|XP_009798100.1|  PREDICTED: alanine aminotransferase 2-like         105   3e-23   
ref|XP_006559494.1|  PREDICTED: alanine aminotransferase 2-like         105   3e-23   
ref|XP_010096539.1|  Alanine aminotransferase 2                         105   3e-23   
ref|XP_011127540.1|  hypothetical protein AOL_s00215g36                 104   3e-23   
gb|ETP13560.1|  hypothetical protein F441_11279                         104   3e-23   
ref|XP_006971817.1|  PREDICTED: alanine aminotransferase 2 isofor...    105   3e-23   
gb|ERE78378.1|  alanine aminotransferase 2-like protein                 105   3e-23   
ref|XP_007629626.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    105   3e-23   
ref|XP_006971818.1|  PREDICTED: alanine aminotransferase 2 isofor...    105   3e-23   
gb|ETP41623.1|  hypothetical protein F442_11247                         104   3e-23   
emb|CDY26256.1|  BnaA06g11610D                                          105   3e-23   
ref|XP_009149177.1|  PREDICTED: alanine aminotransferase 1, mitoc...    105   4e-23   
gb|KJB57091.1|  hypothetical protein B456_009G147700                    105   4e-23   
ref|XP_008180133.1|  PREDICTED: alanine aminotransferase 2 isofor...    104   4e-23   
emb|CDY48485.1|  BnaC05g13450D                                          105   4e-23   
gb|EIE90509.1|  hypothetical protein RO3G_15220                         104   4e-23   
ref|XP_008907369.1|  hypothetical protein PPTG_13440                    104   4e-23   
emb|CAG07105.1|  unnamed protein product                                104   4e-23   
ref|XP_005079251.1|  PREDICTED: alanine aminotransferase 2              104   4e-23   
ref|XP_008120969.1|  PREDICTED: alanine aminotransferase 1-like         104   4e-23   
ref|XP_003429759.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    104   4e-23   
ref|XP_006426797.1|  hypothetical protein CICLE_v10025334mg             105   4e-23   
ref|XP_008718353.1|  hypothetical protein HMPREF1541_05794              104   4e-23   
ref|XP_011109633.1|  hypothetical protein H072_3664                     104   4e-23   
ref|XP_008283496.1|  PREDICTED: alanine aminotransferase 2-like i...    104   4e-23   
emb|CEI91975.1|  Putative Alanine transaminase                          104   5e-23   
ref|XP_006357426.1|  PREDICTED: alanine aminotransferase 2, mitoc...    104   5e-23   
ref|XP_004583879.1|  PREDICTED: alanine aminotransferase 2 isofor...    104   5e-23   
ref|XP_003438123.1|  PREDICTED: alanine aminotransferase 2-like i...    105   5e-23   
gb|AAP42512.1|  mitochondrial alanine aminotransferase                  105   5e-23   
ref|XP_008283495.1|  PREDICTED: alanine aminotransferase 2-like i...    104   5e-23   
gb|ETO72417.1|  hypothetical protein F444_11427                         102   5e-23   
ref|XP_001363190.1|  PREDICTED: alanine aminotransferase 2 isofor...    104   5e-23   
ref|XP_007547926.1|  PREDICTED: alanine aminotransferase 1              104   5e-23   
emb|CEG73189.1|  Putative Alanine transaminase                          104   5e-23   
ref|XP_005809903.1|  PREDICTED: alanine aminotransferase 2-like         104   6e-23   
ref|XP_001948711.2|  PREDICTED: alanine aminotransferase 1 isofor...    104   6e-23   
gb|KEQ61418.1|  PLP-dependent transferase                               104   6e-23   
ref|XP_005912582.1|  PREDICTED: alanine aminotransferase 2-like i...    103   6e-23   
ref|XP_011373236.1|  PREDICTED: alanine aminotransferase 1              103   6e-23   
ref|XP_011337890.1|  PREDICTED: alanine aminotransferase 1 isofor...    104   6e-23   
gb|EGA59376.1|  Alt2p                                                   104   6e-23   
ref|XP_006607395.1|  PREDICTED: alanine aminotransferase 2-like i...    104   6e-23   
gb|AAP42511.1|  cytosolic alanine aminotransferase                      103   6e-23   
ref|XP_006661735.1|  PREDICTED: alanine aminotransferase 2-like         103   6e-23   
ref|XP_006416720.1|  hypothetical protein EUTSA_v10007290mg             104   6e-23   
gb|ABC59812.1|  cytosolic alanine aminotransferase 2                    104   6e-23   
dbj|BAC79866.1|  putative alanine aminotransferase                      103   6e-23   
ref|XP_008620886.1|  alanine transaminase                               103   6e-23   
ref|XP_003802370.1|  PREDICTED: alanine aminotransferase 1              103   6e-23   
gb|ESL10912.1|  alanine aminotransferase                                103   6e-23   
ref|XP_003692587.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    104   7e-23   
emb|CDQ76371.1|  unnamed protein product                                103   7e-23   
ref|XP_005912581.1|  PREDICTED: alanine aminotransferase 2-like i...    103   7e-23   
ref|XP_004542942.1|  PREDICTED: alanine aminotransferase 2-like i...    103   7e-23   
gb|ETN63742.1|  alanine aminotransferase                                103   7e-23   
ref|XP_004081051.1|  PREDICTED: alanine aminotransferase 2-like         103   7e-23   
ref|XP_008283494.1|  PREDICTED: alanine aminotransferase 2-like i...    104   7e-23   
ref|XP_011289880.1|  PREDICTED: alanine aminotransferase 1              102   7e-23   



>ref|XP_006357614.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=481

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAIARAKQFL MTSGGLGAYSDSRGIPGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKQFLGMTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125



>ref|XP_004239121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Solanum 
lycopersicum]
Length=481

 Score =   240 bits (613),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAIARAKQFL MTSGGLGAYSDSRGIPGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKQFLGMTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125



>gb|EPS68501.1| hypothetical protein M569_06265, partial [Genlisea aurea]
Length=481

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  3    PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  62

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK ++S+TSGGLGAYSDSRGIPGVRKEVA FI RRD
Sbjct  63   LCQAPFLLDDPNVGLLFPADAIARAKHYISLTSGGLGAYSDSRGIPGVRKEVAEFIQRRD  122

Query  489  G  491
            G
Sbjct  123  G  123



>emb|CDP13207.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   238 bits (607),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYENLN+NVK+CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNKNVKECQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGLVFPADAIARAK  LSMTSGGLGAYSDSRGIPGVRKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLVFPADAIARAKHLLSMTSGGLGAYSDSRGIPGVRKEVAEFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_010682426.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682427.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYELLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGLVFPADAIARAK +L+MTSGGLGAYSDSRGIPGVRKE+A FIGRRDG
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLAMTSGGLGAYSDSRGIPGVRKEIAEFIGRRDG  125



>ref|XP_009759837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score =   235 bits (599),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+ SGGLGAYSDSRGIPGVRKE+A FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLNSGGLGAYSDSRGIPGVRKEIADFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_009624740.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625366.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+ SGGLGAYSDSRGIPGVRKE+A FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLNSGGLGAYSDSRGIPGVRKEIADFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_009765091.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
sylvestris]
Length=481

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDY+NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYDNLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVG +FPADAIARAK +L+MTSGGLGAYSDSRG PGVRKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGFLFPADAIARAKHYLAMTSGGLGAYSDSRGTPGVRKEVAEFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_006416098.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34451.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=357

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LDYDALNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVA FI RRDG
Sbjct  63   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  122



>ref|XP_009623844.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
tomentosiformis]
Length=481

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDY+NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYDNLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVG +FPADAIARAK +L+MTSGGLGAYSDSRG PGVRKEVA FI +RD
Sbjct  65   LCQAPFLLDDPNVGFLFPADAIARAKHYLAMTSGGLGAYSDSRGTPGVRKEVAEFIEKRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|NP_001268094.1| uncharacterized protein LOC100261274 [Vitis vinifera]
 gb|AAZ43369.1| AlaT1 [Vitis vinifera]
Length=484

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGLVFPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVA FIGRRDG
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIGRRDG  125



>emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera]
Length=481

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGLVFPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVA FIGRRDG
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIGRRDG  125



>emb|CBI23368.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGLVFPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVA FIGRRDG
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIGRRDG  125



>gb|EYU28421.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
 gb|EYU28422.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
Length=480

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            +DYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  5    MDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  64

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPF+LDDPNVGL+FPADAIA+AK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  65   CQAPFMLDDPNVGLLFPADAIAKAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  124



>ref|XP_004489786.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   234 bits (596),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAKQ+LS+TSGGLGAYSDSRG+PGVRKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLIFPADAIARAKQYLSLTSGGLGAYSDSRGVPGVRKEVAEFIQRRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_004489787.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Cicer arietinum]
Length=481

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAKQ+LS+TSGGLGAYSDSRG+PGVRKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLIFPADAIARAKQYLSLTSGGLGAYSDSRGVPGVRKEVAEFIQRRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_010552672.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Tarenaya 
hassleriana]
Length=481

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125



>gb|AAZ43368.1| AlaT1 [Vitis labrusca]
Length=477

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGLVFPADAIARAK +LS+T+GGLGAYSDSRG+PG+RKEVA FIGRRDG
Sbjct  66   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTTGGLGAYSDSRGLPGIRKEVAEFIGRRDG  125



>ref|XP_009115544.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
 emb|CDY44130.1| BnaA09g31220D [Brassica napus]
 emb|CDY04729.1| BnaC05g18600D [Brassica napus]
Length=478

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            L+YE+LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYESLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  63   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  122



>ref|NP_001031083.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19579.1| AT1G23310 [Arabidopsis thaliana]
 gb|AEE30371.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=441

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125



>ref|XP_006307377.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
 gb|EOA40275.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
Length=481

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125



>ref|XP_002887312.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63571.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=482

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPN+G++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNIGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125



>ref|XP_010100388.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
 gb|EXB82522.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
Length=481

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINENVKKTQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVA FIGRRDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGVPGIRKEVAEFIGRRDG  125



>ref|XP_010023477.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
 ref|XP_010023478.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
Length=481

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAIARAK +LS+T+GGLGAYSDSRG+PG+RKEVA FIGRRDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAIARAKHYLSLTTGGLGAYSDSRGLPGIRKEVAEFIGRRDG  125



>ref|XP_006416099.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416100.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416101.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34452.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34453.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34454.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=478

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LDYDALNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVA FI RRDG
Sbjct  63   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  122



>gb|AAK25905.1|AF360195_1 putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125



>ref|XP_006438273.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51513.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=398

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+AL
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG+VFPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGIVFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125



>gb|AAL24255.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAO11559.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
Length=481

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125



>ref|NP_564192.2| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q9LR30.1|GGT1_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 1; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT1; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT1; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis 
thaliana]
 gb|AAF87015.1|AC005292_24 F26F24.16 [Arabidopsis thaliana]
 gb|AAN62332.1|AF479639_1 glutamate:glyoxylate aminotransferase 1 [Arabidopsis thaliana]
 gb|AAL08235.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAN12918.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AEE30370.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125



>ref|XP_010477627.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Camelina 
sativa]
Length=481

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLL+DPNVG+VFPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLEDPNVGMVFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125



>ref|XP_004228555.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
lycopersicum]
Length=473

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVG +FPADAIA+AK +LS+ SGGLGAYSDSRGIPGVRKE+A FI RRD
Sbjct  65   LCQAPFLLDDPNVGQLFPADAIAKAKHYLSLNSGGLGAYSDSRGIPGVRKEIADFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_002893277.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69536.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=481

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125



>dbj|BAH20108.1| AT1G70580 [Arabidopsis thaliana]
Length=481

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV++L
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVSL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125



>ref|NP_177215.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_974122.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031262.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031263.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9S7E9.1|GGT2_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 2; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT2; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT2; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis 
thaliana]
 gb|AAG52344.1|AC011663_23 putative alanine aminotransferase; 91367-88744 [Arabidopsis thaliana]
 gb|AAG52480.1|AC010796_19 putative alanine aminotransferase; 63135-65758 [Arabidopsis thaliana]
 gb|AAN62333.1|AF479640_1 glutamate:glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AAK59635.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AAL34156.1| putative alanine aminotransferase [Arabidopsis thaliana]
 dbj|BAH19506.1| AT1G70580 [Arabidopsis thaliana]
 gb|AEE35082.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35083.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35084.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35085.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
Length=481

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV++L
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVSL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125



>ref|XP_006378236.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|ERP56033.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=335

 Score =   227 bits (578),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAIA+AK +L+MT+GGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAIAKAKHYLAMTTGGLGAYSDSRGMPGVRKEVADFIERRDG  125



>ref|XP_011071137.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Sesamum 
indicum]
Length=481

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFL+DDPNVG +F ADAIARAK +LSMTSGGLGAYSDSRG+PG+RKEVA FI RRDG
Sbjct  66   CQAPFLMDDPNVGTLFHADAIARAKHYLSMTSGGLGAYSDSRGLPGIRKEVAEFIERRDG  125



>ref|XP_010415743.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125



>gb|KHG15331.1| Glutamate--glyoxylate aminotransferase 2 -like protein [Gossypium 
arboreum]
Length=481

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125



>ref|XP_010427837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Camelina 
sativa]
Length=479

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125



>ref|XP_010471056.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAQFIQRRDG  125



>ref|XP_006300456.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
 gb|EOA33354.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
Length=481

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125



>ref|XP_010927963.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Elaeis guineensis]
Length=481

 Score =   230 bits (587),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +LSMTSGGLGAYSDSRG+PG+RKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSMTSGGLGAYSDSRGLPGIRKEVADFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_006390865.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390866.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390867.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390868.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28151.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28152.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28153.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28154.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
Length=481

 Score =   230 bits (587),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDNPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  125



>ref|XP_006348507.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=476

 Score =   230 bits (586),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPF LDDPNVG +FPADAIA+AK +LS+ SGGLGAYSDSRGIPGVRKE+A FI RRD
Sbjct  65   LCQAPFFLDDPNVGQLFPADAIAKAKHYLSLNSGGLGAYSDSRGIPGVRKEIADFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>emb|CDY61225.1| BnaC06g43710D [Brassica napus]
Length=481

 Score =   230 bits (586),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDNPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125



>gb|KDO82251.1| hypothetical protein CISIN_1g041151mg [Citrus sinensis]
Length=463

 Score =   229 bits (585),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+AL
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG+VFPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGIVFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125



>ref|XP_009105727.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Brassica rapa]
Length=481

 Score =   230 bits (586),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDNPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125



>ref|XP_010460118.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLL+DPNVG++FPADAIARA+ +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLEDPNVGMIFPADAIARARHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125



>ref|XP_006658210.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Oryza 
brachyantha]
Length=494

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  15   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  74

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +LSM  GGLGAYSDSRGIPGVRKEVA FI RRD
Sbjct  75   LCQAPFLLDDPNVGLIFPADAIARAKHYLSMAPGGLGAYSDSRGIPGVRKEVAEFIQRRD  134

Query  489  G  491
            G
Sbjct  135  G  135



>ref|XP_009413361.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413362.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAI RAK +LS+TSGGLGAYSDSRG+PG+RKE+A FIGRRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIDRAKHYLSLTSGGLGAYSDSRGLPGIRKEIAEFIGRRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_008446998.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
melo]
Length=234

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE++NE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINETVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGLGAYSDSRGIP +RKEVA FIGRRDG
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKSYLSLIPGGLGAYSDSRGIPAIRKEVADFIGRRDG  125



>ref|XP_006438274.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438275.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438276.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438277.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438278.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006483938.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483939.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483940.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X3 [Citrus sinensis]
 gb|ESR51514.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51515.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51516.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51517.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51518.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=481

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+AL
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG+VFPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGIVFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125



>ref|XP_010498838.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498839.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498840.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLL+DPNVG++FPADAIARA+ +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLEDPNVGMIFPADAIARARHYLSLTSGGLGAYSDSRGLPGVRKEVADFIQRRDG  125



>gb|KJB31174.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=395

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNP ALGQKPLTFPRQV+AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125



>gb|KDP26646.1| hypothetical protein JCGZ_17804 [Jatropha curcas]
Length=481

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE+LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLMFPADAIARAKYYLSLTSGGLGAYSDSRGMPGIRKEVAEFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_010251104.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251105.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251106.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
Length=481

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE++NENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_004955317.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X2 [Setaria italica]
Length=478

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+ +GGLGAYSDSRGIPG+RKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLMFPADAIARAKHYLSLATGGLGAYSDSRGIPGIRKEVADFIQRRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>emb|CDY66294.1| BnaAnng22050D [Brassica napus]
Length=481

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLD+PNVG++FPADAI+RAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDNPNVGMIFPADAISRAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  125



>ref|NP_001058716.1| Os07g0108300 [Oryza sativa Japonica Group]
 dbj|BAD30627.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF20630.1| Os07g0108300 [Oryza sativa Japonica Group]
 gb|EAZ02507.1| hypothetical protein OsI_24612 [Oryza sativa Indica Group]
 gb|EAZ38438.1| hypothetical protein OsJ_22816 [Oryza sativa Japonica Group]
 dbj|BAG90568.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  12   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  71

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +L+M  GGLGAYSDSRGIPG+RKEVA FI RRD
Sbjct  72   LCQAPFLLDDPNVGLIFPADAIARAKHYLAMAPGGLGAYSDSRGIPGIRKEVAEFIERRD  131

Query  489  G  491
            G
Sbjct  132  G  132



>ref|XP_002527918.1| alanine aminotransferase, putative [Ricinus communis]
 gb|EEF34475.1| alanine aminotransferase, putative [Ricinus communis]
Length=452

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIERRDG  125



>gb|AAO84040.1| alanine aminotransferase [Oryza sativa Indica Group]
Length=484

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  11   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  70

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +L+M  GGLGAYSDSRGIPG+RKEVA FI RRD
Sbjct  71   LCQAPFLLDDPNVGLIFPADAIARAKHYLAMAPGGLGAYSDSRGIPGIRKEVAEFIERRD  130

Query  489  G  491
            G
Sbjct  131  G  131



>ref|XP_004955316.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X1 [Setaria italica]
Length=539

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+ +GGLGAYSDSRGIPG+RKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLMFPADAIARAKHYLSLATGGLGAYSDSRGIPGIRKEVADFIQRRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_008789746.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
 ref|XP_008789747.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
Length=481

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE+LNENVKK  YAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRAAELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAI+RA+ +LSMTSGGLGAYSDSRG+PG+RKEVA FIG+RD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAISRARHYLSMTSGGLGAYSDSRGLPGIRKEVADFIGKRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_003613140.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96098.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=474

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAKQ+LS TSGGLGAYSDSRG P VRKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKQYLSFTSGGLGAYSDSRGTPAVRKEVAEFIQRRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_003613139.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96097.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=481

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAKQ+LS TSGGLGAYSDSRG P VRKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKQYLSFTSGGLGAYSDSRGTPAVRKEVAEFIQRRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>gb|AAM61453.1| putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVK CQYAVRGELYLRASELQKE KKIIFTNVGNPHALGQKPLTFPRQV++L
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKECKKIIFTNVGNPHALGQKPLTFPRQVVSL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVADFIERRDG  125



>ref|XP_003557680.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Brachypodium 
distachyon]
Length=479

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVAL  66

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAIARAK +LSM  GGLGAYSDSRGIPGVRKEVA FI RRDG
Sbjct  67   CQAPFLLDDPNVGLIFPADAIARAKHYLSMAPGGLGAYSDSRGIPGVRKEVAEFIQRRDG  126



>ref|XP_008221924.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221925.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221927.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
Length=481

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKK+IFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKVIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+T+GGLGAYSDSRGIPGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAISRAKHYLSITAGGLGAYSDSRGIPGVRKEVAEFIERRDG  125



>ref|XP_009110107.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Brassica 
rapa]
Length=478

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            L+Y+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYDLLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  63   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  122



>emb|CDY41452.1| BnaA08g20540D [Brassica napus]
Length=478

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            L+Y+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYDLLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  63   CQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDG  122



>ref|XP_006840828.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
 gb|ERN02503.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
Length=481

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKSVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARA  +L+MTSGGLGAYSDSRG+PG+RKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARATHYLAMTSGGLGAYSDSRGLPGIRKEVAEFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_009103182.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
Length=478

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  63   CQAPFLLDNPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDG  122



>ref|XP_009359228.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Pyrus x 
bretschneideri]
Length=481

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+TSGGLGAYSDSRGIPGVRKEVA FI +RDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAISRAKHYLSITSGGLGAYSDSRGIPGVRKEVAEFIEKRDG  125



>ref|XP_008340115.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
 ref|XP_008340116.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
Length=481

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+TSGGLGAYSDSRGIPGVRKEVA FI +RDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAISRAKHYLSITSGGLGAYSDSRGIPGVRKEVAEFIEKRDG  125



>ref|XP_002315675.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|EEF01846.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=481

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAIA+AK +L+MT+GGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAIAKAKHYLAMTTGGLGAYSDSRGMPGVRKEVADFIERRDG  125



>ref|XP_007222799.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
 gb|EMJ23998.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
Length=481

 Score =   228 bits (580),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+T+GGLGAYSDSRGIPGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAISRAKHYLSITTGGLGAYSDSRGIPGVRKEVAEFIERRDG  125



>ref|XP_007044762.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044763.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044764.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00594.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00595.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00596.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
Length=481

 Score =   228 bits (580),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LD+E+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDHESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIERRDG  125



>gb|KJB31170.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31171.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31172.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31173.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=481

 Score =   227 bits (579),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNP ALGQKPLTFPRQV+AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFIERRDG  125



>ref|XP_010928898.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
 ref|XP_010928907.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
Length=481

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE+LNENVKK  YAVRGELY RASELQKEGKKIIFT+VGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYFRASELQKEGKKIIFTDVGNPHALGQKPLSFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARA+ +LSMTSGGLGAYSDSRGIPGVRKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARARHYLSMTSGGLGAYSDSRGIPGVRKEVADFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_009406515.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406516.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDP+VG++FPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVA FI RRD
Sbjct  65   LCQAPFLLDDPHVGILFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_011014669.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Populus euphratica]
 ref|XP_011014670.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Populus euphratica]
Length=481

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG +FPADAIA+AK +L+MT+GGLGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGFLFPADAIAKAKHYLAMTTGGLGAYSDSRGMPGVRKEVADFIERRDG  125



>gb|AET06145.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=480

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LD+E LNENVK  QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+AL
Sbjct  5    LDHETLNENVKNVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVAL  64

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGLVFPADAIARAK +LS+TSGGLGAYSDSRG+PG+RKEVA FI RRDG
Sbjct  65   CQAPFLLDDPNVGLVFPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIERRDG  124



>ref|NP_001237581.1| alanine aminotransferase 3 [Glycine max]
 gb|ABW17198.1| alanine aminotransferase 3 [Glycine max]
Length=480

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFILRRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|NP_001237567.1| alanine aminotransferase 2 [Glycine max]
 gb|ABW17197.1| alanine aminotransferase 2 [Glycine max]
Length=481

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFILRRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_003519649.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
2 [Glycine max]
 gb|KHN00386.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFILRRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>gb|KHN14541.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRG+PGVRKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFILRRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_008447004.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=334

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGL AYSDSRGIP +RKEVA FIGRRDG
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKSYLSLIPGGLVAYSDSRGIPAIRKEVADFIGRRDG  125



>ref|XP_004309987.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457416.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+TSGGLGAYSDSRGIP +RKEVA FI +RDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAISRAKHYLSVTSGGLGAYSDSRGIPAIRKEVAEFIEKRDG  125



>ref|XP_008389735.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Malus 
domestica]
Length=481

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNEKVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAI+RAK +LS+TSGGLGAYSDSRGIPGVRKEVA FI +RDG
Sbjct  66   CQAPFLLDDPNVGLLFPADAISRAKHYLSITSGGLGAYSDSRGIPGVRKEVAEFIEKRDG  125



>ref|XP_007158412.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
 gb|ESW30406.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
Length=481

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLD+  +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+A
Sbjct  5    PLDHALINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRGIPGVRKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFILRRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|NP_001151209.1| alanine aminotransferase 2 [Zea mays]
 gb|ACG41981.1| alanine aminotransferase 2 [Zea mays]
Length=478

 Score =   225 bits (573),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE LNENVK+ QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYEELNENVKRVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDP+VGL+FPADAIARAK +L+M  GGLGAYSDSRGIPG+RKEVA FI +RD
Sbjct  65   LCQAPFLLDDPHVGLMFPADAIARAKHYLAMAPGGLGAYSDSRGIPGIRKEVADFIHKRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
Length=460

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGLGAYSDSRGIP +RKEVA FIGRRDG
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKHYLSLIPGGLGAYSDSRGIPAIRKEVADFIGRRDG  125



>gb|EMT29455.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=523

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL+FPADAIARAK +LS+  GGLGAYSDSRGIPGVR+EVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGLIFPADAIARAKHYLSLAPGGLGAYSDSRGIPGVRQEVAEFIQRRDG  125



>ref|XP_004155366.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Cucumis sativus]
Length=481

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGLGAYSDSRGIP +RKEVA FIGRRDG
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKHYLSLIPGGLGAYSDSRGIPAIRKEVADFIGRRDG  125



>gb|KGN51765.1| hypothetical protein Csa_5G598730 [Cucumis sativus]
Length=481

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLL+DPNVGL+FPADAIARAK +LS+  GGLGAYSDSRGIP +RKEVA FIGRRDG
Sbjct  66   CQAPFLLEDPNVGLIFPADAIARAKHYLSLIPGGLGAYSDSRGIPAIRKEVADFIGRRDG  125



>ref|XP_002312679.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
 gb|EEE90046.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
Length=481

 Score =   223 bits (568),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL FPADAI++AK +L+MT GGLGAY+DSRG+PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGLFFPADAISKAKHYLAMTIGGLGAYTDSRGMPGVRKEVADFIERRDG  125



>gb|KGN51767.1| hypothetical protein Csa_5G598750 [Cucumis sativus]
Length=474

 Score =   223 bits (568),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLL+DPNVGL+FPADAI RAK +LS+  GGLGAYSDSRGIP +RKEVA FIGRRDG
Sbjct  66   CQAPFLLEDPNVGLIFPADAIERAKSYLSLIPGGLGAYSDSRGIPAIRKEVADFIGRRDG  125



>ref|XP_002968244.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
 ref|XP_002976136.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ23041.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ30498.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
Length=481

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LD +N+NENVKKC YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDPDNINENVKKCVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFL+DDPNVGL+FP DA+ARAK +LSMTSGG+GAYSDSRG+PGVR+EVA FI +RDG
Sbjct  66   CQAPFLMDDPNVGLLFPPDAVARAKHYLSMTSGGVGAYSDSRGLPGVRQEVAEFIQKRDG  125



>ref|NP_001183048.1| uncharacterized protein LOC100501386 [Zea mays]
 gb|ACR35540.1| unknown [Zea mays]
Length=479

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            P+DYE LNE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  65

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FP DAI RAK++L+M  GGLGAYSD+RGIPG+RKEVA FI +RD
Sbjct  66   LCQAPFLLDDPNVGLMFPPDAIVRAKRYLAMAPGGLGAYSDARGIPGIRKEVADFIHKRD  125

Query  489  G  491
            G
Sbjct  126  G  126



>ref|XP_008444367.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=473

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE++NEN+KK +YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYESINENMKKVEYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVG +FP DAI RAK +LSM  GGLGAYSDSRG PGVRKEVA FI RRD
Sbjct  65   LCQAPFLLDDPNVGQLFPPDAIVRAKHYLSMIGGGLGAYSDSRGNPGVRKEVAEFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>tpg|DAA42656.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
 tpg|DAA42657.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
Length=483

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            P+DYE LNE VKK QYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  65

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FP DAI RAK++L+M  GGLGAYSD+RGIPG+RKEVA FI +RD
Sbjct  66   LCQAPFLLDDPNVGLMFPPDAIVRAKRYLAMAPGGLGAYSDARGIPGIRKEVADFIHKRD  125

Query  489  G  491
            G
Sbjct  126  G  126



>tpg|DAA42658.1| TPA: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Zea mays]
Length=479

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            P+DYE LNE VKK QYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  65

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAPFLLDDPNVGL+FP DAI RAK++L+M  GGLGAYSD+RGIPG+RKEVA FI +RD
Sbjct  66   LCQAPFLLDDPNVGLMFPPDAIVRAKRYLAMAPGGLGAYSDARGIPGIRKEVADFIHKRD  125

Query  489  G  491
            G
Sbjct  126  G  126



>gb|KJB31175.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=495

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 114/134 (85%), Gaps = 14/134 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------------IIFTNVGNPHAL  269
            LDYE +NENVKK QYAVRGELYLRASELQKEGKK              IIFTNVGNP AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKYMKSTVCWGSMHFHIIFTNVGNPQAL  65

Query  270  GQKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPG  449
            GQKPLTFPRQV+ALCQAPFLLDDPNVGL+FPADAIARAK +LS+TSGGLGAYSDSRGIPG
Sbjct  66   GQKPLTFPRQVVALCQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAYSDSRGIPG  125

Query  450  VRKEVAXFIGRRDG  491
            VRKEVA FI RRDG
Sbjct  126  VRKEVAEFIERRDG  139



>ref|XP_001782822.1| predicted protein [Physcomitrella patens]
 gb|EDQ52399.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   217 bits (552),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            +D ENLNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    MDPENLNENVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  66

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFL+DDP+VGL+FPADAIA+AK +LSMTSGG+GAYSDSRG+PGVR+EVA FI +RDG
Sbjct  67   CQAPFLMDDPHVGLLFPADAIAKAKHYLSMTSGGVGAYSDSRGLPGVRQEVANFILQRDG  126



>gb|EMS58349.1| Alanine aminotransferase 2 [Triticum urartu]
Length=478

 Score =   217 bits (552),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPN  L  PADAIARAK +LS+  GGLGAYSDSRGIPGVR+EVA FI RRDG
Sbjct  66   CQAPFLLDDPNAALSSPADAIARAKHYLSLAPGGLGAYSDSRGIPGVRQEVAEFIQRRDG  125



>ref|XP_011086618.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Sesamum indicum]
Length=478

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 3/120 (3%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVGL       A+AK +L+MTSGGLGAYSDSRG+PG+RKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGL---XXXXAKAKHYLAMTSGGLGAYSDSRGLPGIRKEVAEFIERRDG  122



>ref|XP_009105726.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Brassica rapa]
Length=509

 Score =   215 bits (548),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 115/148 (78%), Gaps = 28/148 (19%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG--------------------------  413
            CQAPFLLD+PNVG++FPADAIARAK +LS+TSGG                          
Sbjct  66   CQAPFLLDNPNVGMIFPADAIARAKHYLSLTSGGLGMSLLSIYLLTIAKACKSKKHFCFN  125

Query  414  --LGAYSDSRGIPGVRKEVAXFIGRRDG  491
              LGAYSDSRG+PGVRKEVA FI RRDG
Sbjct  126  LLLGAYSDSRGLPGVRKEVAEFIQRRDG  153



>ref|XP_001777071.1| predicted protein [Physcomitrella patens]
 gb|EDQ58064.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   214 bits (546),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            +D +NLNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    MDPDNLNENVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  66

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFL+DDP+VGL+FPADAIA+AK +L+MTSGG+GAYSDSRG+PGVR+EVA FI +RDG
Sbjct  67   CQAPFLMDDPHVGLLFPADAIAKAKHYLAMTSGGVGAYSDSRGLPGVRQEVANFILQRDG  126



>gb|ABK25444.1| unknown [Picea sitchensis]
 gb|ABR16321.1| unknown [Picea sitchensis]
 gb|ABR17158.1| unknown [Picea sitchensis]
 gb|ACN40300.1| unknown [Picea sitchensis]
Length=480

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDYE +NENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNP ALGQ+PLTFPRQV+A
Sbjct  5    PLDYECINENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQRPLTFPRQVMA  64

Query  309  LCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            LCQAP L+DDPNV ++FPAD IARAK +L+MT+GGLGAYSDSRG+PG+RKEVA FI RRD
Sbjct  65   LCQAPMLMDDPNVSILFPADVIARAKHYLAMTTGGLGAYSDSRGLPGIRKEVAEFIERRD  124

Query  489  G  491
            G
Sbjct  125  G  125



>ref|XP_004142968.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 ref|XP_004161062.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 gb|KGN62316.1| hypothetical protein Csa_2G349020 [Cucumis sativus]
Length=473

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            LDYE++NEN+KK +YAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQ PLTFPRQVIAL
Sbjct  6    LDYESINENMKKVEYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQMPLTFPRQVIAL  65

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFLLDDPNVG +FP DAI RAK +LSM  GGLGAYSDSRG PGVRKEVA FI RRDG
Sbjct  66   CQAPFLLDDPNVGQLFPPDAIVRAKHYLSMIGGGLGAYSDSRGNPGVRKEVAEFIERRDG  125



>ref|XP_001763950.1| predicted protein [Physcomitrella patens]
 gb|EDQ71354.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            +D ENLN NVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    MDPENLNLNVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  66

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQAPFL+DDP+VGL+FP DAIARAK +L+MTSGG+GAYSDSRG+PGVR+EVA FI  RDG
Sbjct  67   CQAPFLMDDPHVGLLFPEDAIARAKHYLAMTSGGVGAYSDSRGLPGVRQEVAEFILERDG  126



>emb|CDY12474.1| BnaC07g13140D [Brassica napus]
Length=537

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 102/118 (86%), Gaps = 11/118 (9%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  68   LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  127

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRR  485
            CQAPFLLDDPNVG++F ADAI RAK +LS+TSGGLGAY           +VA FI RR
Sbjct  128  CQAPFLLDDPNVGMLFSADAIERAKHYLSLTSGGLGAY-----------KVAEFIQRR  174



>ref|XP_002947519.1| alanine aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ51567.1| alanine aminotransferase [Volvox carteri f. nagariensis]
Length=522

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  326
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTFPRQV+ALC APF
Sbjct  60   LNENVMKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFPRQVLALCAAPF  119

Query  327  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            LLD P V  +FPADAIARAK+ LS   GG+GAY+DSRG P VR+EVA FI +RDG
Sbjct  120  LLDHPRVEELFPADAIARAKKILSAFKGGVGAYTDSRGNPLVREEVARFIEKRDG  174



>gb|AAB01685.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  326
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTF RQV+ALC APF
Sbjct  59   LNENVVKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFTRQVLALCAAPF  118

Query  327  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            LLD P V  +FPADAIARAK+ L+   GG+GAY+DSRG P VR+EVA FI +RDG
Sbjct  119  LLDHPKVEDMFPADAIARAKKILASFKGGVGAYTDSRGNPLVREEVARFIEKRDG  173



>ref|XP_001698518.1| alanine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP08011.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  326
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTF RQV+ALC APF
Sbjct  59   LNENVVKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFTRQVLALCAAPF  118

Query  327  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            LLD P V  +FPADAIARAK+ L+   GG+GAY+DSRG P VR+EVA FI +RDG
Sbjct  119  LLDHPKVEDMFPADAIARAKKILASFKGGVGAYTDSRGNPLVREEVARFIEKRDG  173



>ref|XP_005651940.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE27396.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  326
            LNEN+ + +YAVRGELYLR  EL+K+GK+IIFTNVGNPH LGQKPLTF RQV++L  +P 
Sbjct  62   LNENLVRAEYAVRGELYLRGEELRKQGKEIIFTNVGNPHVLGQKPLTFNRQVLSLIASPA  121

Query  327  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            LL+ P VG +FP+DAIARAKQ L+   GG+GAYSDSRG  GVRKE+A FI +RDG
Sbjct  122  LLEHPEVGRLFPSDAIARAKQVLTYFPGGMGAYSDSRGAEGVRKEIAEFISKRDG  176



>gb|KIZ04988.1| alanine transaminase [Monoraphidium neglectum]
Length=242

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  326
            LNEN++K QYAVRGELYL+A EL+  GK IIFTNVGNPH LG KP+TF RQVIALC APF
Sbjct  58   LNENMRKTQYAVRGELYLKAEELKNAGKPIIFTNVGNPHNLGAKPITFTRQVIALCAAPF  117

Query  327  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            LL  P V  +FPADAI RAK+ L   SGG+GAY DSRG   VR+EVA FI  RDG
Sbjct  118  LLQHPKVAELFPADAIERAKKLLGAFSGGIGAYQDSRGNFLVRQEVADFIKARDG  172



>emb|CBJ25743.1| nicotinanamine aminotransferase A [Ectocarpus siliculosus]
Length=490

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            L Y+ + E VK CQYAVRGE+YL A+E  K GK++IFTNVGNPH LGQKPLTF RQV+AL
Sbjct  9    LTYDTIAECVKDCQYAVRGEIYLAATERIKAGKEVIFTNVGNPHGLGQKPLTFLRQVMAL  68

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
              APFLL+DP V  +FP DAIARA+++L    GG GAYSDS+G P VR+EV  FI RRDG
Sbjct  69   VMAPFLLEDPRVSDMFPGDAIARAREYLVHVKGGFGAYSDSKGNPYVRQEVCDFIERRDG  128



>gb|KIY95165.1| alanine transaminase [Monoraphidium neglectum]
Length=227

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  326
            +N N+ K QYAVRGELYLRA ++++EG+ IIFTN+GNPH LG +P TF RQ++ALC AP+
Sbjct  77   INPNILKTQYAVRGELYLRADKMRREGRDIIFTNIGNPHNLGAQPKTFTRQLVALCAAPW  136

Query  327  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            LLDDP    +FP+D + RA++ L   +GG+GAY+DSRG   VR+EVA FI RRDG
Sbjct  137  LLDDPRAAELFPSDVMQRARKLLGTFTGGIGAYTDSRGNAAVRREVADFIQRRDG  191



>gb|EWM24220.1| alanine-2-oxoglutarate aminotransferase 2 [Nannochloropsis gaditana]
Length=593

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            L+Y++L ++VK C+YAVRGELY  A+E    GK++IFTNVGNPH LGQKP+TF RQV AL
Sbjct  52   LNYDSLPDHVKHCEYAVRGELYRAATERVAAGKEVIFTNVGNPHGLGQKPITFIRQVFAL  111

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
              APFLL+ P+V  +FP D IARAK ++    GG+GAYSDS+G+P VR+E A F+ RRDG
Sbjct  112  VSAPFLLEHPDVHRIFPRDVIARAKAYMKAAPGGIGAYSDSKGLPIVRQEFADFLQRRDG  171



>ref|XP_001745052.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90285.1| predicted protein [Monosiga brevicollis MX1]
Length=480

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  326
            +N NV    YAVRG++Y  A + + EGKK+I TNVGNPH+LGQ  +TFPRQV+AL   P 
Sbjct  13   INANVLAATYAVRGKIYEMAMQRKAEGKKVILTNVGNPHSLGQPAITFPRQVLALMNYPA  72

Query  327  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            LLD PNVG +FPAD IARA+ +L    GG GAY DSRG P +RKEVA FI  RDG
Sbjct  73   LLDAPNVGDLFPADVIARARTYLEAFPGGTGAYQDSRGNPAIRKEVADFISARDG  127



>ref|XP_005847240.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
 gb|EFN55138.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
Length=529

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  326
            LNE++ K +YAVRGELY +A ELQK+G+++IFTNVGNP  LGQ+P+TF R V +L  APF
Sbjct  67   LNEDLLKAEYAVRGELYNKAMELQKQGRELIFTNVGNPQQLGQQPITFNRMVTSLVAAPF  126

Query  327  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            L+  P+   +FPAD + RAK+   M  G LGAY+DSRG  GVR+EVA FI +RDG
Sbjct  127  LMGHPSAPSMFPADVLERAKKINGMFGGALGAYTDSRGNAGVRQEVADFIKQRDG  181



>gb|KIZ07569.1| alanine transaminase [Monoraphidium neglectum]
Length=621

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 89/129 (69%), Gaps = 14/129 (11%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQ---------  299
            +N N+ K QYAVRGELYL+A E+++ G+ +IFTN+GNPH LG KP TF RQ         
Sbjct  116  VNPNIIKTQYAVRGELYLKAEEMRRAGRDVIFTNIGNPHNLGAKPKTFTRQAGRGPPRPG  175

Query  300  -----VIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  464
                 VIALC AP LLD P    +FP D +ARA++ LS  +GG+G+Y+DSRG   VR++V
Sbjct  176  PLGRVVIALCAAPDLLDSPQAAGLFPHDTVARARKLLSSFTGGVGSYTDSRGNSMVRQDV  235

Query  465  AXFIGRRDG  491
            A FIGRRDG
Sbjct  236  ADFIGRRDG  244



>ref|XP_004992298.1| alanine aminotransferase [Salpingoeca rosetta]
 gb|EGD75245.1| alanine aminotransferase [Salpingoeca rosetta]
Length=481

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  326
            +N+ V    YAVRG +Y+ A + +  GK++IFTN+GNP +LGQKP+TFPRQVI+L   P 
Sbjct  16   INQFVIASHYAVRGTIYIEAQKRKASGKEVIFTNIGNPQSLGQKPITFPRQVISLVTCPQ  75

Query  327  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            LL+ P+VG +FP DAIARAK++L    GG GAY DSRG   VR+EVA FI RRDG
Sbjct  76   LLEHPDVGKLFPEDAIARAKKYLDNLPGGSGAYQDSRGNMYVRQEVADFIARRDG  130



>gb|KDD76740.1| aminotransferase [Helicosporidium sp. ATCC 50920]
Length=485

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  326
            +N  + K +YAVRGELY RA EL  +G++II+TNVGNPH LG KPLTF R+VI+L  +P+
Sbjct  24   MNPAILKAEYAVRGELYNRAMELAAQGREIIYTNVGNPHQLGGKPLTFNREVISLMLSPW  83

Query  327  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            LLD P    +F  + I RA++      G  GAY+DSRG+ G+RKEVA FI  RDG
Sbjct  84   LLDLPQTQEMFRPEVIERAREMSGFFGGAAGAYTDSRGVAGIRKEVAAFISERDG  138



>gb|AFK37995.1| unknown [Lotus japonicus]
Length=83

 Score =   122 bits (305),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  308
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYVSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  309  LCQA  320
            LC  
Sbjct  65   LCHV  68



>ref|XP_011398130.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25238.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
Length=487

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  326
            LN+N+ K QYAVRGELY RA EL K G ++I+TN+GNP  LGQ+PL F RQV+AL  APF
Sbjct  24   LNDNILKTQYAVRGELYTRAQELAKSGGEVIYTNIGNPQQLGQEPLVFNRQVLALLLAPF  83

Query  327  LLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            LLD P+   +FP +AI RA++ L+   G +GAYSD+RG P +R++VA FI  RDG
Sbjct  84   LLDHPSASALFPREAIDRARELLAAFGGRMGAYSDARGAPAIRQQVAAFIEARDG  138



>ref|XP_007510961.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66521.1| predicted protein [Bathycoccus prasinos]
Length=480

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (68%), Gaps = 9/130 (7%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  281
            P++   +N+NV   +YAVRG + +RA EL  + KK         I+  N+GNP +LGQKP
Sbjct  4    PVNANTINQNVLTAEYAVRGPIVVRAGELALQLKKDPSSLPFEDIVLCNIGNPQSLGQKP  63

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +TF RQ++A+C  P LLD P    +FP D IAR+K+ L+ T+GG GAY++S+G+  VR++
Sbjct  64   ITFYRQIMAICDYPDLLDSPECSKIFPEDVIARSKEVLANTAGGTGAYTESKGLKYVREQ  123

Query  462  VAXFIGRRDG  491
            +A F+ +RDG
Sbjct  124  IATFLEKRDG  133



>ref|XP_002175263.1| alanine aminotransferase [Schizosaccharomyces japonicus yFS275]
 gb|EEB08970.1| alanine aminotransferase [Schizosaccharomyces japonicus yFS275]
Length=486

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 89/129 (69%), Gaps = 11/129 (9%)
 Frame = +3

Query  135  DYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPLT  287
            D E LN+NV   QYAVRG L +RA EL+ + K+         II  N+GNPH +GQ PLT
Sbjct  12   DPEQLNQNVFAAQYAVRGPLAVRAEELRAQLKEKPDSLPFTEIINANIGNPHQMGQIPLT  71

Query  288  FPRQVIALCQAPFLLDDPNVGL-VFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  464
            F RQV+ALCQ P L+++  +   +FP+DAIARAK+ L  T GG+GAYS S+G+P VR++V
Sbjct  72   FIRQVLALCQYPALIENAEITQKLFPSDAIARAKELLEET-GGIGAYSSSQGVPLVRRDV  130

Query  465  AXFIGRRDG  491
            A FI  RDG
Sbjct  131  ARFIEERDG  139



>ref|XP_002176328.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC42720.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=464

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 86/118 (73%), Gaps = 3/118 (3%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  326
            +++++++ QYAVRGE+ L+A +L  EG+KI +TNVGNPHA+GQ+P+TF RQV+ALC  P 
Sbjct  1    MSQSLRRMQYAVRGEVVLKADKLAAEGRKITYTNVGNPHAVGQQPITFYRQVLALCDLPA  60

Query  327  L--LDDPNVGLVFPADAIARAKQFLSMT-SGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
               +D PN   +FP D + RA++   +   GG G+Y++S+G+ G+RK VA +I  RDG
Sbjct  61   SCGVDHPNASQLFPLDVLERARELRGIVGKGGTGSYTNSQGLAGIRKHVAEYILNRDG  118



>ref|XP_005648726.1| alanine aminotransferase 2 [Coccomyxa subellipsoidea C-169]
 gb|EIE24182.1| alanine aminotransferase 2 [Coccomyxa subellipsoidea C-169]
Length=505

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 83/129 (64%), Gaps = 8/129 (6%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPL  284
            PL  EN+N  V K QYAVRGE+ +RA EL+ +          KI++ N+GNP  LGQ P+
Sbjct  19   PLALENINPKVVKAQYAVRGEIVIRAKELEDKLHAGEKLPFDKILYCNIGNPQQLGQHPV  78

Query  285  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  464
            TF RQV+A+C  P LL+      +FP D +ARAK++L+   GG GAYSDSRG   +R+++
Sbjct  79   TFYRQVLAICDYPELLESAEAKSIFPPDVLARAKKYLAAIPGGTGAYSDSRGAMVLRQDI  138

Query  465  AXFIGRRDG  491
            A  I  RDG
Sbjct  139  AKGIEERDG  147



>gb|EJK48082.1| hypothetical protein THAOC_33157 [Thalassiosira oceanica]
Length=613

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQA  320
            + +++++++ QYAVRGE+ + A EL+ EG++IIFTNVGNPHA+GQK +T+ RQV+ALC  
Sbjct  127  DTMSQSLRRMQYAVRGEVVMLAEELKAEGREIIFTNVGNPHAVGQKCITYYRQVLALCDL  186

Query  321  P--FLLDDPNVGLVFPADAIARAKQFL-SMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            P    +D P+V  +FP D IARA+ +  ++ +GG G+YS S+G+   R+ VA FI  RDG
Sbjct  187  PDECGVDHPDVERLFPKDVIARARLYKDAIGTGGTGSYSHSQGVKEFREHVAKFIEARDG  246



>ref|XP_003291733.1| alanine transaminase [Dictyostelium purpureum]
 gb|EGC31753.1| alanine transaminase [Dictyostelium purpureum]
Length=530

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASEL-------QKEGKK------IIFTNVGNPHALG  272
            +  +N+ +NV+  QYAVRGEL +RA  +       +KEG K      I++ N+GNP  L 
Sbjct  50   MTIDNICQNVRNAQYAVRGELVIRAESISHQLEKQKKEGSKVLPFDEIVYCNIGNPQQLK  109

Query  273  QKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGV  452
            QKPLTF RQV++L + P LLD+P +  ++PAD IARA++ L   +   GAYS S+GI  V
Sbjct  110  QKPLTFFRQVVSLTECPELLDNPYIEKIYPADVIARAREILGSINNTTGAYSSSQGISLV  169

Query  453  RKEVAXFIGRRDG  491
             K VA FI +RDG
Sbjct  170  LKSVASFIEKRDG  182



>ref|XP_005833147.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
 gb|EKX46167.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
Length=473

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 82/125 (66%), Gaps = 8/125 (6%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLTFPR  296
            +++N  V + QYAVRG L LRA + ++  ++        I++ N+GNPH L QKP+TF R
Sbjct  6    DSINPKVLEAQYAVRGALVLRAMQHERALQQKQTLPFNEILYCNIGNPHQLKQKPITFFR  65

Query  297  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFI  476
            QV+AL   P LLD      VFPADAIARAK F   T GG GAYS+S+G+  VR+ VA FI
Sbjct  66   QVLALTDYPDLLDMQGCSEVFPADAIARAKDFHKNTPGGTGAYSESQGLRHVRENVAKFI  125

Query  477  GRRDG  491
             +RDG
Sbjct  126  AKRDG  130



>emb|CDY25781.1| BnaA07g10010D [Brassica napus]
Length=58

 Score =   110 bits (274),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  296
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFP 
Sbjct  3    LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPH  57



>ref|XP_005825112.1| hypothetical protein GUITHDRAFT_77426 [Guillardia theta CCMP2712]
 gb|EKX38132.1| hypothetical protein GUITHDRAFT_77426 [Guillardia theta CCMP2712]
Length=482

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 9/129 (7%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  284
            L  +N+N+N+ + QYAVRG + + A  +QKE          K++++ N+GNPH++GQKP+
Sbjct  11   LTKKNINQNLVEMQYAVRGLVPITAERIQKEILNGDTSKPFKEVLYCNIGNPHSVGQKPI  70

Query  285  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  464
            TF R+V+AL   P LL+   V  +F  D I RAK+ + +  GG GAYS S+GI G+RK V
Sbjct  71   TFYREVLALVDCPMLLEREGVEKLFKPDVIKRAKELIGLIKGGTGAYSHSQGIEGIRKHV  130

Query  465  AXFIGRRDG  491
            A FI  RDG
Sbjct  131  AEFIKGRDG  139



>gb|EJK50290.1| hypothetical protein THAOC_30762 [Thalassiosira oceanica]
Length=570

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 84/120 (70%), Gaps = 3/120 (3%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQA  320
              +++N+++ QYAVRGE+ ++A  + K+GKKII+TN+GNPHA+GQKP+T+ RQVI+LC  
Sbjct  116  HTMSQNLRRMQYAVRGEVVIKADAMAKKGKKIIYTNIGNPHAVGQKPITYYRQVISLCDL  175

Query  321  PFL--LDDPNVGLVFPADAIARAKQFL-SMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            P    + +P +  VFP D + RA +   ++   G GAY++S+GI   R ++A FI  RDG
Sbjct  176  PAECGIANPTISSVFPEDVVVRAIEMREAIGPAGTGAYTNSQGIGKFRDDIAKFITARDG  235



>ref|XP_637993.1| alanine transaminase [Dictyostelium discoideum AX4]
 sp|Q54MJ7.1|ALAM_DICDI RecName: Full=Probable alanine aminotransferase, mitochondrial; 
Short=ALT; AltName: Full=Glutamate pyruvate transaminase; 
Short=GPT; AltName: Full=Glutamic--alanine transaminase; AltName: 
Full=Glutamic--pyruvic transaminase; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL64484.1| alanine transaminase [Dictyostelium discoideum AX4]
Length=534

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 87/133 (65%), Gaps = 13/133 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRAS----ELQK---EGKK------IIFTNVGNPHALG  272
            +  +N+ +NV+  QYAVRGEL +RA     +LQK   EG K      I++ N+GNP  L 
Sbjct  54   MTIDNICQNVRNAQYAVRGELVIRAEAISHQLQKQKTEGTKTLPFEEIVYCNIGNPQQLK  113

Query  273  QKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGV  452
            QKPLT+ RQV++L + P LLD+P V  ++PAD I+RAK+ L   +   GAYS+S+GI  V
Sbjct  114  QKPLTYFRQVVSLVECPDLLDNPYVEKIYPADVISRAKEILGSINNTTGAYSNSQGIGLV  173

Query  453  RKEVAXFIGRRDG  491
             + VA FI RRDG
Sbjct  174  LRSVADFIERRDG  186



>gb|AIT69925.1| alanine transaminase [Saccharina sculpera]
Length=501

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 85/130 (65%), Gaps = 12/130 (9%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  284
            PLD   +NENVK  +YAVRG +  R+ ELQ+    G+K+ F      N+GNPHA  Q PL
Sbjct  21   PLDGTTINENVKSAKYAVRGNVLERSMELQRRMAAGEKLPFDTIVPCNIGNPHACLQSPL  80

Query  285  TFPRQVIALCQAPFLLDD-PNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +F R+V++LC +P L  D P+V   F  D + RAK + +   GG+GAY++S+GIP VR+E
Sbjct  81   SFHREVLSLCISPTLASDHPHV---FKKDVVERAKAYTAGLGGGVGAYTNSQGIPAVREE  137

Query  462  VAXFIGRRDG  491
            +A FI  RDG
Sbjct  138  IAAFIAERDG  147



>gb|AIT69927.1| alanine transaminase [Saccharina japonica]
 gb|AIW62927.1| alanine transaminase [Saccharina japonica]
Length=501

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 85/130 (65%), Gaps = 12/130 (9%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  284
            PLD   +NENVK  +YAVRG +  R+ ELQ+    G+K+ F      N+GNPHA  Q PL
Sbjct  21   PLDGTTINENVKSAKYAVRGNVLERSMELQRRMAAGEKLPFDTIVPCNIGNPHACLQSPL  80

Query  285  TFPRQVIALCQAPFLLDD-PNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +F R+V++LC +P L  D P+V   F  D + RAK + +   GG+GAY++S+GIP VR+E
Sbjct  81   SFHREVLSLCISPTLASDHPHV---FKKDVVERAKAYTAGLGGGVGAYTNSQGIPAVREE  137

Query  462  VAXFIGRRDG  491
            +A FI  RDG
Sbjct  138  IAAFIAERDG  147



>gb|KIZ01751.1| alanine transaminase [Monoraphidium neglectum]
Length=351

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 81/125 (65%), Gaps = 9/125 (7%)
 Frame = +3

Query  144  NLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPLTFPR  296
            ++   + + +YAVRGE+  RA E+ ++ +K         +++ N+GNP  LGQKP+T+ R
Sbjct  3    SIRPRIVQVEYAVRGEIVRRAQEIAEDLEKGHGEHPFDKVVWCNIGNPQILGQKPITYFR  62

Query  297  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFI  476
            QV+ LC+ P LL  P V  +FPAD I RA+QFL+   GGLGAYSDS G    R+++A  I
Sbjct  63   QVLCLCEYPELLKHPEVTALFPADVIKRAEQFLAEIPGGLGAYSDSAGAAVCRRQIAAAI  122

Query  477  GRRDG  491
             RRDG
Sbjct  123  ERRDG  127



>sp|P52894.1|ALA2_HORVU RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Hordeum vulgare]
 emb|CAA81231.1| alanine aminotransferase [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 83/127 (65%), Gaps = 10/127 (8%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  293
            +NLN  V KC+YAVRGE+ + A  LQ++ K         +I++ N+GNP +LGQ+P+TF 
Sbjct  8    DNLNPKVLKCEYAVRGEIVIHAQRLQEQLKTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  294  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAX  470
            R+V+ALC  P LL    +  +F AD+I+RAKQ L+M  G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPDLLQREEIKTLFSADSISRAKQILAMIPGRATGAYSHSQGIKGLRDAIAS  127

Query  471  FIGRRDG  491
             I  RDG
Sbjct  128  GIASRDG  134



>ref|WP_026853156.1| aminotransferase class I/II [Geothrix fermentans]
Length=451

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 83/116 (72%), Gaps = 4/116 (3%)
 Frame = +3

Query  144  NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAP  323
            +L + V + +YAVRG +  RA+EL+K+G++II+ N+GNP +LGQKPLT+ RQ++ALC+ P
Sbjct  7    DLGKAVLETEYAVRGPIVARAAELEKQGREIIYCNIGNPQSLGQKPLTWNRQILALCEYP  66

Query  324  FLLD-DPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
             L+D  P     FPAD +  A+  L+ T  GLGAYS+SRG+  +R+ VA FI  RD
Sbjct  67   DLMDLAPG---AFPADVVETARAILAGTRHGLGAYSESRGVRFIREGVAEFILERD  119



>ref|XP_001622550.1| hypothetical protein NEMVEDRAFT_v1g236165 [Nematostella vectensis]
 gb|EDO30450.1| predicted protein [Nematostella vectensis]
Length=496

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 85/125 (68%), Gaps = 13/125 (10%)
 Frame = +3

Query  144  NLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLTFPRQ  299
            ++N  VK+ +YAVRG + +RASEL+KE         K+++  N+G+ HALG KPL FPRQ
Sbjct  24   SMNPYVKQIEYAVRGAIVIRASELEKELQQGHEKPFKEVVKANIGDAHALGMKPLKFPRQ  83

Query  300  VIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAXFI  476
            V+ALC  P LLDDP+    FP+DA  RA++ L+ T G  +GAYSDS G+  +R++V  +I
Sbjct  84   VLALCVNPALLDDPS----FPSDAKDRARRILNSTRGFSMGAYSDSVGLEAIREDVTKYI  139

Query  477  GRRDG  491
              RDG
Sbjct  140  EERDG  144



>ref|XP_010939848.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Elaeis guineensis]
Length=518

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 84/131 (64%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            PL ++++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  40   PLTFDSINPKVLKCEYAVRGEIVSHAQRLQQELQTKPGSYPFDEILYCNIGNPQSLGQQP  99

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P +LD      +F +DAIARA+Q L +  G   GAYS S+GI G+R 
Sbjct  100  VTFFREVLALCDHPSILDKSEAHALFSSDAIARARQILDLIPGRATGAYSHSQGIKGLRD  159

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  160  AIAAGIAARDG  170



>gb|KFH67262.1| alanine transaminase [Mortierella verticillata NRRL 6337]
Length=540

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 86/131 (66%), Gaps = 12/131 (9%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  287
            L  +N+NE V+K +YAVRGEL +R+ EL+ E         K+++  N+GNP AL QKP+T
Sbjct  62   LTSKNMNEQVRKAEYAVRGELAIRSEELKNELAKGVKLPFKRVVGCNIGNPQALDQKPIT  121

Query  288  FPRQVIALCQAPFLLDDPNVGL---VFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRK  458
            F RQV +L + P LL D N  L   ++P+DAI RAK  L    G +GAYS S+GIP +R+
Sbjct  122  FFRQVASLTEYPELLKDENRELALKIYPSDAIDRAKLLLKHI-GSVGAYSHSQGIPHIRE  180

Query  459  EVAXFIGRRDG  491
             VA FI +RDG
Sbjct  181  NVAKFIEKRDG  191



>pdb|3TCM|A Chain A, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
 pdb|3TCM|B Chain B, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
Length=500

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 83/127 (65%), Gaps = 10/127 (8%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  293
            +NLN  V KC+YAVRGE+ + A  LQ++ K         +I++ N+GNP +LGQ+P+TF 
Sbjct  26   DNLNPKVLKCEYAVRGEIVIHAQRLQEQLKTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  85

Query  294  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAX  470
            R+V+ALC  P LL    +  +F AD+I+RAKQ L+M  G   GAYS S+GI G+R  +A 
Sbjct  86   REVLALCDHPDLLQREEIKTLFSADSISRAKQILAMIPGRATGAYSHSQGIHGLRDAIAS  145

Query  471  FIGRRDG  491
             I  RDG
Sbjct  146  GIASRDG  152



>gb|KDR12685.1| Alanine aminotransferase 2 [Zootermopsis nevadensis]
Length=538

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 85/126 (67%), Gaps = 13/126 (10%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLTFPR  296
            EN+N  +K+ +YAVRG L +RASE++KE ++        +I  N+G+ HA+GQKPLTF R
Sbjct  68   ENMNPCLKRMEYAVRGPLVIRASEIEKELQEGVKKPFSEVIKANIGDCHAMGQKPLTFIR  127

Query  297  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAYSDSRGIPGVRKEVAXF  473
            QV+AL   P LLDDP     FP DA ARAK  L+   GG +G+Y+DS GI  +R+ VA +
Sbjct  128  QVLALVSYPALLDDPR----FPTDAKARAKDILAGCRGGSVGSYTDSPGIEIIRRHVAQY  183

Query  474  IGRRDG  491
            I RRDG
Sbjct  184  IERRDG  189



>ref|XP_009380146.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  281
            P+  + +N+ V KC+YAVRGE+   A  LQ+E          ++I++ N+GNP +LGQ+P
Sbjct  45   PVALDTINQKVLKCEYAVRGEIVTHAQRLQQELQSKPGSHPFEEILYCNIGNPQSLGQQP  104

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P LLD      +F ADAIARA Q L    GG  GAYS S+GI G+R 
Sbjct  105  ITFFREVLALCDHPPLLDKSETHALFSADAIARAWQILDAIPGGATGAYSHSQGIKGLRD  164

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  165  TIADGIAARDG  175



>gb|AIT69928.1| alanine transaminase [Scytosiphon dotyi]
Length=500

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 87/130 (67%), Gaps = 12/130 (9%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  284
            PL+   +NENVK  +YAVRG +  R+ ELQ++   G+K+ F      N+GNPHA  Q PL
Sbjct  20   PLNGATINENVKAAKYAVRGAVLERSMELQRKMAAGEKLPFDTIVPCNIGNPHACLQVPL  79

Query  285  TFPRQVIALCQAPFL-LDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +F R+V++LC +P L  D P+V   F  D I RAK + +  +GG+GAY++S+GIP VR+E
Sbjct  80   SFHREVLSLCISPNLATDHPHV---FKKDVIERAKHYAAGLTGGVGAYTNSQGIPAVREE  136

Query  462  VAXFIGRRDG  491
            +A FI  RDG
Sbjct  137  IAAFIAERDG  146



>gb|EFA80185.1| alanine transaminase [Polysphondylium pallidum PN500]
Length=599

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 85/133 (64%), Gaps = 14/133 (11%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASEL-------QKEGKK------IIFTNVGNPHALG  272
            L  +N+   VK  QYAVRGEL +RA  +       +KEG K      I++ N+GNP  L 
Sbjct  120  LTLDNMCPTVKTAQYAVRGELVIRAENIAHLLEKQKKEGTKLLPFNEIVYCNIGNPQQLK  179

Query  273  QKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGV  452
            Q+P++F RQV+ALC+ P LL+  +V  VFPADAIARA++ ++ + G  GAYS S+G+  V
Sbjct  180  QQPISFFRQVLALCECPELLNSAHVDKVFPADAIARARELMA-SIGNTGAYSGSQGVASV  238

Query  453  RKEVAXFIGRRDG  491
             K VA FI  RDG
Sbjct  239  LKSVAAFIESRDG  251



>gb|AIT69918.1| alanine transaminase [Desmarestia viridis]
Length=497

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 83/130 (64%), Gaps = 12/130 (9%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  284
            PLD   +N NVK  +YAVRG +  R+ ELQ+    G+K+ F      N+GNPHA  Q PL
Sbjct  17   PLDGTTINSNVKSAKYAVRGNVLERSMELQRRMAAGEKLPFDKIVPCNIGNPHACMQLPL  76

Query  285  TFPRQVIALCQAPFLLDD-PNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +F R+V++LC +P L  D PN    F  D + RAK + S   GG+GAY++S+GIP VR+E
Sbjct  77   SFHREVLSLCISPSLASDHPNA---FKRDVVERAKSYTSGLGGGVGAYTNSQGIPAVREE  133

Query  462  VAXFIGRRDG  491
            +A FI  RDG
Sbjct  134  IAAFIAERDG  143



>ref|XP_008800517.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 83/131 (63%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+ + ++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  52   PVTFASINPKVLKCEYAVRGEIVSHAQRLQQELQTKPDSHPFDEILYCNIGNPQSLGQQP  111

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P +LD      +F +DAIARA+Q L +  G   GAYS S+GI GVR 
Sbjct  112  VTFFREVLALCDHPSILDKSETHALFSSDAIARARQILDLIPGRATGAYSHSQGIKGVRD  171

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  172  AIAAGITARDG  182



>ref|XP_011048627.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Populus 
euphratica]
Length=481

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 81/131 (62%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+  + +N  V KCQYAVRGE+   A  +Q+E K         +I++ N+GNP +LGQ+P
Sbjct  3    PVSLDTINPKVLKCQYAVRGEIVTLAQAVQEELKSKPGSRPFDEILYCNIGNPQSLGQQP  62

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            LTF R+V+ALC  PF+LD      +F ADAI RA+Q L    G   GAYS S+GI G+R 
Sbjct  63   LTFFREVLALCDHPFILDKSETRGLFSADAIERARQILDQIPGSATGAYSHSQGIKGLRD  122

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  123  AIAAGIEARDG  133



>gb|KFV83100.1| Alanine aminotransferase 2, partial [Struthio camelus australis]
Length=501

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 84/126 (67%), Gaps = 10/126 (8%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFT-----NVGNPHALGQKPLTFPR  296
            L  E++N  VK  +YAVRG + L+A E++KEG K  FT     N+G+ HA+GQ+P+TF R
Sbjct  29   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKEGIKKPFTEVIKANIGDAHAMGQRPITFLR  88

Query  297  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAXF  473
            QV+ALC  P LLD P+    FP DA  RA++ L    G  LG+YS S+GI  +R++VA +
Sbjct  89   QVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSYSASQGINCIREDVASY  144

Query  474  IGRRDG  491
            I RRDG
Sbjct  145  IERRDG  150



>gb|AIT69920.1| alanine transaminase [Scytosiphon lomentaria]
Length=500

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 86/130 (66%), Gaps = 12/130 (9%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  284
            PL    +NENVK  +YAVRG +  R+ ELQ++   G+K+ F      N+GNPHA  Q PL
Sbjct  20   PLTGSTINENVKAAKYAVRGAVLERSMELQRKMAAGEKLPFDTIVPCNIGNPHACLQVPL  79

Query  285  TFPRQVIALCQAPFL-LDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +F R+V++LC +P L  D P+V   F  D + RAK + +  +GG+GAY++S+GIP VR+E
Sbjct  80   SFHREVLSLCISPNLATDHPHV---FKEDVVERAKHYAAGLTGGVGAYTNSQGIPAVREE  136

Query  462  VAXFIGRRDG  491
            +A FI  RDG
Sbjct  137  IAAFIAERDG  146



>emb|CCW65758.1| unnamed protein product [Phytomonas sp. isolate EM1]
Length=499

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 78/124 (63%), Gaps = 9/124 (7%)
 Frame = +3

Query  144  NLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFPR  296
            ++N  V K QYAVRG +  RA E+QKE           ++++ N+GNP AL QKPLTFPR
Sbjct  18   HVNPRVVKAQYAVRGLIPTRAKEIQKEIMDGSTKYPFSELVWCNIGNPQALSQKPLTFPR  77

Query  297  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFI  476
            QV++L  APFLLD P V   +P DA+ARA+++L       GAY+DS G    RK VA +I
Sbjct  78   QVMSLFDAPFLLDIPAVLEHYPPDAVARAREYLKDVKNVTGAYTDSFGYTFARKAVAKYI  137

Query  477  GRRD  488
              RD
Sbjct  138  NERD  141



>ref|XP_008783332.1| PREDICTED: alanine aminotransferase 2 [Phoenix dactylifera]
Length=526

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 83/131 (63%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+ ++++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  48   PVTFDSINPKVLKCEYAVRGEIVSHAQRLQQELQTKPGSRPFDEILYCNIGNPQSLGQQP  107

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P +LD      +F ADAIARA Q L +  G   GAYS S+GI G+R 
Sbjct  108  ITFFREVLALCDHPSILDKSETHALFSADAIARAWQILDLIPGRAGGAYSHSQGIKGLRD  167

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  168  AIAAGIAARDG  178



>gb|EMS19811.1| 1-aminocyclopropane-1-carboxylate synthase [Rhodosporidium toruloides 
NP11]
 emb|CDR35527.1| RHTO0S01e01332g1_1 [Rhodosporidium toruloides]
Length=529

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 82/131 (63%), Gaps = 12/131 (9%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASEL----QKEGK-------KIIFTNVGNPHALGQK  278
            L  E +N++V + QYAVRG + LRA EL    +++GK        ++  N+GNP  L QK
Sbjct  54   LTNERMNKHVLEAQYAVRGAIPLRAEELREQLEEKGKDAGLPFDTVVNCNIGNPQQLDQK  113

Query  279  PLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRK  458
            PLTF RQV AL + P LLD P+   +FP+DAI RA+  L    G +GAYS S G+P +RK
Sbjct  114  PLTFLRQVSALTEYPDLLDHPSTSSIFPSDAIERARSLLKEI-GSVGAYSHSMGVPAIRK  172

Query  459  EVAXFIGRRDG  491
             VA FI  RDG
Sbjct  173  RVAQFIENRDG  183



>ref|NP_001132269.1| uncharacterized protein LOC100193705 [Zea mays]
 gb|ACF81046.1| unknown [Zea mays]
Length=176

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 81/127 (64%), Gaps = 10/127 (8%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  293
            ENLN  V KC+YAVRGE+ + A  LQ++           +I+F N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILFCNIGNPQSLGQQPVTFF  67

Query  294  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAX  470
            R+V+ALC  P LL+      +F ADAI+RAKQ L+   G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPCLLEKEETKSLFSADAISRAKQILATIPGRATGAYSHSQGIKGLRDAIAA  127

Query  471  FIGRRDG  491
             I  RDG
Sbjct  128  GITSRDG  134



>ref|XP_008797360.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  281
            P+  E +N  VKKC+YAVRGE+   A  LQ+E          ++I++ N+GNP ALGQ+P
Sbjct  52   PITVETINPKVKKCEYAVRGEIVSHAQRLQQELQTKPRSHPFEEILYCNIGNPQALGQQP  111

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P LLD      +F +DAIA+A + L +      GAYS S+GI G+R+
Sbjct  112  ITFFREVLALCNYPALLDRDETHALFSSDAIAKAWEILDLIPDRATGAYSHSQGIKGLRE  171

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  172  AIAVGIAERDG  182



>ref|XP_010917381.1| PREDICTED: alanine aminotransferase 2-like isoform X4 [Elaeis 
guineensis]
Length=470

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P LLD      +F +DAIARA + L +      GAYS S+GI G+R+
Sbjct  112  ITFFREVLALCDYPALLDRDETHALFSSDAIARAWEILDLIPDRATGAYSHSQGIKGLRE  171

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  172  AIAVGIAERDG  182



>gb|EPX73451.1| alanine aminotransferase [Schizosaccharomyces octosporus yFS286]
Length=514

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 80/128 (63%), Gaps = 13/128 (10%)
 Frame = +3

Query  144  NLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFPR  296
            NLN+ V +  YA+RG L + A E+QK           + II+ N+GNPH  GQ P+TF R
Sbjct  40   NLNQQVLQANYAIRGPLTVLAEEIQKALLEKPDAYPFQDIIYANIGNPHQFGQLPITFLR  99

Query  297  QVIALCQAPFLLD---DPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVA  467
            QV+++CQ P LLD   +P    +FP+D + RAK  L  T G +GAYSDS+GIP VRK VA
Sbjct  100  QVLSICQYPALLDHAHEPWFKNIFPSDVVERAKLLLKGT-GSVGAYSDSQGIPIVRKHVA  158

Query  468  XFIGRRDG  491
             +I  RD 
Sbjct  159  EYIQERDN  166



>ref|XP_010917380.1| PREDICTED: alanine aminotransferase 2-like isoform X3 [Elaeis 
guineensis]
Length=488

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P LLD      +F +DAIARA + L +      GAYS S+GI G+R+
Sbjct  112  ITFFREVLALCDYPALLDRDETHALFSSDAIARAWEILDLIPDRATGAYSHSQGIKGLRE  171

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  172  AIAVGIAERDG  182



>gb|AGE89226.1| cytosolic alanine aminotransferase, partial [Dicentrarchus labrax]
Length=186

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 83/129 (64%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  + +N NVK+ +YAVRG +  RA +++KE K+        +I  N+G+ HA+GQKP+T
Sbjct  1    LTVDTMNPNVKRVEYAVRGPIVQRAVQIEKELKEGVKKPFSEVIKANIGDAHAMGQKPIT  60

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LL+D      FP DA  RAK+ L    G  +GAYS S+GI  VR++V
Sbjct  61   FLRQVLALCSYPELLEDNK----FPEDAKKRAKRILQACGGHSIGAYSASQGIECVRQDV  116

Query  465  AXFIGRRDG  491
            A +I +RDG
Sbjct  117  ARYIEKRDG  125



>ref|XP_002946490.1| hypothetical protein VOLCADRAFT_120326 [Volvox carteri f. nagariensis]
 gb|EFJ52417.1| hypothetical protein VOLCADRAFT_120326 [Volvox carteri f. nagariensis]
Length=840

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 9/130 (7%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQK---EGK------KIIFTNVGNPHALGQKP  281
            PL  + +N+ V   +YAVRGE+   A ++ +   EGK      K+++ N+GNP  LGQKP
Sbjct  294  PLSIDTINKRVINSEYAVRGEIVQLAQKIARDLEEGKGSHPFDKVVWCNIGNPQILGQKP  353

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +T+ RQV+ALC+ P LLD P +  +FP D IARA+  +    GGLGAYSDS G   +R+ 
Sbjct  354  ITYFRQVLALCECPQLLDHPQIRELFPDDVIARAQLLVKAIPGGLGAYSDSAGALILRQL  413

Query  462  VAXFIGRRDG  491
            VA  I RRDG
Sbjct  414  VARSIARRDG  423



>ref|XP_010917379.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Elaeis 
guineensis]
Length=516

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P LLD      +F +DAIARA + L +      GAYS S+GI G+R+
Sbjct  112  ITFFREVLALCDYPALLDRDETHALFSSDAIARAWEILDLIPDRATGAYSHSQGIKGLRE  171

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  172  AIAVGIAERDG  182



>ref|XP_003724792.1| PREDICTED: LOW QUALITY PROTEIN: alanine aminotransferase 2-like 
[Strongylocentrotus purpuratus]
Length=552

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 86/129 (67%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E +N +++  +YAVRG +  RA+++QKE +K        +I  N+G+ HA+GQKP+T
Sbjct  55   LSLETMNPHIRVMEYAVRGPIVQRATQIQKELEKGVSKPFPSVIKCNIGDAHAMGQKPMT  114

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAYSDSRGIPGVRKEV  464
            F RQVIALC  P LLDD N    FP+DA  RA++ L+   GG LG+YS+S G+  +R +V
Sbjct  115  FLRQVIALCTYPALLDDSN----FPSDAKQRAQRILNGCKGGSLGSYSESIGLEIIRNDV  170

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  171  AEYIKRRDG  179



>ref|XP_010917378.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Elaeis 
guineensis]
Length=534

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P LLD      +F +DAIARA + L +      GAYS S+GI G+R+
Sbjct  112  ITFFREVLALCDYPALLDRDETHALFSSDAIARAWEILDLIPDRATGAYSHSQGIKGLRE  171

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  172  AIAVGIAERDG  182



>ref|WP_005033524.1| aminotransferase class I/II [Holophaga foetida]
Length=451

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 81/120 (68%), Gaps = 2/120 (2%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            +  ++L + V + QYAVRG +  +A ++++EG++II+ N+GNP AL QKPLT+ RQ +AL
Sbjct  3    MQLKDLGKAVLETQYAVRGPIVAKAQDMEREGREIIYCNIGNPQALEQKPLTYLRQTLAL  62

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            CQ P L+       +FPAD +  +++ L     G+GAYSDS+G+  +R+ VA FI  RDG
Sbjct  63   CQYPELIQ--QAAHLFPADVLENSQRLLVGIEHGMGAYSDSKGVHFIREAVAEFIHERDG  120



>ref|XP_006657960.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Oryza 
brachyantha]
Length=491

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  281
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  13   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPESLPFDEILYCNIGNPQSLGQQP  72

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V++LC  P LLD      ++ +DAI RA Q L    G   GAYS S+GI G+R 
Sbjct  73   VTFFREVLSLCDHPALLDKSETHALYSSDAIERAWQILDKIPGRATGAYSHSQGIKGLRD  132

Query  459  EVAXFIGRRDG  491
            E+A  I  RDG
Sbjct  133  EIAAGIAARDG  143



>gb|AIT69929.1| alanine transaminase [Petalonia fascia]
Length=500

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 87/130 (67%), Gaps = 12/130 (9%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  284
            PL    +NE+VK+ +YAVRG +  R+ ELQ++   G+K+ F      N+GNPHA  Q PL
Sbjct  20   PLSGATINESVKEAKYAVRGAVLERSMELQRKMAAGEKLPFDKIVPCNIGNPHACLQVPL  79

Query  285  TFPRQVIALCQAPFL-LDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +F R+V++LC +P L  D P+V   F  D + RAK + +  +GG+GAY++S+GIP VR+E
Sbjct  80   SFHREVLSLCISPNLATDHPHV---FKKDVVERAKHYAAGLTGGVGAYTNSQGIPAVREE  136

Query  462  VAXFIGRRDG  491
            +A FI  RDG
Sbjct  137  IAAFIAERDG  146



>ref|XP_010261672.1| PREDICTED: alanine aminotransferase 2-like [Nelumbo nucifera]
Length=528

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+  E LN  V KCQYAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  50   PVTAETLNPKVLKCQYAVRGEIVTHAQRLQQELQSKPSSHPFNEILYCNIGNPQSLGQQP  109

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P LL+      +F ADAI RA+Q L    G   GAYS S+GI G+R 
Sbjct  110  ITFFREVLALCDHPALLNKSETQGLFSADAIQRAQQILDQIPGRATGAYSHSQGIKGLRD  169

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  170  AIAAGIAARDG  180



>ref|XP_002430266.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
 gb|EEB17528.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
Length=485

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 83/126 (66%), Gaps = 13/126 (10%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKE---GKKIIFT-----NVGNPHALGQKPLTFPR  296
            EN+NEN+ + +YAVRG + +RA E++KE   G K  FT     N+G+ HA+GQKP+TF R
Sbjct  15   ENMNENIIRLEYAVRGPIVIRAGEIEKELEQGVKKPFTEVLKANIGDCHAMGQKPITFFR  74

Query  297  QVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAYSDSRGIPGVRKEVAXF  473
            QV+AL   P L DDP+    FP DA  RA+  L    GG +G+Y+DS GI  +RK VA F
Sbjct  75   QVLALVSLPSLFDDPS----FPEDAKDRARGVLKGCKGGSVGSYTDSVGIEIIRKHVAEF  130

Query  474  IGRRDG  491
            I RRDG
Sbjct  131  IERRDG  136



>emb|CDS30789.1| gag pol polyprotein [Hymenolepis microstoma]
Length=485

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 82/129 (64%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPLT  287
            L    +N NV + QYAVRG + +R+ EL+KE K         ++  N+G+ HA GQKP+T
Sbjct  8    LTLATINPNVVQMQYAVRGPIVIRSQELEKELKDGQKKKFEHVVKCNIGDCHATGQKPIT  67

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAYSDSRGIPGVRKEV  464
            F RQVIALC  P LLDDPN    FP DA  RA+  L+  +G  +G+YS S G+P +R+ +
Sbjct  68   FLRQVIALCSYPTLLDDPN----FPEDAKDRARGILAGCAGASVGSYSISIGVPTIRERI  123

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  124  AAYIKRRDG  132



>dbj|GAA97564.1| hypothetical protein E5Q_04242 [Mixia osmundae IAM 14324]
 gb|KEI42010.1| hypothetical protein L969DRAFT_91476 [Mixia osmundae IAM 14324]
Length=574

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 83/130 (64%), Gaps = 11/130 (8%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK----------IIFTNVGNPHALGQKP  281
            L  +++N NVK  +YAVRG + LRA EL+ + +K          ++  N+GNP  LGQ P
Sbjct  98   LTLDSINHNVKTAEYAVRGAIALRAEELRVKTQKGDTKDLNFKEVVSCNIGNPQQLGQTP  157

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +TF RQV ALC+ P LLD+P    +F  DAI RA++++    G +GAYS S+G+P +R+ 
Sbjct  158  ITFFRQVAALCECPDLLDNPLAPKLFAQDAIDRAREYIKAI-GSVGAYSHSKGVPLIRQY  216

Query  462  VAXFIGRRDG  491
            VA F+  RDG
Sbjct  217  VADFLEERDG  226



>ref|XP_007409910.1| hypothetical protein MELLADRAFT_43385 [Melampsora larici-populina 
98AG31]
 gb|EGG06950.1| hypothetical protein MELLADRAFT_43385 [Melampsora larici-populina 
98AG31]
Length=484

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 80/133 (60%), Gaps = 13/133 (10%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKE------------GKKIIFTNVGNPHALG  272
            PL  +N+N  V + QYAVRGE+ LRA EL+ E               +I  N+GNP  LG
Sbjct  6    PLSIDNINPAVVEAQYAVRGEIALRAEELRNELASDPQAKDRLGFNNVISCNIGNPQQLG  65

Query  273  QKPLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGV  452
            QKPL+F RQV  L + P L+ +P+   +FP+D I RA Q L    G +GAYS S+G+P +
Sbjct  66   QKPLSFTRQVACLTEYPDLIKNPDAKSLFPSDVIERA-QLLLGAIGSVGAYSHSKGVPLI  124

Query  453  RKEVAXFIGRRDG  491
            R+ VA F+  RDG
Sbjct  125  RQHVAEFLQERDG  137



>gb|EGU11111.1| putative Alanine aminotransferase [Rhodotorula glutinis ATCC 
204091]
Length=509

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 82/131 (63%), Gaps = 12/131 (9%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASEL----QKEGK-------KIIFTNVGNPHALGQK  278
            L  E +N++V + QYAVRG + LRA EL    +++GK        ++  N+GNP  L QK
Sbjct  34   LTNERMNKHVLEAQYAVRGAIPLRAEELREQLEEKGKDAGLPFDTVVNCNIGNPQQLDQK  93

Query  279  PLTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRK  458
            PLTF RQV AL + P LLD P+   +FP+DAI RA+  L    G +GAYS S G+P +R+
Sbjct  94   PLTFLRQVSALTEYPDLLDHPSTSSIFPSDAIERARSLLKEI-GSVGAYSHSMGVPAIRQ  152

Query  459  EVAXFIGRRDG  491
             VA FI  RDG
Sbjct  153  RVAQFIENRDG  163



>gb|ADB91976.1| alanine aminotransferase [Branchiostoma belcheri]
Length=500

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 86/129 (67%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  287
            L  +++N  VKK +YAVRG +  RA+EL+KE         K++I  N+G+ HA+GQKP+T
Sbjct  26   LTIDSMNPLVKKVEYAVRGPIVARATELEKELERGVPKPFKQVIKANIGDAHAMGQKPIT  85

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAYSDSRGIPGVRKEV  464
            F RQVI+LC  P LLD+ +    FPADA  RA++ L    GG LG+YSDS G+  +RK +
Sbjct  86   FLRQVISLCVNPDLLDNES----FPADARERARRILQGCKGGSLGSYSDSVGVEVIRKGI  141

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  142  AAYIERRDG  150



>gb|AIT69923.1| alanine transaminase [Dictyopteris undulata]
Length=498

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 11/128 (9%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPLT  287
            LD   +N NVK  QYAVRG +  R+ EL++    G+K+ F      N+GNPHA  Q PL+
Sbjct  21   LDGATINPNVKAAQYAVRGNVLERSMELERRMTAGEKLPFDKFVPCNIGNPHACLQSPLS  80

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVA  467
            F R+V+ALC +P L   PN    F +D + RA ++ +  +GG+GAYS+S+GI  VR+EVA
Sbjct  81   FHREVLALCMSPSLAKHPNT---FKSDVVERANRYTATLNGGVGAYSNSQGIQSVREEVA  137

Query  468  XFIGRRDG  491
             +I  RDG
Sbjct  138  AYITERDG  145



>ref|XP_455940.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAG98648.1| KLLA0F19162p [Kluyveromyces lactis]
Length=528

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 85/130 (65%), Gaps = 11/130 (8%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPL  284
            L  +++NENV K +YAVRG + +RA EL+ + KK         II  N+GNP  L QKPL
Sbjct  49   LSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPL  108

Query  285  TFPRQVIALCQAPFLLDDPNVGL--VFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRK  458
            TF R+V++L Q P LL++ +  L  ++  D+I RAK+ LS   G +GAYS S+G+ G+R+
Sbjct  109  TFYREVLSLLQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRE  168

Query  459  EVAXFIGRRD  488
             VA FI +RD
Sbjct  169  TVADFITKRD  178



>ref|XP_010937250.1| PREDICTED: alanine aminotransferase 2 [Elaeis guineensis]
Length=526

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 81/131 (62%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+  +++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +L Q+P
Sbjct  48   PVTLDSINPKVIKCEYAVRGEIVSHAQRLQQELQTKPGAHPFDEILYCNIGNPQSLAQQP  107

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P +LD      +F ADAIARA Q L +  G   GAYS S+GI G+R 
Sbjct  108  ITFFREVLALCDHPSILDKSETHALFSADAIARAWQILDLIPGRATGAYSHSQGIKGLRD  167

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  168  AIAAGIAARDG  178



>ref|XP_002430215.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
 gb|EEB17477.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
Length=482

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 82/124 (66%), Gaps = 13/124 (10%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLTFPRQV  302
            +N+N+K  +YAVRG L +RA EL+K+         KK+I  N+G+ HA+GQKPLTF RQV
Sbjct  1    MNKNIKTMEYAVRGPLLVRAIELEKQLEAGEKKPFKKVIKANLGDAHAMGQKPLTFYRQV  60

Query  303  IALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAYSDSRGIPGVRKEVAXFIG  479
            +AL   P LL D +    FP+D I RA++ LS   GG +G+YS+S GI  +RK VA FI 
Sbjct  61   LALVSYPELLKDSS----FPSDTICRAEELLSACKGGSVGSYSESFGIEIIRKHVAEFIC  116

Query  480  RRDG  491
             RDG
Sbjct  117  NRDG  120



>gb|EEE67593.1| hypothetical protein OsJ_25140 [Oryza sativa Japonica Group]
Length=546

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  281
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  68   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPDSLPFDEILYCNIGNPQSLGQQP  127

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V++LC  P LLD      ++ +DAI RA Q L    G   GAYS S+GI G+R 
Sbjct  128  VTFFREVLSLCDHPALLDKSETHALYSSDAIERAWQILDKIPGRATGAYSHSQGIKGLRD  187

Query  459  EVAXFIGRRDG  491
            E+A  I  RDG
Sbjct  188  EIAAGIAARDG  198



>gb|EEC82447.1| hypothetical protein OsI_26881 [Oryza sativa Indica Group]
Length=546

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  281
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  68   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPDSLPFDEILYCNIGNPQSLGQQP  127

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V++LC  P LLD      ++ +DAI RA Q L    G   GAYS S+GI G+R 
Sbjct  128  VTFFREVLSLCDHPALLDKSETHALYSSDAIERAWQILDKIPGRATGAYSHSQGIKGLRD  187

Query  459  EVAXFIGRRDG  491
            E+A  I  RDG
Sbjct  188  EIAAGIAARDG  198



>ref|XP_002492709.1| Putative alanine transaminase (glutamic pyruvic transaminase) 
[Komagataella pastoris GS115]
 emb|CAY70530.1| Putative alanine transaminase (glutamic pyruvic transaminase) 
[Komagataella pastoris GS115]
 emb|CCA39682.1| alanine transaminase [Komagataella pastoris CBS 7435]
Length=510

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 78/129 (60%), Gaps = 10/129 (8%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  284
            L   +LN +    +YAVRG++  +A  L+ +           KII  N+GNP  L QKPL
Sbjct  35   LTVTDLNPHTVNAKYAVRGKIPTKAELLRNQLNDVDHKLPFTKIISANIGNPQQLDQKPL  94

Query  285  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  464
            TF RQ++AL Q P LLDDP V  +FP D I RA+  L    G +GAYS S+G+P +R+ +
Sbjct  95   TFYRQILALLQYPPLLDDPRVASIFPKDIIERARSLLKQI-GSVGAYSQSQGVPSIRQSI  153

Query  465  AXFIGRRDG  491
            A FI RRDG
Sbjct  154  ADFISRRDG  162



>ref|XP_008460349.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X3 [Cucumis melo]
 ref|XP_008460350.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X4 [Cucumis melo]
 ref|XP_008460351.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X5 [Cucumis melo]
Length=436

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  52   PLSVATINDKVLKCEYAVRGEIVTLAQKLQEELSAKPGLHPFDEILYCNIGNPQSLGQQP  111

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P +LD      +F  DAIARA Q L    G   GAYS S+GI G+R 
Sbjct  112  ITFFREVLALCDHPAILDRSETQGLFSTDAIARAWQILDQIPGRATGAYSHSQGIKGLRD  171

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  172  TIAAGIEERDG  182



>gb|AGE89227.1| mitochondrial alanine aminotransferase, partial [Dicentrarchus 
labrax]
Length=154

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 82/129 (64%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  + +N  VKK +YAVRG +  RA EL++E  +        +I  N+G+ HA+GQ+P+T
Sbjct  21   LTIDTMNPTVKKVEYAVRGPIVQRAVELERELSEGIKKPFAEVIKANIGDAHAMGQQPIT  80

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LL+D      FP DA +RA++ L    G  +G+YS S+GI  VR++V
Sbjct  81   FFRQVLALCSYPELLNDS----TFPEDAKSRARRILQSCGGNSMGSYSASQGIDSVRQDV  136

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  137  ARYIERRDG  145



>ref|XP_006649511.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=482

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 84/127 (66%), Gaps = 10/127 (8%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  293
            EN+N  V +C+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQKP+TF 
Sbjct  8    ENINPKVLRCEYAVRGEISIHAQHLQQQLQAQPGSLPFDEILYCNIGNPQSLGQKPITFF  67

Query  294  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAX  470
            R+V+ALC  P LLD   +  +F ADAIARAK+ L++  G   GAYS S+GI G+R E+A 
Sbjct  68   REVLALCDHPKLLDREEIKSLFSADAIARAKKILALIPGRATGAYSHSQGIKGLRDEIAA  127

Query  471  FIGRRDG  491
             I  RDG
Sbjct  128  GIASRDG  134



>ref|XP_003646187.1| hypothetical protein Ecym_4307 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET39370.1| hypothetical protein Ecym_4307 [Eremothecium cymbalariae DBVPG#7215]
Length=534

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 85/132 (64%), Gaps = 11/132 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  281
            PL  E+LN NV + +YAVRG++  RA EL+++          KKII+ N+GNP  LGQKP
Sbjct  55   PLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKP  114

Query  282  LTFPRQVIALCQAPFLLDDPN--VGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVR  455
            L+F R+V++L ++P LL  P   + L++  DA+ RAK+ +      +GAYS S+G+ G R
Sbjct  115  LSFSREVLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFR  174

Query  456  KEVAXFIGRRDG  491
            K VA ++  RDG
Sbjct  175  KTVAEYLSSRDG  186



>gb|AGT60040.1| aminotransferase [uncultured bacterium]
Length=462

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  311
            + + NLN+ +   +YAVRG++  RA EL+K GKKI + N+GNPHA  QKPL++ R+V++L
Sbjct  2    ITFNNLNQKLIDAEYAVRGKIVTRAQELEKTGKKITYCNIGNPHAFAQKPLSYVREVLSL  61

Query  312  CQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
             + P LL+     L F +D+I RA+  L     G+GAYS S G+  VR+ VA FI  RD 
Sbjct  62   LEFPDLLERDLTNL-FHSDSIERARYILRQIPEGVGAYSASAGVEFVREAVAKFIATRDN  120



>ref|XP_006775215.1| PREDICTED: alanine aminotransferase 1 [Myotis davidii]
Length=307

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 82/129 (64%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  + +N  VK+ +YAVRG + LRA EL++E ++        +I  N+G+ HA+GQKP+T
Sbjct  21   LTLDTMNACVKRVEYAVRGPIVLRALELEQELRQGVKKPFTEVIHANIGDAHAMGQKPIT  80

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LL+ P+    FP DA  RA+  L    G  LGAYS+S GI  +R+ V
Sbjct  81   FLRQVLALCVHPDLLNSPD----FPEDAKRRAENILQACRGHSLGAYSNSSGIQPIREHV  136

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  137  AQYIQRRDG  145



>ref|XP_005838227.1| hypothetical protein GUITHDRAFT_103164 [Guillardia theta CCMP2712]
 gb|EKX51247.1| hypothetical protein GUITHDRAFT_103164 [Guillardia theta CCMP2712]
Length=483

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 78/127 (61%), Gaps = 8/127 (6%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E +N  V   QYA+RG L LRA + ++  K+        II+ N+GNP  L QKP+T
Sbjct  13   LTAETINPKVLDAQYAIRGALVLRAMQHERNLKESVRMPFDEIIYCNIGNPQQLNQKPIT  72

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVA  467
            F RQV+AL   P L++ P    +FP DAI RA+ F S   GG GAYS+S+GI  VR+ VA
Sbjct  73   FFRQVLALMDYPDLVEMPKAKKLFPEDAIERARMFFSNIPGGTGAYSESQGIRLVREHVA  132

Query  468  XFIGRRD  488
             +I +RD
Sbjct  133  EYISKRD  139



>gb|AIT69919.1| alanine transaminase [Sargassum vachellianum]
Length=500

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 12/130 (9%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEG--------KKIIFTNVGNPHALGQKPL  284
            PLD  ++N NV+  +YAVRG +  R+ ELQ+          KK +  N+GNPHAL Q PL
Sbjct  20   PLDATSINANVRAAEYAVRGNVLERSMELQRRMAAGEMLPFKKFVPCNIGNPHALLQLPL  79

Query  285  TFPRQVIALCQAPFLLDD-PNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +F R V+ALC +P L +D P+    F  DA+ RA+++ +   GG+G+Y++S+GI  VR+E
Sbjct  80   SFHRDVLALCISPHLANDHPST---FNTDAVERAQKYATDMGGGVGSYTNSQGILAVREE  136

Query  462  VAXFIGRRDG  491
            +A FI  RDG
Sbjct  137  IAAFIAERDG  146



>ref|XP_002304255.2| hypothetical protein POPTR_0003s07020g [Populus trichocarpa]
 gb|EEE79234.2| hypothetical protein POPTR_0003s07020g [Populus trichocarpa]
Length=481

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+  +N+N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  3    PVSLDNINPKVLKCEYAVRGEIVTLAQALQEELKSKPGSHPFDEILYCNIGNPQSLGQQP  62

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R 
Sbjct  63   ITFFREVLALCDHPSILDRSETQGLFSADAIERAWQILDQIPGRATGAYSHSQGIKGLRD  122

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  123  TIAAGIEARDG  133



>gb|AIT69916.1| alanine transaminase [Sargassum henslowianum]
Length=501

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 12/130 (9%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEG--------KKIIFTNVGNPHALGQKPL  284
            PLD  ++N NV+  +YAVRG +  R+ ELQ+          KK +  N+GNPHAL Q PL
Sbjct  21   PLDATSINANVRAAEYAVRGNVLERSMELQRRMAAGEMLPFKKFVPCNIGNPHALLQLPL  80

Query  285  TFPRQVIALCQAPFLLDD-PNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +F R V+ALC +P L +D P+    F  DA+ RA+++ +   GG+G+Y++S+GI  VR+E
Sbjct  81   SFHRDVLALCISPHLANDHPST---FNTDAVERAQKYATDMGGGVGSYTNSQGILAVREE  137

Query  462  VAXFIGRRDG  491
            +A FI  RDG
Sbjct  138  IAAFIAERDG  147



>ref|XP_008869166.1| hypothetical protein H310_06043 [Aphanomyces invadans]
 gb|ETW02561.1| hypothetical protein H310_06043 [Aphanomyces invadans]
Length=486

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 79/128 (62%), Gaps = 8/128 (6%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPLT  287
            L  + +N  V + +YAVRG L L++ ELQK           KII  N+GNP +LGQKP+ 
Sbjct  15   LTKKTINPRVVEAEYAVRGPLVLKSIELQKRLSAGEKLPFDKIISCNIGNPQSLGQKPIQ  74

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVA  467
            F R+V+AL   P L+D P+   +F  DAIARAK++L    GG GAY  S+G   VR+EVA
Sbjct  75   FHREVLALVNMPGLVDHPSAPSIFKPDAIARAKRYLQRIPGGTGAYGHSKGADVVREEVA  134

Query  468  XFIGRRDG  491
             F+  RDG
Sbjct  135  QFLYERDG  142



>ref|XP_005865158.1| PREDICTED: alanine aminotransferase 1 [Myotis brandtii]
Length=265

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 82/129 (64%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  + +N  VK+ +YAVRG + LRA EL++E ++        +I  N+G+ HA+GQKP+T
Sbjct  21   LTLDTMNACVKRVEYAVRGPIVLRALELEQELRQGVKKPFTEVIRANIGDAHAMGQKPIT  80

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LL+ P+    FP DA  RA+  L    G  LGAYS+S GI  +R+ V
Sbjct  81   FLRQVLALCVHPDLLNSPD----FPEDAKRRAESILQACGGHSLGAYSNSSGIQPIREHV  136

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  137  AQYIQRRDG  145



>gb|KFO69634.1| Alanine aminotransferase 2, partial [Cuculus canorus]
Length=482

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E++N  VK  +YAVRG + L+A E++KE ++        +I  N+G+ HA+GQ+P+T
Sbjct  7    LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRRGIKKPFTEVIKANIGDAHAMGQRPIT  66

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LLD P+    FP DA  RAK+ L    G  LG+YS S+GI  +R++V
Sbjct  67   FLRQVVALCTYPNLLDSPS----FPEDAKKRAKRILQGCGGNSLGSYSASQGINCIREDV  122

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  123  ASYIERRDG  131



>ref|XP_009382959.1| PREDICTED: alanine aminotransferase 2 [Musa acuminata subsp. 
malaccensis]
Length=522

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 79/127 (62%), Gaps = 10/127 (8%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  293
            + +N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P+TF 
Sbjct  48   DTINPKVLKCEYAVRGEIVSHAQRLQQELQDKPGSHPFDEILYCNIGNPQSLGQQPVTFF  107

Query  294  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAX  470
            R+V+ALC  P LLD      +F ADAIARA Q L +  G   GAYS S+GI G+R  +A 
Sbjct  108  REVLALCDHPSLLDKSETHALFSADAIARAWQILDVIPGRATGAYSHSQGIKGLRDAIAA  167

Query  471  FIGRRDG  491
             I  RDG
Sbjct  168  GIADRDG  174



>emb|CBN81871.1| Alanine aminotransferase 2-like [Dicentrarchus labrax]
Length=491

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  +N+N NVK+ +YAVRG +  RA +++KE K+        +I  N+G+ HA+GQKP+T
Sbjct  16   LTLDNMNPNVKRVEYAVRGPIVQRAVQIEKELKEGVKKPFSEVIKANIGDAHAMGQKPIT  75

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LL+D      FP DA  RAK+ L    G  +GAYS S+GI  VR++V
Sbjct  76   FLRQVLALCSYPELLEDNK----FPEDAKKRAKRILQACGGHSIGAYSASQGIECVRQDV  131

Query  465  AXFIGRRDG  491
            A +I +RDG
Sbjct  132  ARYIEKRDG  140



>gb|ACJ85860.1| unknown [Medicago truncatula]
Length=524

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 79/131 (60%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+  +N+N  V KCQYAVRGE+   A  LQK  +         +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P LLD      +F AD+I RA Q +    G   GAYS S+GI G+R 
Sbjct  106  ITFFREVLALCDYPALLDKSETQGLFSADSIERAWQLVDQIPGRATGAYSHSQGIQGLRD  165

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  166  TIAAGIEERDG  176



>gb|EPB88721.1| alanine transaminase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=512

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 81/132 (61%), Gaps = 13/132 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPL  284
            L  E ++  VK  +YAVRG L +RA  L ++ KK         ++F N+GNP  L QKP+
Sbjct  33   LTTETMHPLVKSVEYAVRGALPIRAEALSQQLKKDPSKLNFDRVVFCNIGNPQQLNQKPI  92

Query  285  TFPRQVIALCQAPFLLDDPNVGLV---FPADAIARAKQFLSMTSGGLGAYSDSRGIPGVR  455
            TF RQV +LC+ P LL   N  LV   +PADAIARA Q L    G +GAYS S+GI  +R
Sbjct  93   TFFRQVASLCENPELLKTENRALVSKLYPADAIARA-QVLLKNIGSVGAYSHSKGITHIR  151

Query  456  KEVAXFIGRRDG  491
            + VA FI RRDG
Sbjct  152  ENVAKFIERRDG  163



>dbj|GAN09782.1| alanine transaminase [Mucor ambiguus]
Length=512

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 81/132 (61%), Gaps = 13/132 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPL  284
            L  E ++  VK  +YAVRG L +RA  L ++ KK         ++F N+GNP  L QKP+
Sbjct  33   LTTETMHPLVKSVEYAVRGALPIRAEALSQQLKKDPSKLNFDRVVFCNIGNPQQLNQKPI  92

Query  285  TFPRQVIALCQAPFLLDDPNVGLV---FPADAIARAKQFLSMTSGGLGAYSDSRGIPGVR  455
            TF RQV +LC+ P LL   N  LV   +PADAIARA Q L    G +GAYS S+GI  +R
Sbjct  93   TFFRQVASLCENPELLKTENRALVSKLYPADAIARA-QVLLKNIGSVGAYSHSKGITHIR  151

Query  456  KEVAXFIGRRDG  491
            + VA FI RRDG
Sbjct  152  ENVAKFIERRDG  163



>ref|XP_008460347.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Cucumis 
melo]
Length=530

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  52   PLSVATINDKVLKCEYAVRGEIVTLAQKLQEELSAKPGLHPFDEILYCNIGNPQSLGQQP  111

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P +LD      +F  DAIARA Q L    G   GAYS S+GI G+R 
Sbjct  112  ITFFREVLALCDHPAILDRSETQGLFSTDAIARAWQILDQIPGRATGAYSHSQGIKGLRD  171

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  172  TIAAGIEERDG  182



>ref|XP_004510570.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cicer 
arietinum]
Length=531

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+  +N+N  V +CQYAVRGE+   A  LQK+ +         +II+ N+GNP +LGQ+P
Sbjct  53   PVTAQNINPQVLQCQYAVRGEIVTLAQNLQKDLQANPGSHSFDEIIYCNIGNPQSLGQQP  112

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P LLD      +F AD+I RA Q +    G   GAYS S+GI G+R 
Sbjct  113  ITFFREVLALCDYPALLDKSETQGLFSADSIERAWQIVEQIPGRATGAYSHSQGIQGLRD  172

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  173  TIAAGIQERDG  183



>ref|XP_009041360.1| hypothetical protein AURANDRAFT_67623 [Aureococcus anophagefferens]
 gb|EGB03935.1| hypothetical protein AURANDRAFT_67623 [Aureococcus anophagefferens]
Length=1156

 Score =   112 bits (279),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 57/121 (47%), Positives = 86/121 (71%), Gaps = 7/121 (6%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEG----KKIIFTNVGNPHALGQKPLTFPRQ  299
            ++  N+++ ++K QYAVRGE+ ++A  L++EG    K+I++TNVGNPH++GQKPLTF RQ
Sbjct  146  INASNMSQALRKMQYAVRGEVVMKADALEQEGREQRKEILYTNVGNPHSVGQKPLTFFRQ  205

Query  300  VIALCQAP--FLLDDPNVGLVFPADAIARAKQF-LSMTSGGLGAYSDSRGIPGVRKEVAX  470
            V+ALC  P    +D PN   +FPADAIARA+    ++   G G+Y++S+GI   R +VA 
Sbjct  206  VLALCDLPAEHGVDHPNASAMFPADAIARARDMRAAIGDAGTGSYTNSQGIAQFRGDVAR  265

Query  471  F  473
            +
Sbjct  266  Y  266



>ref|XP_003573850.1| PREDICTED: alanine aminotransferase 2 [Brachypodium distachyon]
Length=481

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 83/127 (65%), Gaps = 10/127 (8%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  293
            ENLN  V KC+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQNQPGSLPFHEILYCNIGNPQSLGQQPVTFF  67

Query  294  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAX  470
            R+V+ALC  P+LL    +  +F AD+I+RAKQ L++  G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPYLLQREEIKSLFSADSISRAKQILALIPGRATGAYSHSQGIKGLRDAIAA  127

Query  471  FIGRRDG  491
             I  RDG
Sbjct  128  GITARDG  134



>gb|KFW64540.1| Alanine aminotransferase 2, partial [Pygoscelis adeliae]
Length=539

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  64   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  123

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+YS S+GI  +R++V
Sbjct  124  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSYSASQGINCIREDV  179

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  180  ASYIERRDG  188



>gb|AFK39904.1| unknown [Medicago truncatula]
Length=524

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 79/131 (60%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+  +N+N  V KCQYAVRGE+   A  LQK  +         +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P LLD      +F AD+I RA Q +    G   GAYS S+GI G+R 
Sbjct  106  ITFFREVLALCDYPALLDKSETQGLFSADSIERAWQLVDQIPGRATGAYSHSQGIQGLRD  165

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  166  TIAAGIEERDG  176



>ref|XP_003627448.1| Alanine aminotransferase [Medicago truncatula]
 gb|AET01924.1| alanine aminotransferase [Medicago truncatula]
Length=524

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 79/131 (60%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+  +N+N  V KCQYAVRGE+   A  LQK  +         +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P LLD      +F AD+I RA Q +    G   GAYS S+GI G+R 
Sbjct  106  ITFFREVLALCDYPALLDKSETQGLFSADSIERAWQIVDQIPGRATGAYSHSQGIQGLRD  165

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  166  TIAAGIEERDG  176



>emb|CDO96247.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=528

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 83/130 (64%), Gaps = 11/130 (8%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPL  284
            L  E++NENV K +YAVRG + +RA EL++  +         KII  N+GNP  L QKPL
Sbjct  49   LSLEDVNENVLKAKYAVRGRIPMRAEELKETLRTDPKSLPFSKIISANIGNPQQLDQKPL  108

Query  285  TFPRQVIALCQAPFLLDDPNVGL--VFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRK  458
            TF R+V++L Q P LL++ +  L  ++  DAI RA+  L+   G +GAYS S+G+ G+R+
Sbjct  109  TFYREVLSLLQHPELLEETDATLQTLYKIDAIQRARHLLAKVGGSVGAYSQSQGVQGIRE  168

Query  459  EVAXFIGRRD  488
             VA FI  RD
Sbjct  169  TVAQFITNRD  178



>sp|P34106.1|ALA2_PANMI RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Panicum miliaceum]
 emb|CAA49199.1| alanine aminotransferase [Panicum miliaceum]
Length=482

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 81/127 (64%), Gaps = 10/127 (8%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  293
            ENLN  V KC+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQHLQQQLQTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  294  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAX  470
            R+V+ALC  P LL+      +F ADAI+RAKQ LS   G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPCLLEKEETKSLFSADAISRAKQILSTIPGRATGAYSHSQGIKGLRDAIAA  127

Query  471  FIGRRDG  491
             I  RDG
Sbjct  128  GIASRDG  134



>gb|KFQ95766.1| Alanine aminotransferase 2, partial [Nipponia nippon]
Length=539

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  64   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  123

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+YS S+GI  +R++V
Sbjct  124  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSYSASQGINCIREDV  179

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  180  ASYIERRDG  188



>gb|KFM05788.1| Alanine aminotransferase 2, partial [Aptenodytes forsteri]
Length=539

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  64   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  123

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+YS S+GI  +R++V
Sbjct  124  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSYSASQGINCIREDV  179

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  180  ASYIERRDG  188



>dbj|BAF93199.1| putative alanine aminotransferase [Hordeum vulgare]
Length=55

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  285  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPG  449
            TFPRQV+ALCQAPFLLDDPNV L+FPADAIARAK +LS+  GGLGAYSDSRGIPG
Sbjct  1    TFPRQVVALCQAPFLLDDPNVCLIFPADAIARAKHYLSLAPGGLGAYSDSRGIPG  55



>ref|XP_004144444.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=528

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  50   PLSIATINDKVLKCEYAVRGEIVTLAQKLQEELSVKPGSHPFDEILYCNIGNPQSLGQQP  109

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P +LD      +F  DAIARA Q L    G   GAYS S+GI G+R 
Sbjct  110  ITFFREVLALCDHPAILDKSETQGLFSTDAIARAWQILDQIPGRATGAYSHSQGIKGLRD  169

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  170  TIAAGIEARDG  180



>ref|XP_004212634.1| PREDICTED: uncharacterized protein LOC101238311 [Hydra vulgaris]
Length=348

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 79/122 (65%), Gaps = 12/122 (10%)
 Frame = +3

Query  150  NENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPLTFPRQVI  305
            N+ VK+ +YAVRG + ++A+EL KE K        KII  N+G+ HA+GQKP+TF RQ++
Sbjct  207  NDYVKQVEYAVRGPIVIKAAELDKELKEGKKHPFEKIIKANIGDCHAMGQKPITFIRQLL  266

Query  306  ALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRR  485
            A C  P L+ +     +FP+D  +RAK+ LS  +   G YSDS G+  VRK++A FI  R
Sbjct  267  AACSYPPLIKEN----IFPSDVNSRAKEILSTINESTGCYSDSAGLAVVRKDIAKFISNR  322

Query  486  DG  491
            DG
Sbjct  323  DG  324



>gb|KGN58474.1| hypothetical protein Csa_3G646610 [Cucumis sativus]
Length=535

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  57   PLSIATINDKVLKCEYAVRGEIVTLAQKLQEELSVKPGSHPFDEILYCNIGNPQSLGQQP  116

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P +LD      +F  DAIARA Q L    G   GAYS S+GI G+R 
Sbjct  117  ITFFREVLALCDHPAILDKSETQGLFSTDAIARAWQILDQIPGRATGAYSHSQGIKGLRD  176

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  177  TIAAGIEARDG  187



>ref|XP_004983099.1| PREDICTED: alanine aminotransferase 2-like [Setaria italica]
Length=482

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 82/127 (65%), Gaps = 10/127 (8%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  293
            ENLN  V KC+YAVRGE+ + A  LQ++           +I++ N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQNQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  294  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAX  470
            R+V+ALC  P LL+   +  +F ADAI+RAKQ L+   G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPCLLEKEEIKSLFSADAISRAKQILATIPGRATGAYSHSQGIKGLRDAIAA  127

Query  471  FIGRRDG  491
             I  RDG
Sbjct  128  GIASRDG  134



>ref|XP_002295840.1| alanine aminotransferase, aminotransferase class I [Thalassiosira 
pseudonana CCMP1335]
 gb|ACI64557.1| alanine aminotransferase, aminotransferase class I [Thalassiosira 
pseudonana CCMP1335]
Length=485

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 85/133 (64%), Gaps = 13/133 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK----------IIFTNVGNPHALGQKP  281
            L  + +++N+K  +YAVRG++ + A  + +E K           II TN+GNPHA+ QK 
Sbjct  3    LSIDTISDNLKAMEYAVRGKIAIEADRITEELKSSTDNKYPFDHIIMTNIGNPHAVQQKA  62

Query  282  LTFPRQVIALCQA--PFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGV  452
            LT+PRQV+AL Q   P  +D P+   +FP DAIARAK+  +   G G+GAY+ S+G+   
Sbjct  63   LTWPRQVMALLQLPDPLGIDHPSANALFPEDAIARAKEMKAALGGHGIGAYTHSKGVKEF  122

Query  453  RKEVAXFIGRRDG  491
            R++VA FI +RDG
Sbjct  123  REDVARFIEKRDG  135



>ref|XP_008653343.1| PREDICTED: alanine aminotransferase 2 [Zea mays]
Length=541

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 79/131 (60%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  281
            P+    +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  63   PVSVATINPKVLKCEYAVRGEIVTHAQNLQQELQKNPESLPFDEILYCNIGNPQSLGQQP  122

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +T+ R+V++LC  P LLD      ++ +DAI RA Q L    G   GAYS S+GI G+R 
Sbjct  123  VTYFREVLSLCDHPALLDKSETHALYSSDAIERAWQILEKIPGRATGAYSHSQGIKGLRD  182

Query  459  EVAXFIGRRDG  491
            E+A  I  RDG
Sbjct  183  EIAAGIAARDG  193



>gb|ETK83887.1| hypothetical protein L915_11052, partial [Phytophthora parasitica]
Length=169

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 76/129 (59%), Gaps = 9/129 (7%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  284
            L  + +N N+ K +YAVRG L LR++E +             K+I  N+GNP  L Q+P+
Sbjct  24   LTADTINPNIVKAEYAVRGALVLRSNEYENRLANGDKSLPFDKVIPCNIGNPQVLEQEPI  83

Query  285  TFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEV  464
             F RQV+AL   P L+D P    +F  DAIARAK ++    GG GAY  S+G   VR+EV
Sbjct  84   EFQRQVLALVNVPGLVDQPEAQKLFQPDAIARAKFYIDNIPGGTGAYGHSKGSAVVREEV  143

Query  465  AXFIGRRDG  491
            A F+ RRDG
Sbjct  144  ARFLQRRDG  152



>ref|XP_008499534.1| PREDICTED: alanine aminotransferase 2 [Calypte anna]
Length=486

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  11   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  70

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+Y+ S+GI  +R++V
Sbjct  71   FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQDCGGNSLGSYTASQGINCIREDV  126

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  127  ASYIQRRDG  135



>ref|XP_008654837.1| PREDICTED: uncharacterized protein LOC100193705 isoform X1 [Zea 
mays]
Length=482

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 81/127 (64%), Gaps = 10/127 (8%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  293
            ENLN  V KC+YAVRGE+ + A  LQ++           +I+F N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILFCNIGNPQSLGQQPVTFF  67

Query  294  RQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEVAX  470
            R+V+ALC  P LL+      +F ADAI+RAKQ L+   G   GAYS S+GI G+R  +A 
Sbjct  68   REVLALCDHPCLLEKEETKSLFSADAISRAKQILATIPGRATGAYSHSQGIKGLRDAIAA  127

Query  471  FIGRRDG  491
             I  RDG
Sbjct  128  GITSRDG  134



>ref|XP_009389580.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=487

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  281
            P+  + +N  V KCQYAVRG +   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  9    PVSIDTINPKVLKCQYAVRGAIVSHAQRLQQELQTSQGSLPFDEILYCNIGNPQSLGQQP  68

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P LL   N+  +F  DAI RA++ L +  G   GAYS S+GI G+R 
Sbjct  69   ITFFREVLALCDHPALLGKSNIDALFSKDAIGRAQKILDLIPGRATGAYSHSQGIKGLRD  128

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  129  AIAAGIAIRDG  139



>ref|XP_004664888.1| PREDICTED: alanine aminotransferase 2 [Jaculus jaculus]
Length=522

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 83/129 (64%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E++N  VK  +YAVRG + L+A E++ E ++        +I  N+G+ HA+GQ+P+T
Sbjct  48   LTLESMNPQVKAVEYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPIT  107

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LLD PN    FP DA  RA++ L    G  LG+YS S+G+  +R++V
Sbjct  108  FLRQVMALCTYPNLLDSPN----FPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDV  163

Query  465  AXFIGRRDG  491
            A FI RRDG
Sbjct  164  AAFITRRDG  172



>gb|AIT69930.1| alanine transaminase [Sargassum hemiphyllum var. chinense]
Length=501

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 83/130 (64%), Gaps = 12/130 (9%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEG--------KKIIFTNVGNPHALGQKPL  284
            PLD  ++N NV+  +YAVRG +  R+ ELQ+          KK +  N+GNPHAL Q PL
Sbjct  21   PLDATSINANVRAAEYAVRGNVLERSMELQRRMAAGEMLPFKKFVPCNIGNPHALLQLPL  80

Query  285  TFPRQVIALCQAPFL-LDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +F R V+ALC +P L  D P+    F  DA+ RA+++ +   GG+G+Y++S+GI  VR+E
Sbjct  81   SFHRDVLALCISPHLATDHPSA---FNPDAVERAQKYATGMGGGVGSYTNSQGILAVREE  137

Query  462  VAXFIGRRDG  491
            +A FI  RDG
Sbjct  138  IAAFIAERDG  147



>gb|AIT69931.1| alanine transaminase [Sargassum thunbergii]
Length=501

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 83/130 (64%), Gaps = 12/130 (9%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEG--------KKIIFTNVGNPHALGQKPL  284
            PLD  ++N NV+  +YAVRG +  R+ ELQ+          KK +  N+GNPHAL Q PL
Sbjct  21   PLDATSINANVRAAEYAVRGNVLERSMELQRRMAAGEMLPFKKFVPCNIGNPHALLQLPL  80

Query  285  TFPRQVIALCQAPFL-LDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +F R V+ALC +P L  D P+    F  DA+ RA+++ +   GG+G+Y++S+GI  VR+E
Sbjct  81   SFHRDVLALCISPHLATDHPSA---FNPDAVERAQKYATGMGGGVGSYTNSQGILAVREE  137

Query  462  VAXFIGRRDG  491
            +A FI  RDG
Sbjct  138  IAAFIAERDG  147



>gb|AIT69922.1| alanine transaminase [Sargassum fusiforme]
Length=501

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 83/130 (64%), Gaps = 12/130 (9%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEG--------KKIIFTNVGNPHALGQKPL  284
            PLD  ++N NV+  +YAVRG +  R+ ELQ+          KK +  N+GNPHAL Q PL
Sbjct  21   PLDATSINANVRAAEYAVRGNVLERSMELQRRMAAGEMLPFKKFVPCNIGNPHALLQLPL  80

Query  285  TFPRQVIALCQAPFL-LDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +F R V+ALC +P L  D P+    F  DA+ RA+++ +   GG+G+Y++S+GI  VR+E
Sbjct  81   SFHRDVLALCISPHLATDHPSA---FNPDAVERAQKYATGMGGGVGSYTNSQGILAVREE  137

Query  462  VAXFIGRRDG  491
            +A FI  RDG
Sbjct  138  IAAFIAERDG  147



>ref|XP_008436808.1| PREDICTED: alanine aminotransferase 1 [Poecilia reticulata]
Length=491

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  EN+N NVK+ +YAVRG +  RA +++KE ++        +I  N+G+ HA+GQ+P+T
Sbjct  16   LTVENMNPNVKRVEYAVRGPIVQRAVQIEKELREGVKKPFTEVIKANIGDAHAMGQRPIT  75

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LL+D      FP DA  RA++ L    G  +GAYS S+GI  +R++V
Sbjct  76   FFRQVLALCSYPELLEDNK----FPEDAKQRARRILDACGGHSIGAYSASQGIECIRQDV  131

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  132  AHYIERRDG  140



>ref|XP_005052721.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Ficedula albicollis]
 ref|XP_005052722.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Ficedula albicollis]
Length=549

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  74   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  133

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+Y+ S+GI  +R++V
Sbjct  134  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSYTASQGINCIREDV  189

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  190  ASYIERRDG  198



>ref|XP_002289904.1| alanine aminotransferase [Thalassiosira pseudonana CCMP1335]
 gb|EED93441.1| alanine aminotransferase [Thalassiosira pseudonana CCMP1335]
Length=444

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 75/109 (69%), Gaps = 3/109 (3%)
 Frame = +3

Query  171  QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPFL--LDDPN  344
            QYAVRGE+ +RA  +  EG+KII+TN+GNPHA+GQKP+T+ RQV++LC  P    +D+  
Sbjct  2    QYAVRGEVVIRADAMAAEGRKIIYTNIGNPHAVGQKPITYYRQVLSLCDLPAECGVDNTQ  61

Query  345  VGLVFPADAIARAKQFL-SMTSGGLGAYSDSRGIPGVRKEVAXFIGRRD  488
            V   FP+D I RA +   ++   G GAY++S+GI   R +VA FI  RD
Sbjct  62   VAAAFPSDVIERAIEMRDAIGPAGTGAYTNSQGIGKFRDDVAHFITARD  110



>emb|CDO97792.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  281
            P+  +++N  V KC+YAVRGE+   A +L+++ K+         II+ N+GNP +LGQ+P
Sbjct  9    PVTLQSVNPKVLKCEYAVRGEIVTLAQKLEQDLKQNPDSHPFDEIIYCNIGNPQSLGQQP  68

Query  282  LTFPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRK  458
            +TF R+V+ALC  P +LD      +F ADAI RA Q L    G   GAYS S+GI G+R+
Sbjct  69   ITFFREVLALCDHPAILDRSETQGLFSADAIERAFQILDQIPGRATGAYSHSQGIKGLRE  128

Query  459  EVAXFIGRRDG  491
             +A  I  RDG
Sbjct  129  TIAAGIAERDG  139



>gb|AIT69921.1| alanine transaminase [Sargassum muticum]
Length=501

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 83/130 (64%), Gaps = 12/130 (9%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEG--------KKIIFTNVGNPHALGQKPL  284
            PLD  ++N NV+  +YAVRG +  R+ ELQ+          KK +  N+GNPHAL Q PL
Sbjct  21   PLDATSINANVRAAEYAVRGNVLERSMELQRRMAAGEMLPFKKFVPCNIGNPHALLQLPL  80

Query  285  TFPRQVIALCQAPFL-LDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +F R V+ALC +P L  D P+    F  DA+ RA+++ +   GG+G+Y++S+GI  VR+E
Sbjct  81   SFHRDVLALCISPHLATDHPSA---FNPDAVERAQKYATGMGGGVGSYTNSQGILAVREE  137

Query  462  VAXFIGRRDG  491
            +A FI  RDG
Sbjct  138  IAAFIAERDG  147



>ref|XP_011485336.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Oryzias 
latipes]
Length=515

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKE---GKK-----IIFTNVGNPHALGQKPLT  287
            L  +N+N  VKK +YAVRG +  RA EL++E   G K     +I  N+G+ HA+GQ+P+T
Sbjct  40   LTIDNMNPTVKKVEYAVRGPIVQRAVELERELSEGMKKPFAEVIKANIGDAHAMGQQPIT  99

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LL D     +FP DA  RA++ L+   G  +GAYS S+GI  VR++V
Sbjct  100  FFRQVLALCSYPELLSDS----IFPEDAKNRARRILNSCGGNSMGAYSASQGIESVRQDV  155

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  156  ALYIERRDG  164



>ref|XP_005526439.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Pseudopodoces 
humilis]
Length=551

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  76   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  135

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+Y+ S+GI  +R++V
Sbjct  136  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSYTASQGINCIREDV  191

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  192  ASYIERRDG  200



>gb|KFP06658.1| Alanine aminotransferase 2, partial [Calypte anna]
Length=538

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  63   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  122

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+Y+ S+GI  +R++V
Sbjct  123  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQDCGGNSLGSYTASQGINCIREDV  178

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  179  ASYIQRRDG  187



>gb|KFH70378.1| alanine transaminase [Mortierella verticillata NRRL 6337]
Length=493

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 82/131 (63%), Gaps = 12/131 (9%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  287
            L   N+N  ++K +YAVRGEL +R+  L+ E          +++  N+GNP AL QKP+T
Sbjct  16   LTAHNMNPKIRKAEYAVRGELAIRSEALKIELANGANLPFSRVVGCNIGNPQALDQKPIT  75

Query  288  FPRQVIALCQAPFLLDDPNVGLV---FPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRK  458
            F RQV +L + P LL + N  +V   +P+DAIARAK  L  + G +GAYS S+GIP +R 
Sbjct  76   FFRQVASLVEYPALLQEENAEVVSKLYPSDAIARAKLLLD-SIGSVGAYSHSQGIPHIRN  134

Query  459  EVAXFIGRRDG  491
             VA FI  RDG
Sbjct  135  NVAQFIAERDG  145



>ref|WP_012096788.1| aminotransferase class I/II [Anaeromyxobacter sp. Fw109-5]
 gb|ABS26209.1| aminotransferase class I and II [Anaeromyxobacter sp. Fw109-5]
Length=457

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = +3

Query  141  ENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQA  320
            E++   V++ QYAVRG +  RA EL+++G+++I+ N+GNP +LGQ+PL++ RQV+A+ + 
Sbjct  6    EDVAPVVREAQYAVRGPIVARAQELERQGREVIYCNIGNPQSLGQRPLSWVRQVLAIAEW  65

Query  321  PFLLDDPNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAXFIGRRDG  491
            P LL+    G  F AD +A A++ L  +  GLGAY++S+G   VR+ VA FI  RDG
Sbjct  66   PELLERVPAG-TFAADVVAVAREVLRGSEHGLGAYTESKGYHFVREAVAAFIRDRDG  121



>ref|XP_001919896.1| PREDICTED: alanine aminotransferase 1 [Danio rerio]
 ref|XP_005156168.1| PREDICTED: alanine aminotransferase 1 [Danio rerio]
Length=488

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPLT  287
            L  + +N N+K+ +YAVRG +  RA ++ KE K        ++I  N+G+ HA+GQKP+T
Sbjct  13   LTVDTMNPNIKRLEYAVRGPIVQRAVQIDKELKMGIKKPFTEVIKANIGDCHAMGQKPIT  72

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSGG-LGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LL+D      FP DA +RA++ L    GG LGAYS S+GI  +R++V
Sbjct  73   FFRQVLALCSYPDLLEDNK----FPEDAKSRAQRILKACGGGSLGAYSTSQGIEMIRQDV  128

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  129  ARYIERRDG  137



>gb|AIT69926.1| alanine transaminase [Sargassum horneri]
Length=501

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 83/130 (64%), Gaps = 12/130 (9%)
 Frame = +3

Query  129  PLDYENLNENVKKCQYAVRGELYLRASELQKEG--------KKIIFTNVGNPHALGQKPL  284
            PLD  ++N NV+  +YAVRG +  R+ ELQ+          KK +  N+GNPHAL Q PL
Sbjct  21   PLDATSINANVRAAEYAVRGNVLERSMELQRRMAAGEMLPFKKFVPCNIGNPHALLQLPL  80

Query  285  TFPRQVIALCQAPFLLDD-PNVGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKE  461
            +F R V+ALC +P L  D P+    F  DA+ RA+++ +   GG+G+Y++S+GI  VR+E
Sbjct  81   SFHRDVLALCISPHLASDHPSA---FNPDAVERAQKYATEMGGGVGSYTNSQGILAVREE  137

Query  462  VAXFIGRRDG  491
            +A FI  RDG
Sbjct  138  IAAFITERDG  147



>ref|XP_008637027.1| PREDICTED: alanine aminotransferase 2 [Corvus brachyrhynchos]
Length=551

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  76   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  135

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+Y+ S+GI  +R++V
Sbjct  136  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSYTASQGINCIREDV  191

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  192  ASYIERRDG  200



>gb|KFO63157.1| Alanine aminotransferase 2, partial [Corvus brachyrhynchos]
Length=536

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  61   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  120

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+Y+ S+GI  +R++V
Sbjct  121  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSYTASQGINCIREDV  176

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  177  ASYIERRDG  185



>dbj|BAP71656.1| probable alanine aminotransferase [Kluyveromyces marxianus]
Length=542

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 11/130 (8%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  284
            L  +++NEN+ K +YAVRG + +RA EL+ +          KKII  N+GNP  L QKPL
Sbjct  63   LTLDDVNENILKAKYAVRGRIPMRAEELKAQLKKDPASLPFKKIINANIGNPQQLDQKPL  122

Query  285  TFPRQVIALCQAPFLLDDPNVGL--VFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRK  458
            TF R+V++L Q P LLD+ +  L  ++  D+I RA++ L    G +GAYS S+G+ G+R+
Sbjct  123  TFYREVLSLLQHPELLDEADETLLSLYKIDSIQRARKLLEEVGGSVGAYSQSQGVQGIRE  182

Query  459  EVAXFIGRRD  488
             VA FI +RD
Sbjct  183  TVASFITKRD  192



>dbj|BAO40163.1| probable alanine aminotransferase [Kluyveromyces marxianus DMKU3-1042]
Length=542

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 11/130 (8%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  284
            L  +++NEN+ K +YAVRG + +RA EL+ +          KKII  N+GNP  L QKPL
Sbjct  63   LTLDDVNENILKAKYAVRGRIPMRAEELKAQLKKDPASLPFKKIINANIGNPQQLDQKPL  122

Query  285  TFPRQVIALCQAPFLLDDPNVGL--VFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRK  458
            TF R+V++L Q P LLD+ +  L  ++  D+I RA++ L    G +GAYS S+G+ G+R+
Sbjct  123  TFYREVLSLLQHPELLDEADETLLSLYKIDSIQRARKLLEEVGGSVGAYSQSQGVQGIRE  182

Query  459  EVAXFIGRRD  488
             VA FI +RD
Sbjct  183  TVASFITKRD  192



>ref|XP_002194653.1| PREDICTED: alanine aminotransferase 2 [Taeniopygia guttata]
Length=552

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  287
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  77   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  136

Query  288  FPRQVIALCQAPFLLDDPNVGLVFPADAIARAKQFLSMTSG-GLGAYSDSRGIPGVRKEV  464
            F RQV+ALC  P LLD P+    FP DA  RA++ L    G  LG+Y+ S+GI  +R++V
Sbjct  137  FLRQVVALCTYPNLLDSPS----FPEDAKKRARRILQGCGGNSLGSYTASQGINCIREDV  192

Query  465  AXFIGRRDG  491
            A +I RRDG
Sbjct  193  ASYIERRDG  201



>emb|CDS05712.1| hypothetical protein LRAMOSA08240 [Absidia idahoensis var. thermophila]
Length=506

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 83/131 (63%), Gaps = 11/131 (8%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  287
            L  +N+N +++  +YAVRG + +RA E++ +         K ++  N+GNP  L QKP+T
Sbjct  8    LTVDNINPHIRDMEYAVRGRIAIRAEEIRDQLNKGDQLPFKTVVNCNIGNPQQLEQKPIT  67

Query  288  FPRQVIALCQAPFLLDDPN---VGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRK  458
            F RQV +LC+ P LL D     V  ++P+DAIARA++ ++M     GAYS S+G+ G+R+
Sbjct  68   FFRQVASLCENPELLADDKQDIVSQLYPSDAIARARKLMAMIGSSTGAYSHSQGVAGIRQ  127

Query  459  EVAXFIGRRDG  491
             VA F+  RDG
Sbjct  128  TVARFLEERDG  138



>emb|CEG77871.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=225

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 79/127 (62%), Gaps = 13/127 (10%)
 Frame = +3

Query  147  LNENVKKCQYAVRGELYLRASELQK---------EGKKIIFTNVGNPHALGQKPLTFPRQ  299
            +N NV+  +YAV GEL  RA  ++K         +   +++ N+GNPH   QKP+TF RQ
Sbjct  1    MNPNVRDAEYAVLGELPARAEMIEKAIQAGQNKFKFDNVVYCNIGNPHIFNQKPITFFRQ  60

Query  300  VIALCQAPFLLDDPNVGLV---FPADAIARAKQFLSMTSGGLGAYSDSRGIPGVRKEVAX  470
            V +LC+ P LL   N  LV   +P+DAIARA+  L    G LGAYSDS+G+P +R+ +A 
Sbjct  61   VSSLCENPDLLKIENRQLVSKLYPSDAIARAEILLK-NIGFLGAYSDSKGVPHIRQNIAK  119

Query  471  FIGRRDG  491
            FI  RDG
Sbjct  120  FIKNRDG  126



>gb|EPZ32571.1| Aminotransferase, class I/classII domain-containing protein [Rozella 
allomycis CSF55]
Length=284

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = +3

Query  132  LDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPL  284
            L   N+N  + + QYAVRGE+ +RA +L+KE          KKII  N+GNP  L QKP+
Sbjct  10   LQLRNINSKILQTQYAVRGEIAIRAEQLRKELESNPQSFPFKKIINCNIGNPQQLNQKPI  69

Query  285  TFPRQVIALCQAPFLLDDPN----VGLVFPADAIARAKQFLSMTSGGLGAYSDSRGIPGV  452
            TF RQ+++L + P L  +      +  ++P D I RA+Q L   SG +GAYS S+GIP V
Sbjct  70   TFFRQIMSLLEYPELFKNTEYLDKIKYIYPNDVINRAQQILRQ-SGPIGAYSHSKGIPYV  128

Query  453  RKEVAXFIGRRDG  491
            R  VA +I  RDG
Sbjct  129  RNAVAKYIHERDG  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780