BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF012J17

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP29212.1|  hypothetical protein JCGZ_16601                         228   2e-70   Jatropha curcas
ref|XP_004304330.1|  PREDICTED: caffeic acid 3-O-methyltransferase      223   1e-68   Fragaria vesca subsp. vesca
ref|XP_008442758.1|  PREDICTED: caffeic acid 3-O-methyltransferase      223   2e-68   Cucumis melo [Oriental melon]
ref|XP_004488687.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    221   1e-67   Cicer arietinum [garbanzo]
ref|XP_007027514.1|  O-methyltransferase family protein                 220   2e-67   
ref|XP_011101458.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    219   8e-67   Sesamum indicum [beniseed]
ref|XP_006594705.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    216   1e-66   Glycine max [soybeans]
gb|AFK33955.1|  unknown                                                 213   2e-66   Medicago truncatula
gb|KEH38506.1|  caffeic acid O-methyltransferase                        218   2e-66   Medicago truncatula
ref|XP_006594704.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    218   3e-66   
gb|KJB62321.1|  hypothetical protein B456_009G411600                    213   7e-66   Gossypium raimondii
gb|KJB62324.1|  hypothetical protein B456_009G411600                    214   8e-66   Gossypium raimondii
gb|KJB62322.1|  hypothetical protein B456_009G411600                    213   1e-65   Gossypium raimondii
ref|XP_008361606.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    212   3e-65   
gb|KGN59032.1|  hypothetical protein Csa_3G747630                       214   6e-65   Cucumis sativus [cucumbers]
gb|KJB62323.1|  hypothetical protein B456_009G411600                    214   6e-65   Gossypium raimondii
ref|XP_009341082.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    214   9e-65   Pyrus x bretschneideri [bai li]
gb|KJB62320.1|  hypothetical protein B456_009G411600                    214   1e-64   Gossypium raimondii
ref|XP_004137858.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    215   1e-64   
ref|XP_006381360.1|  hypothetical protein POPTR_0006s12160g             211   1e-64   
ref|XP_007149437.1|  hypothetical protein PHAVU_005G070300g             213   1e-64   Phaseolus vulgaris [French bean]
ref|XP_007202084.1|  hypothetical protein PRUPE_ppa007420mg             213   1e-64   Prunus persica
gb|KHG05883.1|  Caffeic acid 3-O-methyltransferase                      213   1e-64   Gossypium arboreum [tree cotton]
ref|XP_011018830.1|  PREDICTED: caffeic acid 3-O-methyltransferase      213   3e-64   Populus euphratica
ref|XP_006598126.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    211   8e-64   Glycine max [soybeans]
ref|XP_006367254.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    211   8e-64   Solanum tuberosum [potatoes]
ref|XP_008241354.1|  PREDICTED: caffeic acid 3-O-methyltransferase      211   1e-63   Prunus mume [ume]
ref|XP_006381361.1|  hypothetical protein POPTR_0006s12160g             211   2e-63   
ref|XP_002519426.1|  o-methyltransferase, putative                      210   2e-63   Ricinus communis
ref|XP_006367255.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    210   3e-63   Solanum tuberosum [potatoes]
ref|XP_010267318.1|  PREDICTED: caffeic acid 3-O-methyltransferase      209   3e-63   Nelumbo nucifera [Indian lotus]
ref|XP_008361604.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    207   4e-63   
ref|XP_006428524.1|  hypothetical protein CICLE_v10013655mg             206   4e-63   
ref|XP_009341081.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    209   1e-62   Pyrus x bretschneideri [bai li]
ref|XP_010504072.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    208   3e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010312333.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    206   8e-62   Solanum lycopersicum
ref|XP_010426946.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    204   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010515802.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    204   5e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006291371.1|  hypothetical protein CARUB_v10017511mg             204   5e-61   Capsella rubella
emb|CAN65776.1|  hypothetical protein VITISV_030414                     204   6e-61   Vitis vinifera
ref|XP_002264566.1|  PREDICTED: caffeic acid 3-O-methyltransferase      204   7e-61   Vitis vinifera
ref|XP_010050337.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    202   4e-60   Eucalyptus grandis [rose gum]
ref|XP_006391885.1|  hypothetical protein EUTSA_v10023542mg             201   6e-60   Eutrema salsugineum [saltwater cress]
ref|XP_010546519.1|  PREDICTED: flavone 3'-O-methyltransferase 1        201   7e-60   Tarenaya hassleriana [spider flower]
ref|XP_010271244.1|  PREDICTED: uncharacterized protein LOC104607...    196   1e-59   Nelumbo nucifera [Indian lotus]
ref|XP_006403721.1|  hypothetical protein EUTSA_v10010488mg             200   2e-59   Eutrema salsugineum [saltwater cress]
ref|XP_010271241.1|  PREDICTED: uncharacterized protein LOC104607...    196   4e-59   Nelumbo nucifera [Indian lotus]
ref|XP_009617330.1|  PREDICTED: flavone 3'-O-methyltransferase 1        199   7e-59   Nicotiana tomentosiformis
ref|NP_190882.1|  putative O-diphenol-O-methyl transferase              198   8e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009774776.1|  PREDICTED: caffeic acid 3-O-methyltransferase      191   2e-57   Nicotiana sylvestris
gb|KFK34550.1|  hypothetical protein AALP_AA5G160800                    192   1e-56   Arabis alpina [alpine rockcress]
ref|XP_011098295.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    192   2e-56   Sesamum indicum [beniseed]
ref|XP_010098845.1|  Caffeic acid 3-O-methyltransferase                 192   3e-56   Morus notabilis
emb|CDX76223.1|  BnaA04g04870D                                          187   2e-55   
ref|XP_009139429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      187   2e-54   Brassica rapa
ref|XP_011101457.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    186   3e-54   
emb|CDX95399.1|  BnaC04g27590D                                          186   7e-54   
ref|XP_004502926.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    184   4e-53   Cicer arietinum [garbanzo]
gb|KHN47498.1|  Caffeic acid 3-O-methyltransferase                      177   1e-50   Glycine soja [wild soybean]
gb|AAP03054.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    171   3e-50   Limonium latifolium
ref|XP_003602597.1|  Caffeic acid 3-O-methyltransferase                 175   8e-50   
emb|CAB65279.1|  O-diphenol-O-methyl transferase                        171   2e-48   Medicago sativa subsp. x varia
gb|AFK47565.1|  unknown                                                 166   6e-48   Medicago truncatula
gb|AAP03058.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    170   7e-48   Limonium latifolium
ref|XP_003602596.1|  Caffeic acid 3-O-methyltransferase                 166   2e-47   
ref|XP_003602595.1|  Caffeic acid 3-O-methyltransferase                 166   1e-46   Medicago truncatula
ref|XP_009382782.1|  PREDICTED: caffeic acid 3-O-methyltransferase      160   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010935842.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    149   4e-40   
ref|XP_010935841.1|  PREDICTED: quercetin 3-O-methyltransferase 1...    149   1e-39   Elaeis guineensis
gb|AAP03053.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    144   1e-39   Limonium latifolium
gb|AGW45465.1|  beta-alanine n-methyltransferase                        142   8e-39   Reaumuria trigyna
dbj|BAJ96291.1|  predicted protein                                      145   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO38249.1|  hypothetical protein CISIN_1g043063mg                   142   5e-38   Citrus sinensis [apfelsine]
ref|XP_006423903.1|  hypothetical protein CICLE_v10029876mg             141   1e-37   
gb|KDO41959.1|  hypothetical protein CISIN_1g021707mg                   141   2e-37   Citrus sinensis [apfelsine]
ref|XP_006436414.1|  hypothetical protein CICLE_v10033543mg             141   3e-37   Citrus clementina [clementine]
ref|XP_006485837.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    141   3e-37   Citrus sinensis [apfelsine]
ref|XP_010683979.1|  PREDICTED: caffeic acid 3-O-methyltransferase      142   5e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004954455.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    140   1e-36   Setaria italica
ref|XP_011101495.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    133   3e-36   
ref|XP_006451708.1|  hypothetical protein CICLE_v10010561mg             137   5e-36   
ref|XP_006485822.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    135   2e-35   
ref|XP_002453074.1|  hypothetical protein SORBIDRAFT_04g037820          137   3e-35   Sorghum bicolor [broomcorn]
ref|NP_001149617.1|  LOC100283243                                       136   5e-35   
gb|ACN25427.1|  unknown                                                 136   5e-35   Zea mays [maize]
ref|XP_003572969.1|  PREDICTED: caffeic acid 3-O-methyltransferase      136   5e-35   Brachypodium distachyon [annual false brome]
gb|EEC74273.1|  hypothetical protein OsI_09508                          132   9e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_001048569.1|  Os02g0823400                                       132   2e-33   
ref|XP_010243879.1|  PREDICTED: uncharacterized protein LOC104587837    121   2e-31   Nelumbo nucifera [Indian lotus]
gb|AES72848.2|  caffeic acid O-methyltransferase                        124   1e-30   Medicago truncatula
ref|XP_010275846.1|  PREDICTED: uncharacterized protein LOC104610771    121   6e-30   
ref|XP_006838729.1|  hypothetical protein AMTR_s00002p00253410          103   5e-23   Amborella trichopoda
gb|KCW89310.1|  hypothetical protein EUGRSUZ_A01600                     101   2e-22   Eucalyptus grandis [rose gum]
ref|XP_008387516.1|  PREDICTED: caffeic acid 3-O-methyltransferase      100   4e-22   
gb|KDO38695.1|  hypothetical protein CISIN_1g037818mg                 98.2    5e-22   Citrus sinensis [apfelsine]
ref|XP_006425490.1|  hypothetical protein CICLE_v10027189mg           96.3    9e-21   
ref|XP_006441597.1|  hypothetical protein CICLE_v10023355mg           93.6    2e-20   
gb|KDO39478.1|  hypothetical protein CISIN_1g036218mg                 84.3    6e-18   Citrus sinensis [apfelsine]
ref|XP_002986612.1|  hypothetical protein SELMODRAFT_124122           85.9    3e-17   
ref|XP_002965284.1|  hypothetical protein SELMODRAFT_83100            85.5    4e-17   
gb|KCW89309.1|  hypothetical protein EUGRSUZ_A01600                   86.3    5e-17   Eucalyptus grandis [rose gum]
ref|XP_006649184.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  85.5    6e-17   
gb|ADE88153.1|  caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-...  85.9    8e-17   Selaginella moellendorffii
ref|XP_002986521.1|  hypothetical protein SELMODRAFT_124205           84.3    1e-16   
ref|XP_002962074.1|  hypothetical protein SELMODRAFT_76630            83.6    6e-16   
ref|XP_002971011.1|  hypothetical protein SELMODRAFT_94918            83.6    6e-16   
ref|XP_002988275.1|  caffeic acid O-methyltransferase                 82.8    8e-16   Selaginella moellendorffii
ref|XP_002963872.1|  caffeic acid O-methyltransferase                 82.8    8e-16   Selaginella moellendorffii
emb|CCC55423.1|  caffeic acid O-3-methyltransferase                   80.5    7e-15   Pinus pinaster [cluster pine]
gb|KDO39806.1|  hypothetical protein CISIN_1g025363mg                 76.6    6e-14   Citrus sinensis [apfelsine]
gb|KHF97637.1|  Caffeic acid 3-O-methyltransferase                    76.3    1e-13   Gossypium arboreum [tree cotton]
gb|ABR18380.1|  unknown                                               75.5    4e-13   Picea sitchensis
gb|KHF97352.1|  Caffeic acid 3-O-methyltransferase                    74.3    4e-13   Gossypium arboreum [tree cotton]
emb|CAI30878.1|  caffeate O-methyltransferase                         75.5    4e-13   Picea abies
gb|ABK22490.1|  unknown                                               75.1    5e-13   Picea sitchensis
gb|AAV36348.1|  caffeate O-methyltransferase                          73.2    6e-13   Pinus taeda
ref|NP_200227.1|  caffeic acid/5-hydroxyferulic acid O-methyltran...  75.1    7e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAB96879.1|  O-methyltransferase 1                                 74.7    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008788729.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  74.7    7e-13   Phoenix dactylifera
gb|KJB16304.1|  hypothetical protein B456_002G222400                  75.1    8e-13   Gossypium raimondii
gb|ABO41840.1|  putative caffeic acid methyltransferase               74.7    8e-13   Gossypium arboreum [tree cotton]
ref|XP_006280681.1|  hypothetical protein CARUB_v10026645mg           74.7    9e-13   Capsella rubella
gb|AHA44835.1|  caffeate O-methyltransferase                          74.3    1e-12   Larix kaempferi [karamatsu]
ref|XP_002864309.1|  O-methyltransferase 1                            74.3    1e-12   
gb|ABO41845.1|  putative caffeic acid methyltransferase               74.3    1e-12   Gossypium hirsutum [American cotton]
gb|AFM73596.1|  caffeate O-methyltransferase                          73.2    2e-12   Populus simonii
gb|AAV36304.1|  caffeate O-methyltransferase                          72.0    2e-12   Pinus taeda
gb|AHY28755.1|  caffeate O-methyltransferase                          72.0    2e-12   Pinus palustris [longleaf pine]
gb|ABO41834.1|  putative caffeic acid methyltransferase               73.6    2e-12   Gossypium raimondii
emb|CDX78145.1|  BnaA09g33400D                                        74.7    2e-12   
gb|ABO41846.1|  putative caffeic acid methyltransferase               73.2    2e-12   Gossypium hirsutum [American cotton]
gb|KDO40925.1|  hypothetical protein CISIN_1g0357381mg                72.0    2e-12   Citrus sinensis [apfelsine]
dbj|BAD87408.1|  O-diphenol-O-methyl transferase-like                 70.5    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010241050.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  73.2    3e-12   Nelumbo nucifera [Indian lotus]
gb|AER35881.1|  S-adenosyl-L-methionine:flavonoid O-methyltransfe...  73.2    3e-12   Ginkgo biloba [ginkgo]
gb|EPS67212.1|  hypothetical protein M569_07558                       73.2    3e-12   Genlisea aurea
ref|XP_010069184.1|  PREDICTED: uncharacterized protein LOC104456144  70.5    3e-12   Eucalyptus grandis [rose gum]
gb|AAV36346.1|  caffeate O-methyltransferase                          71.2    3e-12   Pinus taeda
gb|AAV36308.1|  caffeate O-methyltransferase                          71.2    3e-12   Pinus taeda
gb|AAV36354.1|  caffeate O-methyltransferase                          71.2    3e-12   Pinus taeda
dbj|BAJ34520.1|  unnamed protein product                              72.4    6e-12   Eutrema halophilum
gb|ACD56610.1|  putative caffeic acid protein                         72.4    6e-12   Gossypioides kirkii
ref|XP_006401613.1|  hypothetical protein EUTSA_v10013897mg           72.4    6e-12   Eutrema salsugineum [saltwater cress]
gb|ABO41852.1|  putative caffeic acid methyltransferase               71.6    8e-12   Gossypium hirsutum [American cotton]
ref|XP_007136428.1|  hypothetical protein PHAVU_009G044400g           71.2    1e-11   Phaseolus vulgaris [French bean]
ref|XP_011084578.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  68.6    1e-11   Sesamum indicum [beniseed]
gb|AHY28752.1|  caffeate O-methyltransferase                          70.9    2e-11   Pinus echinata [shortleaf pine]
ref|XP_002864307.1|  O-methyltransferase 1                            70.9    2e-11   Arabidopsis lyrata subsp. lyrata
dbj|BAK42963.1|  caffeic acid O-methylltransferase                    70.9    2e-11   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AHY28754.1|  caffeate O-methyltransferase                          70.9    2e-11   Pinus elliottii [American pitch pine]
gb|KDO44005.1|  hypothetical protein CISIN_1g018576mg                 70.5    2e-11   Citrus sinensis [apfelsine]
ref|XP_006431772.1|  hypothetical protein CICLE_v10001661mg           70.5    2e-11   Citrus clementina [clementine]
ref|XP_009119948.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  70.5    2e-11   Brassica rapa
dbj|BAD18975.1|  phloroglucinol O-methyltransferase                   70.5    2e-11   Rosa chinensis var. spontanea
gb|EEC84528.1|  hypothetical protein OsI_31257                        71.6    2e-11   Oryza sativa Indica Group [Indian rice]
gb|AIJ28474.1|  O-methyltransferase                                   70.5    2e-11   Vaccinium corymbosum [American blueberry]
gb|AEQ59236.1|  putative S-adenosyl-L-methionine:flavonoid O-meth...  69.7    2e-11   Ginkgo biloba [ginkgo]
gb|AHY28757.1|  caffeate O-methyltransferase                          70.5    3e-11   Pinus taeda
gb|ABU53653.1|  caffeic acid O-3-methyltransferase                    70.5    3e-11   Populus deltoides
gb|AET34455.1|  putative S-adenosyl-L-methionine: flavonoid O-met...  68.9    3e-11   Ginkgo biloba [ginkgo]
gb|ACN41351.2|  putative caffeic acid O-methyltransferase             70.5    3e-11   Betula pendula [white birch]
gb|AAF60951.1|  O-methyltransferase                                   70.5    3e-11   Populus trichocarpa x Populus deltoides
prf||1906376A  O-methyltransferase                                    70.5    3e-11
gb|KHG13754.1|  Caffeic acid 3-O-methyltransferase                    70.5    3e-11   Gossypium arboreum [tree cotton]
gb|ABK23795.1|  unknown                                               70.1    4e-11   Picea sitchensis
gb|AAD29845.1|AF064697_1  O-methyltransferase                         69.7    4e-11   Thalictrum tuberosum
ref|XP_007223223.1|  hypothetical protein PRUPE_ppa007212mg           69.7    5e-11   Prunus persica
gb|ABK21417.1|  unknown                                               69.3    6e-11   Picea sitchensis
gb|AGG91492.1|  caffeic acid 3-O-methyltransferase                    69.3    6e-11   Betula platyphylla [Asian white birch]
ref|XP_002525818.1|  o-methyltransferase, putative                    69.3    6e-11   Ricinus communis
gb|KJB52493.1|  hypothetical protein B456_008G264900                  68.2    7e-11   Gossypium raimondii
gb|KDP28404.1|  hypothetical protein JCGZ_14175                       69.3    8e-11   Jatropha curcas
ref|XP_011025357.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  68.9    8e-11   Populus euphratica
ref|XP_010103059.1|  Caffeic acid 3-O-methyltransferase               67.8    8e-11   
gb|ACT32028.1|  caffeic acid O-methyltransferase 1                    68.9    8e-11   Gossypium hirsutum [American cotton]
gb|ABK25932.1|  unknown                                               68.9    8e-11   Picea sitchensis
gb|KDP24164.1|  hypothetical protein JCGZ_25821                       68.6    1e-10   Jatropha curcas
ref|XP_011043758.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  68.6    1e-10   Populus euphratica
emb|CDY43839.1|  BnaC03g14720D                                        68.6    1e-10   Brassica napus [oilseed rape]
gb|AFZ78575.1|  caffeic acid O-methyltransferase                      68.6    1e-10   Populus tomentosa [Chinese white poplar]
ref|XP_002320237.1|  eugenol O-methyltransferase family protein       68.6    1e-10   
gb|AAD29841.1|AF064693_1  catechol O-methyltransferase                68.6    1e-10   Thalictrum tuberosum
gb|AAD29842.1|AF064694_1  catechol O-methyltransferase                68.6    1e-10   Thalictrum tuberosum
sp|Q00763.1|COMT1_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...  68.6    1e-10   Populus tremuloides
sp|Q9XGW0.1|COMT1_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...  68.6    1e-10   Ocimum basilicum [basil]
gb|AFK40372.1|  unknown                                               68.6    1e-10   Lotus japonicus
ref|XP_002317838.1|  Chain A family protein                           68.6    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010671332.1|  PREDICTED: caffeic acid 3-O-methyltransferase    68.6    1e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO44721.1|  hypothetical protein CISIN_1g036188mg                 66.6    1e-10   Citrus sinensis [apfelsine]
gb|AAD29844.1|AF064696_1  catechol O-methyltransferase                68.2    2e-10   Thalictrum tuberosum
gb|AAD29843.1|AF064695_1  catechol O-methyltransferase                68.2    2e-10   Thalictrum tuberosum
gb|AAL57301.1|AF387790_1  O-methyltransferase                         68.2    2e-10   Sorghum bicolor [broomcorn]
ref|XP_009132451.1|  PREDICTED: flavone 3'-O-methyltransferase 1      68.2    2e-10   Brassica rapa
gb|AFO69477.1|  caffeic acid O-methyltransferase                      68.2    2e-10   Sorghum bicolor [broomcorn]
gb|AAO43609.1|  caffeic acid O-methyltransferase                      68.2    2e-10   Sorghum bicolor [broomcorn]
sp|Q8W013.1|COMT1_CATRO  RecName: Full=Caffeic acid 3-O-methyltra...  67.8    2e-10   Catharanthus roseus [chatas]
gb|KFK27028.1|  hypothetical protein AALP_AA8G324800                  67.8    2e-10   Arabis alpina [alpine rockcress]
ref|XP_006436320.1|  hypothetical protein CICLE_v10031951mg           66.6    2e-10   
dbj|BAO79380.1|  5-hydroxyconiferylaldehyde O-methyltransferase       67.8    2e-10   Anthriscus sylvestris
ref|XP_010934914.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  67.8    2e-10   Elaeis guineensis
gb|ABK23414.1|  unknown                                               67.8    3e-10   Picea sitchensis
gb|ABR18103.1|  unknown                                               67.4    3e-10   Picea sitchensis
gb|KJB52492.1|  hypothetical protein B456_008G264900                  67.8    3e-10   Gossypium raimondii
ref|XP_002515087.1|  o-methyltransferase, putative                    67.4    3e-10   Ricinus communis
gb|AGR85824.1|  caffeic acid O-methyltransferase                      67.0    3e-10   Hibiscus cannabinus [bimli-jute]
ref|XP_011084580.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  67.4    3e-10   Sesamum indicum [beniseed]
gb|ADO16247.1|  caffeic acid O-methyltransferase                      67.4    3e-10   Ocimum tenuiflorum [holy basil]
ref|XP_011039447.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  67.4    3e-10   Populus euphratica
prf||2119166A  caffeic acid O-methyltransferase                       67.4    3e-10
ref|XP_010934913.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  67.4    3e-10   Elaeis guineensis
ref|XP_008775842.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  67.4    3e-10   Phoenix dactylifera
ref|XP_006436417.1|  hypothetical protein CICLE_v10031953mg           65.9    4e-10   
ref|XP_010107138.1|  Caffeic acid 3-O-methyltransferase               65.9    4e-10   
gb|AFK39562.1|  unknown                                               67.0    4e-10   Lotus japonicus
ref|XP_006441263.1|  hypothetical protein CICLE_v100208142mg          65.5    4e-10   
gb|AAN03726.1|  caffeic acid O-methyltransferase                      67.0    4e-10   Coffea canephora [robusta coffee]
gb|EAY75657.1|  hypothetical protein OsI_03563                        63.2    4e-10   Oryza sativa Indica Group [Indian rice]
sp|Q6T1F5.1|COMT1_AMMMJ  RecName: Full=Caffeic acid 3-O-methyltra...  67.0    4e-10   Ammi majus [ameo mayor]
sp|Q8LL87.1|COMT1_COFCA  RecName: Full=Caffeic acid 3-O-methyltra...  66.6    5e-10   Coffea canephora [robusta coffee]
ref|XP_002445083.1|  hypothetical protein SORBIDRAFT_07g003860        66.6    5e-10   Sorghum bicolor [broomcorn]
gb|AAF63200.1|  caffeic acid O-3-methyltransferase                    66.6    5e-10   Populus tomentosa [Chinese white poplar]
ref|XP_010112212.1|  Caffeic acid 3-O-methyltransferase               66.6    6e-10   Morus notabilis
ref|XP_006436317.1|  hypothetical protein CICLE_v10031952mg           65.5    6e-10   
ref|XP_006478090.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  66.6    6e-10   Citrus sinensis [apfelsine]
gb|AET00984.2|  caffeic acid O-methyltransferase                      66.6    6e-10   Medicago truncatula
ref|XP_006436319.1|  hypothetical protein CICLE_v10031951mg           66.2    6e-10   Citrus clementina [clementine]
ref|XP_002302676.2|  eugenol O-methyltransferase family protein       66.6    6e-10   
sp|Q43046.1|COMT1_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...  66.6    6e-10   Populus sieboldii x Populus grandidentata
ref|XP_006478241.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  66.6    6e-10   
gb|ADN27527.1|  caffeic acid O-methyltransferase                      66.2    7e-10   Camellia sinensis [black tea]
ref|XP_006478243.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.3    8e-10   
gb|KDP36008.1|  hypothetical protein JCGZ_10407                       66.2    8e-10   Jatropha curcas
ref|XP_006485684.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  66.2    8e-10   
ref|XP_010911558.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  66.2    8e-10   Elaeis guineensis
ref|XP_006436416.1|  hypothetical protein CICLE_v10031953mg           66.2    8e-10   Citrus clementina [clementine]
gb|AAF28353.1|AF220491_1  O-methyltransferase                         66.2    8e-10   Fragaria x ananassa
ref|NP_001242325.1|  uncharacterized protein LOC100805999             66.2    9e-10   
ref|XP_008347322.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.5    9e-10   
gb|ABI54119.1|  caffeic acid O-methyltransferase                      66.2    9e-10   Malus domestica [apple tree]
gb|KJB23956.1|  hypothetical protein B456_004G125600                  64.7    9e-10   Gossypium raimondii
gb|KHN23296.1|  Caffeic acid 3-O-methyltransferase                    65.9    9e-10   Glycine soja [wild soybean]
dbj|BAO79382.1|  hypothetical plant O-methyltransferase               65.9    9e-10   Anthriscus sylvestris
ref|XP_008219627.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...  65.9    9e-10   
ref|XP_008376825.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  65.9    1e-09   
gb|AGJ84131.1|  putative caffeic acid O-methyltransferase             65.9    1e-09   Hibiscus cannabinus [bimli-jute]
gb|AHM25237.1|  noraucuparin O-methyltransferase                      65.9    1e-09   Sorbus aucuparia [European mountain ash]
ref|XP_007019090.1|  Caffeic acid 3-O-methyltransferase 1             65.9    1e-09   
gb|AFK45226.1|  unknown                                               65.9    1e-09   Lotus japonicus
gb|KHG13289.1|  Caffeic acid 3-O-methyltransferase                    65.9    1e-09   Gossypium arboreum [tree cotton]
ref|XP_008376828.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  65.9    1e-09   Malus domestica [apple tree]
sp|Q8GU25.1|COMT1_ROSCH  RecName: Full=Caffeic acid 3-O-methyltra...  65.9    1e-09   Rosa chinensis [China rose]
gb|ACT32029.1|  caffeic acid O-methyltransferase 2                    65.9    1e-09   Gossypium hirsutum [American cotton]
ref|XP_007143654.1|  hypothetical protein PHAVU_007G090100g           65.9    1e-09   Phaseolus vulgaris [French bean]
dbj|BAO31651.1|  O-methyltransferase                                  65.5    1e-09   Sesamum radiatum
dbj|BAC78827.1|  caffeic acid O-methyltransferase                     65.9    1e-09   Rosa chinensis var. spontanea
ref|NP_001289246.1|  caffeic acid 3-O-methyltransferase               65.5    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_003526767.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  65.5    1e-09   Glycine max [soybeans]
ref|XP_010520935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  65.5    1e-09   Tarenaya hassleriana [spider flower]
gb|AEV93478.1|  caffeic acid O-methyltransferase                      65.5    1e-09   Caragana korshinskii
ref|XP_006386660.1|  hypothetical protein POPTR_0002s18130g           65.5    1e-09   
ref|XP_006386659.1|  hypothetical protein POPTR_0002s18120g           65.5    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011075886.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...  65.5    1e-09   
ref|XP_006434355.1|  hypothetical protein CICLE_v10003445mg           63.2    1e-09   
ref|XP_008234634.1|  PREDICTED: caffeic acid 3-O-methyltransferase    65.5    1e-09   Prunus mume [ume]
ref|XP_006436316.1|  hypothetical protein CICLE_v10031952mg           65.5    1e-09   Citrus clementina [clementine]
gb|KJB23955.1|  hypothetical protein B456_004G125600                  64.3    1e-09   Gossypium raimondii
ref|XP_004235028.1|  PREDICTED: caffeic acid 3-O-methyltransferase    65.5    1e-09   Solanum lycopersicum
ref|XP_003618025.1|  Caffeic acid 3-O-methyltransferase               65.5    1e-09   
ref|XP_006494578.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  65.5    1e-09   Citrus sinensis [apfelsine]
gb|ADK97702.1|  putative caffeic acid O-methyltransferase             65.5    2e-09   Citrus aurantium [bitter orange]
gb|AFK41218.1|  unknown                                               65.5    2e-09   Medicago truncatula
ref|XP_010537046.1|  PREDICTED: flavone 3'-O-methyltransferase 1      65.1    2e-09   Tarenaya hassleriana [spider flower]
gb|KJB23957.1|  hypothetical protein B456_004G125600                  64.7    2e-09   Gossypium raimondii
gb|KDP35860.1|  hypothetical protein JCGZ_10599                       65.1    2e-09   Jatropha curcas
dbj|BAO31650.1|  O-methyltransferase                                  65.1    2e-09   Sesamum indicum [beniseed]
ref|XP_008462913.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  65.1    2e-09   Cucumis melo [Oriental melon]
ref|XP_007039215.1|  Caffeic acid 3-O-methyltransferase 1             65.1    2e-09   
ref|XP_010034911.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  65.1    2e-09   Eucalyptus grandis [rose gum]
gb|ABG27066.1|  caffeic acid O-methyltransferase                      65.1    2e-09   Boehmeria nivea [Chinese silk-plant]
gb|AAS64572.1|  caffeic acid O-methyltransferase                      64.7    2e-09   
gb|AEO14871.1|  caffeic acid O-methyltransferase                      64.7    2e-09   
gb|AEO14870.1|  caffeic acid O-methyltransferase                      64.7    2e-09   
gb|ADI24332.1|  caffeic acid 3-O-methyltransferase                    64.7    2e-09   
ref|XP_010442991.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  64.7    2e-09   
pdb|4PGH|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  64.7    3e-09   
ref|NP_001240003.1|  uncharacterized protein LOC100780100             64.7    3e-09   
ref|XP_006401618.1|  hypothetical protein EUTSA_v10013896mg           64.7    3e-09   
sp|P46484.1|COMT1_EUCGU  RecName: Full=Caffeic acid 3-O-methyltra...  64.7    3e-09   
ref|XP_008364894.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.0    3e-09   
ref|XP_006478347.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.3    3e-09   
ref|XP_004509701.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.7    3e-09   
gb|KJB23954.1|  hypothetical protein B456_004G125600                  64.7    3e-09   
pdb|4PGG|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  64.7    3e-09   
ref|XP_009418618.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  64.7    3e-09   
dbj|BAE94403.1|  Caffeic acid 3-O-methyltransferase                   64.7    3e-09   
dbj|BAE94400.1|  Caffeic acid 3-O-methyltransferase                   64.7    3e-09   
ref|XP_006441603.1|  hypothetical protein CICLE_v10020875mg           64.3    3e-09   
emb|CAA52461.1|  catechol O-methyltransferase                         64.7    3e-09   
gb|ACY06328.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...  64.3    3e-09   
ref|XP_009757562.1|  PREDICTED: caffeic acid 3-O-methyltransferase    64.3    3e-09   
ref|XP_010482824.1|  PREDICTED: flavone 3'-O-methyltransferase 1      64.3    3e-09   
gb|KCW89068.1|  hypothetical protein EUGRSUZ_A01397                   64.7    3e-09   
gb|AAY86361.1|  caffeic acid O-methyltransferase                      64.3    3e-09   
gb|AFR39730.1|  caffeate O-methyltransferase                          61.2    3e-09   
ref|XP_010107137.1|  Caffeic acid 3-O-methyltransferase               63.9    3e-09   
gb|AFR39749.1|  caffeate O-methyltransferase                          61.2    3e-09   
ref|XP_006478225.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.2    3e-09   
gb|AFK39235.1|  unknown                                               64.3    4e-09   
gb|ACO90249.1|  scoulerine 9-O-methyltransferase                      62.4    4e-09   
ref|XP_009361271.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.3    4e-09   
ref|XP_010446534.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  64.3    4e-09   
gb|AFR39750.1|  caffeate O-methyltransferase                          61.2    4e-09   
ref|XP_003602396.1|  Caffeic acid O-methyltransferase                 64.3    4e-09   
sp|O23760.1|COMT1_CLABR  RecName: Full=Caffeic acid 3-O-methyltra...  64.3    4e-09   
sp|Q9XGV9.1|COMT2_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...  63.9    4e-09   
ref|XP_006401615.1|  hypothetical protein EUTSA_v10013908mg           63.9    4e-09   
gb|ABS57468.1|  caffeic acid O-methyl transferase                     63.9    4e-09   
ref|XP_004307899.1|  PREDICTED: caffeic acid 3-O-methyltransferase    63.9    4e-09   
gb|ADB82906.1|  caffeic O-methyltransferase1                          63.9    4e-09   
ref|XP_006478224.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.8    5e-09   
gb|AAC18863.1|  caffeic acid 3-O-methyltransferase                    63.9    5e-09   
ref|XP_006478221.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.9    5e-09   
emb|CDY18306.1|  BnaC09g30560D                                        63.9    5e-09   
gb|ACY66932.1|  caffeic O-methyltransferase 1                         63.9    5e-09   
ref|XP_006478222.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.9    5e-09   
ref|XP_006441599.1|  hypothetical protein CICLE_v10020870mg           63.9    5e-09   
ref|XP_010048429.1|  PREDICTED: caffeic acid 3-O-methyltransferase    63.9    5e-09   
ref|XP_006442371.1|  hypothetical protein CICLE_v10024037mg           63.9    5e-09   
gb|KDP30064.1|  hypothetical protein JCGZ_18389                       63.5    6e-09   
ref|XP_006436309.1|  hypothetical protein CICLE_v10031949mg           62.8    6e-09   
ref|XP_004150934.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.5    6e-09   
ref|XP_004502769.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.5    6e-09   
gb|ACT87981.1|  caffeic acid O-methyltransferase                      63.5    7e-09   
ref|XP_010107135.1|  Caffeic acid 3-O-methyltransferase               63.5    7e-09   
gb|KHN23295.1|  Caffeic acid 3-O-methyltransferase                    63.5    7e-09   
ref|XP_003528001.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.5    7e-09   
ref|XP_009119951.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  63.5    7e-09   
sp|P59049.1|OMT1_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...  63.2    7e-09   
ref|XP_004164570.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.5    7e-09   
ref|XP_008244204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.5    7e-09   
sp|P28002.1|COMT1_MEDSA  RecName: Full=Caffeic acid 3-O-methyltra...  63.2    8e-09   
dbj|BAD83867.1|  Caffeic acid O-methyltransferase                     63.2    8e-09   
ref|XP_006436307.1|  hypothetical protein CICLE_v10031949mg           63.2    8e-09   
ref|XP_008347272.1|  PREDICTED: caffeic acid 3-O-methyltransferase    63.2    8e-09   
gb|AFD61598.1|  caffeic acid 3-O-methyltransferase                    63.2    9e-09   
ref|XP_009418616.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  63.2    9e-09   
ref|XP_006436308.1|  hypothetical protein CICLE_v10031949mg           63.2    9e-09   
emb|CDX73580.1|  BnaC08g24230D                                        63.5    1e-08   
ref|XP_006443200.1|  hypothetical protein CICLE_v10020377mg           62.4    1e-08   
gb|ABP94018.1|  O-methyltransferase                                   62.8    1e-08   
ref|XP_009608171.1|  PREDICTED: caffeic acid 3-O-methyltransferase    63.2    1e-08   
sp|Q42653.1|OMT2_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...  62.8    1e-08   
ref|XP_009352092.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.0    1e-08   
ref|XP_008352782.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.8    1e-08   
ref|XP_006443201.1|  hypothetical protein CICLE_v10020377mg           62.8    1e-08   
gb|AEI54336.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...  62.8    1e-08   
dbj|BAM05584.1|  caffeic acid O-methyltransferase 2                   62.4    1e-08   
emb|CDY41780.1|  BnaC02g13760D                                        61.6    1e-08   
sp|O82054.1|COMT1_SACOF  RecName: Full=Caffeic acid 3-O-methyltra...  62.8    1e-08   
gb|AAQ67347.1|  caffeic acid 3-O-methyltransferase                    62.8    1e-08   
ref|XP_010520933.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  62.8    1e-08   
emb|CAA52462.1|  catechol O-methyltransferase                         62.8    1e-08   
ref|XP_006425206.1|  hypothetical protein CICLE_v100108602mg          60.1    1e-08   
gb|AFR39721.1|  caffeate O-methyltransferase                          59.7    1e-08   
gb|AFR39717.1|  caffeate O-methyltransferase                          59.7    1e-08   
ref|XP_006441596.1|  hypothetical protein CICLE_v10023568mg           62.4    2e-08   
gb|KDO41090.1|  hypothetical protein CISIN_1g018681mg                 62.4    2e-08   
ref|XP_008362805.1|  PREDICTED: caffeic acid 3-O-methyltransferase    62.4    2e-08   
ref|XP_006443203.1|  hypothetical protein CICLE_v10020377mg           62.4    2e-08   
ref|XP_004137204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.4    2e-08   
ref|XP_009361268.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.4    2e-08   
ref|XP_008353353.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.4    2e-08   
gb|ADP00412.1|  putative methyltransferase                            62.4    2e-08   
ref|XP_007015113.1|  Caffeic acid 3-O-methyltransferase 1 isoform 1   62.4    2e-08   
ref|XP_007015114.1|  Caffeic acid 3-O-methyltransferase 1 isoform 2   62.4    2e-08   
ref|XP_003634161.1|  PREDICTED: caffeic acid 3-O-methyltransferase    62.0    2e-08   
ref|XP_003626615.1|  Caffeic acid 3-O-methyltransferase               60.8    2e-08   
ref|XP_008358297.1|  PREDICTED: anthranilate N-methyltransferase-...  62.0    2e-08   
ref|XP_006495276.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.5    2e-08   
ref|XP_008348753.1|  PREDICTED: anthranilate N-methyltransferase-...  61.6    2e-08   
ref|XP_008376824.1|  PREDICTED: caffeic acid 3-O-methyltransferase    61.6    3e-08   
sp|O81646.1|COMT1_CAPCH  RecName: Full=Caffeic acid 3-O-methyltra...  61.6    3e-08   
ref|XP_010035325.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  61.6    3e-08   
ref|XP_006478226.1|  PREDICTED: anthranilate N-methyltransferase-...  61.6    3e-08   
ref|XP_006441468.1|  hypothetical protein CICLE_v10020874mg           61.6    3e-08   
gb|AAU20770.1|  (S)-scoulerine 9-O-methyltransferase                  61.6    3e-08   
gb|AFX98069.1|  caffeic acid O-methyltransferase                      61.6    3e-08   
ref|XP_008357058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  61.6    3e-08   
ref|XP_010107139.1|  Caffeic acid 3-O-methyltransferase               61.2    3e-08   
gb|AFK42771.1|  unknown                                               61.2    4e-08   
ref|XP_010527383.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  61.2    4e-08   
ref|XP_007032646.1|  Caffeic acid 3-O-methyltransferase 1             61.2    4e-08   
gb|AGS49216.1|  O-methyltransferase                                   61.2    4e-08   
dbj|BAM05583.1|  caffeic acid O-methyltransferase 2                   60.8    4e-08   
ref|XP_006493515.1|  PREDICTED: anthranilate N-methyltransferase-...  61.2    4e-08   
ref|XP_003626614.1|  Caffeic acid 3-O-methyltransferase               61.2    4e-08   
gb|KDO36328.1|  hypothetical protein CISIN_1g036971mg                 59.7    4e-08   
ref|XP_006829216.1|  hypothetical protein AMTR_s00001p00272250        60.8    4e-08   
gb|KDP37670.1|  hypothetical protein JCGZ_06898                       60.8    5e-08   
gb|AAG43822.1|AF212316_1  caffeic acid O-methyltransferase            60.8    5e-08   
dbj|BAM05582.1|  caffeic acid O-methyltransferase 2                   60.8    5e-08   
sp|Q9FQY8.2|COMT1_CAPAN  RecName: Full=Caffeic acid 3-O-methyltra...  60.8    5e-08   
ref|XP_010261275.1|  PREDICTED: LOW QUALITY PROTEIN: (S)-scouleri...  60.8    5e-08   
ref|XP_002302677.1|  eugenol O-methyltransferase family protein       60.5    5e-08   
ref|XP_010230425.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  60.8    6e-08   
ref|XP_006441607.1|  hypothetical protein CICLE_v10020880mg           60.5    6e-08   
ref|XP_010660322.1|  PREDICTED: caffeic acid 3-O-methyltransferase    60.5    6e-08   
gb|AAD50440.1|AF168777_1  caffeic acid O-methyltransferase            60.5    6e-08   
ref|XP_006494834.1|  PREDICTED: anthranilate N-methyltransferase-...  60.5    6e-08   
ref|XP_009366585.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.5    7e-08   
gb|ADA61114.1|  caffeic acid o-methyltransferase                      60.5    7e-08   
ref|XP_006441605.1|  hypothetical protein CICLE_v10024367mg           57.8    7e-08   
gb|AFR39733.1|  caffeate O-methyltransferase                          57.8    7e-08   
ref|XP_004156527.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.5    8e-08   
ref|XP_002869540.1|  hypothetical protein ARALYDRAFT_913747           60.5    8e-08   
ref|XP_006441606.1|  hypothetical protein CICLE_v10023994mg           60.1    8e-08   
ref|XP_010671879.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.1    8e-08   
ref|XP_010662844.1|  PREDICTED: caffeic acid O-methyltransferase ...  60.1    9e-08   
ref|XP_010267679.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.1    1e-07   
emb|CDP19753.1|  unnamed protein product                              60.1    1e-07   
ref|XP_009384375.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.1    1e-07   
ref|XP_009392797.1|  PREDICTED: flavone O-methyltransferase 1-like    60.1    1e-07   
gb|AAQ01670.1|  catechol O-methyltransferase                          59.7    1e-07   
ref|XP_008367482.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.7    1e-07   
gb|EYU19261.1|  hypothetical protein MIMGU_mgv1a026228mg              58.9    1e-07   
ref|XP_008803441.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.7    1e-07   
ref|XP_008364840.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.7    1e-07   
gb|AHN20046.1|  caffeic acid O-methyl transferase                     58.9    1e-07   
ref|XP_011069564.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.7    1e-07   
ref|XP_009420747.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.7    1e-07   
ref|XP_010520934.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.7    1e-07   
gb|ACJ84924.1|  unknown                                               58.2    1e-07   
gb|AGO50639.1|  caffeic acid O-methyltransferase                      59.3    1e-07   
ref|XP_001762717.1|  predicted protein                                59.7    2e-07   
ref|XP_006478994.1|  PREDICTED: anthranilate N-methyltransferase-...  57.4    2e-07   
ref|XP_009384387.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.3    2e-07   
ref|XP_004169230.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.5    2e-07   
ref|XP_009418619.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  57.8    2e-07   
sp|A8J6X1.1|BMT_GLELI  RecName: Full=Bergaptol O-methyltransferas...  59.3    2e-07   
gb|KDP32877.1|  hypothetical protein JCGZ_12169                       59.3    2e-07   
gb|EYU35612.1|  hypothetical protein MIMGU_mgv1a021833mg              58.2    2e-07   
ref|XP_010100665.1|  Anthranilate N-methyltransferase                 59.3    2e-07   
ref|XP_006478917.1|  PREDICTED: anthranilate N-methyltransferase-...  59.3    2e-07   
ref|XP_010541235.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.5    2e-07   
ref|XP_002869549.1|  hypothetical protein ARALYDRAFT_354029           59.3    2e-07   
ref|XP_010534702.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.9    2e-07   
gb|AGS49187.1|  O-methyltransferase                                   58.9    2e-07   
gb|ACJ76442.1|  caffeic acid 3-O-methyltransferase 2                  58.9    2e-07   
ref|XP_002321948.1|  Chain A family protein                           58.9    2e-07   
gb|ABK24146.1|  unknown                                               58.9    2e-07   
gb|KDP32878.1|  hypothetical protein JCGZ_12170                       58.9    2e-07   
ref|XP_008380838.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.9    2e-07   
sp|Q43047.1|COMT3_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...  58.9    2e-07   
ref|XP_004248417.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.9    2e-07   
gb|KHN06374.1|  Anthranilate N-methyltransferase                      58.9    2e-07   
gb|AAD48913.1|AF139533_1  caffeate O-methyltransferase                58.9    3e-07   
gb|AGS49199.1|  O-methyltransferase                                   58.9    3e-07   
ref|XP_002268308.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.9    3e-07   
gb|ABI54120.1|  caffeic acid O-methyltransferase                      58.9    3e-07   
dbj|BAC78826.1|  eugenol O-methyltransferase                          58.5    3e-07   
gb|ABI54118.1|  caffeic acid O-methyltransferase                      58.5    3e-07   
ref|XP_004148286.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.5    3e-07   
ref|XP_007219351.1|  hypothetical protein PRUPE_ppa019437mg           58.5    3e-07   
emb|CAC21601.1|  caffeic acid O-methyltransferase                     58.5    3e-07   
dbj|BAG71895.1|  5-hydroxyconiferaldehyde O-methyltransferase         58.5    3e-07   
gb|ABR17930.1|  unknown                                               58.5    3e-07   
gb|KDO40748.1|  hypothetical protein CISIN_1g0470001mg                55.5    3e-07   
ref|XP_002966220.1|  hypothetical protein SELMODRAFT_85878            58.5    3e-07   
gb|AGS49184.1|  O-methyltransferase                                   58.5    3e-07   
ref|XP_008343466.1|  PREDICTED: anthranilate N-methyltransferase-...  58.5    3e-07   
gb|AAZ32409.1|  S-methyltransferase                                   58.2    4e-07   
gb|AGS49186.1|  O-methyltransferase                                   58.2    4e-07   
gb|AGS49209.1|  O-methyltransferase                                   58.2    4e-07   
gb|KDO38355.1|  hypothetical protein CISIN_1g024350mg                 57.4    4e-07   
ref|XP_008244208.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.2    4e-07   
ref|XP_006421071.1|  hypothetical protein CICLE_v10005251mg           58.2    5e-07   
ref|XP_006413044.1|  hypothetical protein EUTSA_v10027501mg           58.2    5e-07   
emb|CDP19755.1|  unnamed protein product                              58.2    5e-07   
gb|EYU31473.1|  hypothetical protein MIMGU_mgv1a026236mg              55.5    5e-07   
gb|AGI97942.1|  caffeic acid O-methyltransferase-like protein         58.2    5e-07   
ref|XP_009386883.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.2    5e-07   
ref|XP_010048410.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  57.8    5e-07   
sp|A9X7L0.1|ANMT_RUTGR  RecName: Full=Anthranilate N-methyltransf...  57.8    5e-07   
ref|XP_006443198.1|  hypothetical protein CICLE_v10021888mg           57.0    5e-07   
ref|XP_002992222.1|  hypothetical protein SELMODRAFT_134972           57.4    5e-07   
ref|XP_002966107.1|  hypothetical protein SELMODRAFT_85724            57.4    6e-07   
ref|NP_001280180.1|  uncharacterized protein LOC103342359             57.8    6e-07   
ref|XP_002300513.1|  eugenol O-methyltransferase family protein       57.8    6e-07   
gb|AFZ78574.1|  caffeic acid O-methyltransferase                      57.8    6e-07   
gb|ACF04799.1|  caffeic acid 3-O-methytransferase                     57.8    6e-07   
ref|XP_003634428.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  57.8    6e-07   
ref|XP_007211258.1|  hypothetical protein PRUPE_ppa021447mg           57.8    6e-07   
sp|Q39522.1|SMT_COPJA  RecName: Full=(S)-scoulerine 9-O-methyltra...  57.8    6e-07   
gb|AIY62319.1|  caffeic acid O-methyl transferase                     57.8    6e-07   
ref|XP_009386768.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  55.1    6e-07   
gb|AGS49206.1|  O-methyltransferase                                   57.8    6e-07   
ref|XP_006478995.1|  PREDICTED: anthranilate N-methyltransferase-...  57.4    7e-07   
ref|XP_006443208.1|  hypothetical protein CICLE_v10020820mg           57.4    7e-07   
ref|XP_011003285.1|  PREDICTED: caffeic acid 3-O-methyltransferase 3  57.4    7e-07   
gb|AFK35470.1|  unknown                                               57.4    7e-07   



>gb|KDP29212.1| hypothetical protein JCGZ_16601 [Jatropha curcas]
Length=357

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = +2

Query  68   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  247
            AM  ES  ++  ARL I+ELANMISVPMSLNA+VRLNVAD IWQGG+NAPLSASEIL+ V
Sbjct  2    AMEDESSESRNRARLAILELANMISVPMSLNAIVRLNVADVIWQGGANAPLSASEILARV  61

Query  248  LPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVL  427
             PSGG D +NLQRILRMLTSY VF EH+N+DA+ERRYSL E+GKTLVTD +GLSY +YVL
Sbjct  62   HPSGG-DPENLQRILRMLTSYDVFTEHVNSDATERRYSLTEIGKTLVTDSEGLSYASYVL  120

Query  428  QHHQDALMKAWPLVHXAVVDSSSE  499
            QHHQDALM+AWPLVH AVVD ++E
Sbjct  121  QHHQDALMRAWPLVHEAVVDPTTE  144



>ref|XP_004304330.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +2

Query  86   ESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  265
            + A   AR+ I+ELANMISVPMSLNAVVRLNVADAIWQ GSN PLSAS+IL  VLP+G G
Sbjct  8    KEASNEARIAILELANMISVPMSLNAVVRLNVADAIWQKGSNTPLSASQILERVLPTGSG  67

Query  266  DAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDA  445
            DA+NLQRILRMLTSYGVF EH NAD SER++SL EVG+TLVT++DGLSYG YVLQHHQD 
Sbjct  68   DAENLQRILRMLTSYGVFSEHFNADGSERKFSLTEVGQTLVTNQDGLSYGDYVLQHHQDV  127

Query  446  LMKAWPLVHXAVVDSSSE  499
            LM AWPLVH AV+D S E
Sbjct  128  LMGAWPLVHEAVIDPSVE  145



>ref|XP_008442758.1| PREDICTED: caffeic acid 3-O-methyltransferase [Cucumis melo]
Length=371

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  274
            Q  ARL I+ELANMISVPMSLNA+VRLNVADAIWQ GSN+PLSASEIL+ V+PSGGGDA 
Sbjct  24   QNKARLAILELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGGGDAH  83

Query  275  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  454
            NL+RILRMLTSYGVF EH++ ++S  RYSL +VGKTLVTD DGLSY  YVLQHHQDALM+
Sbjct  84   NLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDTDGLSYAPYVLQHHQDALMR  143

Query  455  AWPLVHXAVVDSSSE  499
            AWP VH A +DS++E
Sbjct  144  AWPRVHEAAIDSTTE  158



>ref|XP_004488687.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=353

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 2/140 (1%)
 Frame = +2

Query  80   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  259
            E   ++K ARL+I+ELANMISVPMSLNAVVRLNVADAIW+GGSNAPLSA +IL  VLP G
Sbjct  3    EDTDSRKQARLSILELANMISVPMSLNAVVRLNVADAIWEGGSNAPLSADQILKRVLPGG  62

Query  260  GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  439
            GGDA+NLQR+LRMLTSY VF EH+     ER+YSL +VGKTLVTD+ GLSYG+YVLQHHQ
Sbjct  63   GGDAENLQRVLRMLTSYDVFEEHLG--GGERKYSLTDVGKTLVTDEQGLSYGSYVLQHHQ  120

Query  440  DALMKAWPLVHXAVVDSSSE  499
            DALM+AWPLVH AVVD S E
Sbjct  121  DALMRAWPLVHEAVVDPSKE  140



>ref|XP_007027514.1| O-methyltransferase family protein [Theobroma cacao]
 gb|EOY08016.1| O-methyltransferase family protein [Theobroma cacao]
Length=356

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  E+  ++  ARL I+ELANM+SVPMSLNAVVRLNV DAIWQGG+N PLSA++ILS VL
Sbjct  1    MEDETADSRNKARLAILELANMMSVPMSLNAVVRLNVPDAIWQGGANTPLSATQILSRVL  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  430
            PSGGGD +NLQRILRMLTSYGVF EH++++  ERR+SL ++GKTLVTD DGLS   YVLQ
Sbjct  61   PSGGGDPENLQRILRMLTSYGVFAEHLDSECPERRFSLTDIGKTLVTDADGLSCAPYVLQ  120

Query  431  HHQDALMKAWPLVHXAVVDSSSE  499
            HHQDALM+ WPL+H AV+D +SE
Sbjct  121  HHQDALMRVWPLMHEAVLDPTSE  143



>ref|XP_011101458.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=354

 Score =   219 bits (557),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 123/139 (88%), Gaps = 1/139 (1%)
 Frame = +2

Query  86   ESAQKNARLT-IMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  262
            E++Q N+  T IMELANMISVPM+LNAVVRLNVADAIWQGGSN PLSA+EILS+     G
Sbjct  2    ENSQTNSPTTAIMELANMISVPMALNAVVRLNVADAIWQGGSNNPLSAAEILSAAAVGPG  61

Query  263  GDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  442
            GDA+NLQRILR+LTS+GVF EH+NADA++RRYSL EVGKTL TD++GLSYGAYVLQHHQD
Sbjct  62   GDAENLQRILRLLTSFGVFEEHLNADATKRRYSLTEVGKTLATDENGLSYGAYVLQHHQD  121

Query  443  ALMKAWPLVHXAVVDSSSE  499
            ALM+AW LVH AV+D SSE
Sbjct  122  ALMRAWTLVHEAVLDPSSE  140



>ref|XP_006594705.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Glycine max]
Length=298

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (86%), Gaps = 2/140 (1%)
 Frame = +2

Query  80   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  259
            ES   +K ARL IMELANMISVPM+LNAVVRLNVADAIWQGG+N PLSA+EIL  +LP+G
Sbjct  5    ESTEQRKQARLAIMELANMISVPMALNAVVRLNVADAIWQGGANNPLSAAEILPRLLPAG  64

Query  260  GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  439
            GGDA+NLQR+LRML SYGVF EH++  A ER+YSL +VGKTLVTD+ GLSY  YVLQHHQ
Sbjct  65   GGDAENLQRLLRMLASYGVFYEHLS--AGERKYSLTDVGKTLVTDEQGLSYAHYVLQHHQ  122

Query  440  DALMKAWPLVHXAVVDSSSE  499
            DALM+AWP+VH AVVD + E
Sbjct  123  DALMRAWPMVHEAVVDPTKE  142



>gb|AFK33955.1| unknown [Medicago truncatula]
Length=201

 Score =   213 bits (542),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 121/143 (85%), Gaps = 2/143 (1%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M   +  AQK ARL I+ELANMIS+PMSL+AVVRLNVADAIW+GG+NAPLSA++IL+ V+
Sbjct  1    MAETNTEAQKQARLAILELANMISIPMSLHAVVRLNVADAIWEGGANAPLSAAQILARVV  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  430
            P GGGDA+NLQR+LRML SYGVF EHI     ER+YSL  VGKTLV+D++G+SYGAYVLQ
Sbjct  61   PGGGGDAENLQRVLRMLASYGVFEEHIG--DGERKYSLTNVGKTLVSDENGVSYGAYVLQ  118

Query  431  HHQDALMKAWPLVHXAVVDSSSE  499
             HQDALM+AWPLVH AV+D S E
Sbjct  119  LHQDALMRAWPLVHEAVLDPSKE  141



>gb|KEH38506.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=354

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M   +  AQK ARL I+ELANMIS+PMSL+AVVRLNVADAIW+GG+NAPLSA++IL+ V+
Sbjct  1    MAETNTEAQKQARLAILELANMISIPMSLHAVVRLNVADAIWEGGANAPLSAAQILARVV  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  430
            P GGGDA+NLQR+LRML SYGVF EHI     ER+YSL  VGKTLV+D++G+SYGAYVLQ
Sbjct  61   PGGGGDAENLQRVLRMLASYGVFEEHIG--DGERKYSLTNVGKTLVSDENGVSYGAYVLQ  118

Query  431  HHQDALMKAWPLVHXAVVDSSSE  499
            HHQDALM+AWPLVH AV+D S E
Sbjct  119  HHQDALMRAWPLVHEAVLDPSKE  141



>ref|XP_006594704.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Glycine max]
Length=355

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
             ES   +K ARL IMELANMISVPM+LNAVVRLNVADAIWQGG+N PLSA+EIL  +LP+
Sbjct  4    EESTEQRKQARLAIMELANMISVPMALNAVVRLNVADAIWQGGANNPLSAAEILPRLLPA  63

Query  257  GGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHH  436
            GGGDA+NLQR+LRML SYGVF EH++  A ER+YSL +VGKTLVTD+ GLSY  YVLQHH
Sbjct  64   GGGDAENLQRLLRMLASYGVFYEHLS--AGERKYSLTDVGKTLVTDEQGLSYAHYVLQHH  121

Query  437  QDALMKAWPLVHXAVVDSSSE  499
            QDALM+AWP+VH AVVD + E
Sbjct  122  QDALMRAWPMVHEAVVDPTKE  142



>gb|KJB62321.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=248

 Score =   213 bits (542),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 6/144 (4%)
 Frame = +2

Query  83   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  262
            +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSGG
Sbjct  7    AESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGG  65

Query  263  GDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYVL  427
            GD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YVL
Sbjct  66   GDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVL  125

Query  428  QHHQDALMKAWPLVHXAVVDSSSE  499
            QHHQDALM+AWPLVH AV++ +SE
Sbjct  126  QHHQDALMRAWPLVHEAVLNPTSE  149



>gb|KJB62324.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=269

 Score =   214 bits (544),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 6/144 (4%)
 Frame = +2

Query  83   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  262
            +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSGG
Sbjct  7    AESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGG  65

Query  263  GDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYVL  427
            GD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YVL
Sbjct  66   GDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVL  125

Query  428  QHHQDALMKAWPLVHXAVVDSSSE  499
            QHHQDALM+AWPLVH AV++ +SE
Sbjct  126  QHHQDALMRAWPLVHEAVLNPTSE  149



>gb|KJB62322.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=258

 Score =   213 bits (541),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 6/145 (4%)
 Frame = +2

Query  80   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  259
             +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSG
Sbjct  6    RAESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSG  64

Query  260  GGDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYV  424
            GGD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YV
Sbjct  65   GGDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYV  124

Query  425  LQHHQDALMKAWPLVHXAVVDSSSE  499
            LQHHQDALM+AWPLVH AV++ +SE
Sbjct  125  LQHHQDALMRAWPLVHEAVLNPTSE  149



>ref|XP_008361606.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X2 [Malus domestica]
Length=278

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 125/155 (81%), Gaps = 3/155 (2%)
 Frame = +2

Query  44   ITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLS  223
            + G  ++  + +   S+   ARL I+ELANMISVPMSLNAVVRLNV DAIWQGG N PLS
Sbjct  1    MEGNNQVSNVTAGPSSSNNEARLAILELANMISVPMSLNAVVRLNVPDAIWQGGCNTPLS  60

Query  224  ASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTD  394
            AS++L+ V+P+GGGDA+NLQRILRMLTSYGVF EH+ N D  + +R++SL  +G+TLVTD
Sbjct  61   ASDVLARVIPNGGGDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTD  120

Query  395  KDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            ++GLSYG YVLQHHQD LM AWP+VH AVVDS+ E
Sbjct  121  QNGLSYGPYVLQHHQDVLMGAWPMVHEAVVDSTVE  155



>gb|KGN59032.1| hypothetical protein Csa_3G747630 [Cucumis sativus]
Length=370

 Score =   214 bits (546),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 117/135 (87%), Gaps = 1/135 (1%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  274
            Q  ARL I+ELANMISVPMSLNA+VRLNVADAIWQ GSN+PLSASEIL+ V+PSGG DA 
Sbjct  24   QNKARLAIIELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGG-DAH  82

Query  275  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  454
            NL+RILRMLTSYGVF EH++ ++S  RYSL +VGKTLVTD DGLSY  YVLQHHQDALM+
Sbjct  83   NLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDSDGLSYAPYVLQHHQDALMR  142

Query  455  AWPLVHXAVVDSSSE  499
            AWP VH A +DS++E
Sbjct  143  AWPRVHEAAIDSTTE  157



>gb|KJB62323.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=347

 Score =   214 bits (544),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 6/144 (4%)
 Frame = +2

Query  83   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  262
            +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSGG
Sbjct  7    AESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGG  65

Query  263  GDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYVL  427
            GD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YVL
Sbjct  66   GDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVL  125

Query  428  QHHQDALMKAWPLVHXAVVDSSSE  499
            QHHQDALM+AWPLVH AV++ +SE
Sbjct  126  QHHQDALMRAWPLVHEAVLNPTSE  149



>ref|XP_009341082.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Pyrus 
x bretschneideri]
Length=369

 Score =   214 bits (545),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 3/142 (2%)
 Frame = +2

Query  83   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  262
            S S+   ARL I+ELANMISVPMSLNAVVRLNVADAIWQGG N PLSAS+IL+ VLP+GG
Sbjct  15   SSSSSNEARLAILELANMISVPMSLNAVVRLNVADAIWQGGCNTPLSASDILARVLPNGG  74

Query  263  GDAQNLQRILRMLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTDKDGLSYGAYVLQH  433
            GDA+NLQRILRMLTSYGVF EH+ N D  + +R++SL  +G+TLVTD++GLSYG YVLQH
Sbjct  75   GDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQH  134

Query  434  HQDALMKAWPLVHXAVVDSSSE  499
            HQD LM AWP+VH AVVDS+ E
Sbjct  135  HQDVLMGAWPMVHEAVVDSTVE  156



>gb|KJB62320.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=361

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 6/144 (4%)
 Frame = +2

Query  83   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  262
            +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSGG
Sbjct  7    AESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGG  65

Query  263  GDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYVL  427
            GD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YVL
Sbjct  66   GDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVL  125

Query  428  QHHQDALMKAWPLVHXAVVDSSSE  499
            QHHQDALM+AWPLVH AV++ +SE
Sbjct  126  QHHQDALMRAWPLVHEAVLNPTSE  149



>ref|XP_004137858.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 ref|XP_004169388.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=409

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 117/135 (87%), Gaps = 1/135 (1%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  274
            Q  ARL I+ELANMISVPMSLNA+VRLNVADAIWQ GSN+PLSASEIL+ V+PSGG DA 
Sbjct  61   QNKARLAIIELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGG-DAH  119

Query  275  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  454
            NL+RILRMLTSYGVF EH++ ++S  RYSL +VGKTLVTD DGLSY  YVLQHHQDALM+
Sbjct  120  NLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDSDGLSYAPYVLQHHQDALMR  179

Query  455  AWPLVHXAVVDSSSE  499
            AWP VH A +DS++E
Sbjct  180  AWPRVHEAAIDSTTE  194



>ref|XP_006381360.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59157.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=270

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 120/151 (79%), Gaps = 8/151 (5%)
 Frame = +2

Query  68   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  247
            A+  ES   +K+ARL I ELANMISVPMSLNA+VRL VADAIWQGGSNAPLSAS+IL  +
Sbjct  2    ALNEESAEKRKSARLAIFELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRI  61

Query  248  LPSGGGDAQNLQRILRMLTSYGVFREHINADA-------SERRYSLGEVGKTLVTDKDGL  406
              S G D +NLQRILRMLTSYGVF EH+  ++       SER+YSL EVGKTLVTD +GL
Sbjct  62   A-STGSDPENLQRILRMLTSYGVFEEHLTIESSPLDGSVSERKYSLTEVGKTLVTDTEGL  120

Query  407  SYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            SY  YVLQHHQDALMKAWPLVH AV+D ++E
Sbjct  121  SYAPYVLQHHQDALMKAWPLVHEAVLDPTTE  151



>ref|XP_007149437.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
 gb|ESW21431.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
Length=354

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 2/143 (1%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  ES  ++K +RL IMELANMISVPM+LNAVVRLNVADAIW GG+NAPLSA++IL  +L
Sbjct  1    MEEESTDSRKQSRLAIMELANMISVPMALNAVVRLNVADAIWNGGANAPLSAAQILPRIL  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  430
            P G GDA+NLQR+LR+LTSYGVF EH+   A ER+YSL +VGK LVTD+ GLSYGAYVLQ
Sbjct  61   PVGDGDAENLQRLLRILTSYGVFHEHLA--AGERKYSLTDVGKALVTDEQGLSYGAYVLQ  118

Query  431  HHQDALMKAWPLVHXAVVDSSSE  499
            HHQDALM+AW LVH AVVD + E
Sbjct  119  HHQDALMRAWTLVHEAVVDPTKE  141



>ref|XP_007202084.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
 gb|EMJ03283.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
Length=368

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 121/146 (83%), Gaps = 5/146 (3%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
            + +E     ARL I+ELANMISVPMSLNAVVRLNV DAIWQGGSN+PLSAS ILS VLP 
Sbjct  10   TTAEQPSNEARLGILELANMISVPMSLNAVVRLNVPDAIWQGGSNSPLSASAILSHVLPD  69

Query  257  GGGDAQNLQRILRMLTSYGVFREH-INAD----ASERRYSLGEVGKTLVTDKDGLSYGAY  421
            GGGDA+NLQRILRMLTSYGVF EH ++AD    + +R++SL E+GKTLVTD++GLSYG Y
Sbjct  70   GGGDAENLQRILRMLTSYGVFAEHLVSADDDGGSHQRKFSLTEIGKTLVTDQNGLSYGPY  129

Query  422  VLQHHQDALMKAWPLVHXAVVDSSSE  499
            +LQHHQD LM AWP+VH AVVD + E
Sbjct  130  ILQHHQDVLMGAWPMVHEAVVDPTIE  155



>gb|KHG05883.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=361

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 6/144 (4%)
 Frame = +2

Query  83   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  262
            +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLSA +ILS VLP GG
Sbjct  7    AESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSAVQILSRVLPYGG  65

Query  263  GDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYVL  427
            GD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YVL
Sbjct  66   GDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVL  125

Query  428  QHHQDALMKAWPLVHXAVVDSSSE  499
            QHHQDALM+AWPLVH AV++ +SE
Sbjct  126  QHHQDALMRAWPLVHEAVLNPTSE  149



>ref|XP_011018830.1| PREDICTED: caffeic acid 3-O-methyltransferase [Populus euphratica]
Length=364

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 121/151 (80%), Gaps = 8/151 (5%)
 Frame = +2

Query  68   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  247
            A+  ES   +K+ARL I+ELANMISVPMSLNA+VRL VADAIWQGGSNAPLSAS+IL  +
Sbjct  2    ALNEESAEKRKSARLAILELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRI  61

Query  248  LPSGGGDAQNLQRILRMLTSYGVFREH-------INADASERRYSLGEVGKTLVTDKDGL  406
              S G D +NLQRILRMLTSYGVF EH       ++  ASER+YSL EVGKTLVTD +GL
Sbjct  62   A-STGSDPENLQRILRMLTSYGVFEEHLTNESSPLDGSASERKYSLTEVGKTLVTDTEGL  120

Query  407  SYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            SY  YVLQHHQDALMKAWPLVH AV+D ++E
Sbjct  121  SYAPYVLQHHQDALMKAWPLVHEAVLDPTTE  151



>ref|XP_006598126.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=356

 Score =   211 bits (537),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 117/142 (82%), Gaps = 3/142 (2%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP-  253
             ES   +K A L IMELANMISVPM+LNAVVRLNVADA+WQGG+NAPLSASEIL  +LP 
Sbjct  4    EESTEQRKQAMLAIMELANMISVPMALNAVVRLNVADALWQGGANAPLSASEILPRILPG  63

Query  254  SGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQH  433
            + G DA+NLQR+LRML SYGVFREH+   A ER YSL EVGKTLVTD+ GLSY  YVLQH
Sbjct  64   ADGADAENLQRLLRMLASYGVFREHLA--AGERNYSLTEVGKTLVTDEQGLSYAHYVLQH  121

Query  434  HQDALMKAWPLVHXAVVDSSSE  499
            HQDALM+AWPLVH AVVD + E
Sbjct  122  HQDALMRAWPLVHEAVVDPTKE  143



>ref|XP_006367254.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Solanum tuberosum]
Length=361

 Score =   211 bits (538),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +2

Query  104  ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL-PSGGGDAQNL  280
            ARL IMELANMISVPMSLNAVV+L VADAIWQ GSNAPLS  EIL+ +  P GGGDA+NL
Sbjct  15   ARLAIMELANMISVPMSLNAVVKLKVADAIWQNGSNAPLSPVEILAKIRGPQGGGDAENL  74

Query  281  QRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  460
            QRILRMLTSYGVF+EH+  D+S+RRYSL EVGKTLVTD++GLS+G+YVLQHHQDALM+AW
Sbjct  75   QRILRMLTSYGVFKEHVVDDSSQRRYSLTEVGKTLVTDENGLSHGSYVLQHHQDALMRAW  134

Query  461  PLVHXAVVDSSSE  499
             +VH AV DSS E
Sbjct  135  TMVHEAVNDSSIE  147



>ref|XP_008241354.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=368

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 117/146 (80%), Gaps = 5/146 (3%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
            + +E     ARL I+ELANMISVPMSLNAVVRLNV DAIWQ GSN PLSAS IL+ VLP 
Sbjct  10   TTAEQPSNEARLGILELANMISVPMSLNAVVRLNVPDAIWQAGSNTPLSASAILARVLPD  69

Query  257  GGGDAQNLQRILRMLTSYGVFREHI-----NADASERRYSLGEVGKTLVTDKDGLSYGAY  421
            GGGDA+NLQRILRMLTSYGVF EH+     +  + +R++SL E+GKTLVTD++GLSYG Y
Sbjct  70   GGGDAENLQRILRMLTSYGVFEEHLIKEDDDGGSQQRKFSLTEIGKTLVTDQNGLSYGPY  129

Query  422  VLQHHQDALMKAWPLVHXAVVDSSSE  499
            +LQHHQD LM AWP+VH AVVD + E
Sbjct  130  ILQHHQDVLMGAWPMVHEAVVDPTVE  155



>ref|XP_006381361.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59158.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=364

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 120/151 (79%), Gaps = 8/151 (5%)
 Frame = +2

Query  68   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  247
            A+  ES   +K+ARL I ELANMISVPMSLNA+VRL VADAIWQGGSNAPLSAS+IL  +
Sbjct  2    ALNEESAEKRKSARLAIFELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRI  61

Query  248  LPSGGGDAQNLQRILRMLTSYGVFREHINADA-------SERRYSLGEVGKTLVTDKDGL  406
              S G D +NLQRILRMLTSYGVF EH+  ++       SER+YSL EVGKTLVTD +GL
Sbjct  62   A-STGSDPENLQRILRMLTSYGVFEEHLTIESSPLDGSVSERKYSLTEVGKTLVTDTEGL  120

Query  407  SYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            SY  YVLQHHQDALMKAWPLVH AV+D ++E
Sbjct  121  SYAPYVLQHHQDALMKAWPLVHEAVLDPTTE  151



>ref|XP_002519426.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF42840.1| o-methyltransferase, putative [Ricinus communis]
Length=357

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 123/145 (85%), Gaps = 3/145 (2%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M +ES   +KNA+L I+ELANMISVPMSLNAVV+LNVADAIWQ G N+PLSASEILS + 
Sbjct  1    MENESSETRKNAKLAIIELANMISVPMSLNAVVQLNVADAIWQNGVNSPLSASEILSRIN  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINA--DASERRYSLGEVGKTLVTDKDGLSYGAYV  424
             SGG D  NLQRILRML+SY VF EH++A    +ERRYSL E+GKTLVTD +GLSYGAYV
Sbjct  61   LSGG-DPDNLQRILRMLSSYNVFTEHLSAVDGVTERRYSLTEIGKTLVTDVNGLSYGAYV  119

Query  425  LQHHQDALMKAWPLVHXAVVDSSSE  499
            LQHHQDALM+AWPLVH AV+DS++E
Sbjct  120  LQHHQDALMRAWPLVHEAVLDSTTE  144



>ref|XP_006367255.1| PREDICTED: caffeic acid 3-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=360

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  104  ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQ  283
            ARL IMELANMISVPMSLNA+++L VADAIW+GGSNAPLS +EIL+ + P GGGDA+NLQ
Sbjct  16   ARLAIMELANMISVPMSLNAIIKLKVADAIWEGGSNAPLSPAEILAKIRPQGGGDAENLQ  75

Query  284  RILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWP  463
            RILRMLTSY VF EH+  D S+RRYSL EVGKTLVTD++GLS+G YVLQHHQDALM+ W 
Sbjct  76   RILRMLTSYRVFEEHVVDDGSQRRYSLTEVGKTLVTDENGLSHGLYVLQHHQDALMRVWT  135

Query  464  LVHXAVVDSSSE  499
            +VH  V DSSS+
Sbjct  136  MVHETVNDSSSD  147



>ref|XP_010267318.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nelumbo nucifera]
Length=354

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 115/143 (80%), Gaps = 2/143 (1%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  E+   + NARL I+ELANMISVPMSLNA+VRL V DAIWQ GSN PLSASEIL+  L
Sbjct  1    MADETTEIRNNARLAILELANMISVPMSLNAIVRLKVPDAIWQSGSNVPLSASEILARAL  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  430
            P+G  D +NLQRILRMLT+Y VF EHI   +SER+YSL E+GKTLVTD +GLSY AYVLQ
Sbjct  61   PTG--DPENLQRILRMLTTYDVFSEHIADGSSERKYSLTEIGKTLVTDGEGLSYAAYVLQ  118

Query  431  HHQDALMKAWPLVHXAVVDSSSE  499
            HHQDALMKAWP++H AVVD   E
Sbjct  119  HHQDALMKAWPILHEAVVDPKEE  141



>ref|XP_008361604.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X1 [Malus domestica]
Length=281

 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 125/158 (79%), Gaps = 6/158 (4%)
 Frame = +2

Query  44   ITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLS  223
            + G  ++  + +   S+   ARL I+ELANMISVPMSLNAVVRLNV DAIWQGG N PLS
Sbjct  1    MEGNNQVSNVTAGPSSSNNEARLAILELANMISVPMSLNAVVRLNVPDAIWQGGCNTPLS  60

Query  224  ASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTD  394
            AS++L+ V+P+GGGDA+NLQRILRMLTSYGVF EH+ N D  + +R++SL  +G+TLVTD
Sbjct  61   ASDVLARVIPNGGGDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTD  120

Query  395  KDGLSYGAYVLQHHQ---DALMKAWPLVHXAVVDSSSE  499
            ++GLSYG YVLQHHQ   D LM AWP+VH AVVDS+ E
Sbjct  121  QNGLSYGPYVLQHHQLFKDVLMGAWPMVHEAVVDSTVE  158



>ref|XP_006428524.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
 gb|ESR41764.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
Length=261

 Score =   206 bits (525),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
            +E     K  RL IMELANMISVPMSL A +RL+V DAIWQGG+N PLSAS+IL+ +LPS
Sbjct  4    NECRDGGKKVRLAIMELANMISVPMSLTAAIRLHVPDAIWQGGANTPLSASQILTRILPS  63

Query  257  GGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHH  436
            GGGDA+NLQRILR+LTSYGVF EH      ER+YSL E+GK+LVTD +GLSY  YVLQHH
Sbjct  64   GGGDAENLQRILRLLTSYGVFSEH-REFGGERKYSLTEIGKSLVTDAEGLSYAPYVLQHH  122

Query  437  QDALMKAWPLVHXAVVDSSSE  499
            QDALM AWPLVH AV+D + E
Sbjct  123  QDALMSAWPLVHEAVLDPTIE  143



>ref|XP_009341081.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X1 [Pyrus 
x bretschneideri]
Length=372

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 121/145 (83%), Gaps = 6/145 (4%)
 Frame = +2

Query  83   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  262
            S S+   ARL I+ELANMISVPMSLNAVVRLNVADAIWQGG N PLSAS+IL+ VLP+GG
Sbjct  15   SSSSSNEARLAILELANMISVPMSLNAVVRLNVADAIWQGGCNTPLSASDILARVLPNGG  74

Query  263  GDAQNLQRILRMLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTDKDGLSYGAYVLQH  433
            GDA+NLQRILRMLTSYGVF EH+ N D  + +R++SL  +G+TLVTD++GLSYG YVLQH
Sbjct  75   GDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQH  134

Query  434  HQ---DALMKAWPLVHXAVVDSSSE  499
            HQ   D LM AWP+VH AVVDS+ E
Sbjct  135  HQLFKDVLMGAWPMVHEAVVDSTVE  159



>ref|XP_010504072.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=385

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 125/155 (81%), Gaps = 2/155 (1%)
 Frame = +2

Query  35   EKQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNA  214
            E++IT K++ + M  ES  ++  ARL I+ELANMISVPMSLNA V+L +ADAIW GG+N+
Sbjct  20   EEKITNKQK-KKMEKESSESRNRARLAILELANMISVPMSLNAAVKLGIADAIWNGGANS  78

Query  215  PLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTD  394
            PLSA+EILS +L   GGD +NLQRILR LTSYGVF EH+   ++ER+YSL +VGKTLVTD
Sbjct  79   PLSAAEILSRLLLQSGGDPENLQRILRTLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTD  137

Query  395  KDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
              GLSY AYVLQHHQDALM+AWPLVH AVV+  +E
Sbjct  138  SGGLSYAAYVLQHHQDALMRAWPLVHTAVVEPETE  172



>ref|XP_010312333.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Solanum lycopersicum]
Length=361

 Score =   206 bits (524),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = +2

Query  68   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  247
            A G  S +   + RL IMELANMISVPMSLNAVV+L V DA+W+ GSNAPLS  EIL+ +
Sbjct  4    ANGEPSNNNNNDERLAIMELANMISVPMSLNAVVKLKVTDAVWENGSNAPLSPVEILAKI  63

Query  248  L-PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYV  424
              P GGGDA+NLQRILRMLTSYGVF+EH++ D S+RRYSL +VGKTLVTD++GLS+G+YV
Sbjct  64   RGPQGGGDAENLQRILRMLTSYGVFKEHVD-DGSQRRYSLTKVGKTLVTDENGLSHGSYV  122

Query  425  LQHHQDALMKAWPLVHXAVVDSSSE  499
            LQHHQDALMKAW +VH AV DSS E
Sbjct  123  LQHHQDALMKAWTMVHEAVNDSSIE  147



>ref|XP_010426946.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=356

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 118/144 (82%), Gaps = 2/144 (1%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  ES  ++  ARL I+ELANMISVPMSLNA V+L +ADAIW  G+N+PLSA+EIL  +L
Sbjct  1    MEKESSESRNRARLAILELANMISVPMSLNAAVKLGIADAIWNDGTNSPLSAAEILPRLL  60

Query  251  -PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVL  427
             PSGGGD +NLQRILRMLTSYGVF EH+   ++ER+YSL +VGKTLVTD  GLSY AYVL
Sbjct  61   LPSGGGDPENLQRILRMLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGGLSYAAYVL  119

Query  428  QHHQDALMKAWPLVHXAVVDSSSE  499
            QHHQDALM+AWPLVH AVV+  +E
Sbjct  120  QHHQDALMRAWPLVHTAVVEPETE  143



>ref|XP_010515802.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=355

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  ES  ++  ARL I+ELANMISVPMSLNA V+L +ADA+W GG+N+PLSA+EIL+ +L
Sbjct  1    MEKESSESRNRARLAILELANMISVPMSLNAAVKLGIADAVWNGGTNSPLSAAEILTRLL  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  430
               GGD +NLQRILRMLTSYGVF EH+   ++ER+YSL +VGKTLVTD  GLSY AYVLQ
Sbjct  61   LPSGGDPENLQRILRMLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGGLSYAAYVLQ  119

Query  431  HHQDALMKAWPLVHXAVVDSSSE  499
            HHQDALM+AWPLVH AVV+  +E
Sbjct  120  HHQDALMRAWPLVHTAVVEPETE  142



>ref|XP_006291371.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
 gb|EOA24269.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
Length=359

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 119/147 (81%), Gaps = 5/147 (3%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  ES  ++  ARL IMELANMISVPMSLNA VRL +ADAIW GG+N+PLSASEIL  +L
Sbjct  1    MEKESSESRNRARLAIMELANMISVPMSLNAAVRLGIADAIWNGGANSPLSASEILPRLL  60

Query  251  -PSG---GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  418
             PS    GGD +NLQRILRMLTSYGVF EH+   +SER++SL +VGKTLVTD DGLSY A
Sbjct  61   IPSATTTGGDPENLQRILRMLTSYGVFSEHL-VGSSERKFSLTDVGKTLVTDSDGLSYAA  119

Query  419  YVLQHHQDALMKAWPLVHXAVVDSSSE  499
            Y+LQHHQ+ALM+AWPLVH AVV+  +E
Sbjct  120  YILQHHQEALMRAWPLVHTAVVEPETE  146



>emb|CAN65776.1| hypothetical protein VITISV_030414 [Vitis vinifera]
Length=358

 Score =   204 bits (518),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 6/147 (4%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  E+  ++  ARL I+EL NMISVPM L+A+VRLNV DAIWQGGSNAPLSAS+IL+ VL
Sbjct  1    MEDETLESRNQARLAILELTNMISVPMCLHAIVRLNVPDAIWQGGSNAPLSASQILTRVL  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINADASE----RRYSLGEVGKTLVTDKDGLSYGA  418
            PS  GD  NLQRILR+LT+YGVF EH+  D S     R+YSL ++GKTLVTD DGLSYGA
Sbjct  61   PS--GDPHNLQRILRLLTTYGVFAEHLLTDPSSDQVLRKYSLTDIGKTLVTDADGLSYGA  118

Query  419  YVLQHHQDALMKAWPLVHXAVVDSSSE  499
            YVLQH+Q+ LM AWPLVH AVVDS++E
Sbjct  119  YVLQHYQEELMTAWPLVHEAVVDSTTE  145



>ref|XP_002264566.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=358

 Score =   204 bits (518),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 6/147 (4%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  E+  ++  ARL I+EL NMISVPM L+A+VRLNV DAIWQGGSNAPLSAS+IL+ VL
Sbjct  1    MEDETLESRNQARLAILELTNMISVPMCLHAIVRLNVPDAIWQGGSNAPLSASQILTRVL  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINADASE----RRYSLGEVGKTLVTDKDGLSYGA  418
            PS  GD  NLQRILR+LT+YGVF EH+  D S     R+YSL ++GKTLVTD DGLSYGA
Sbjct  61   PS--GDPHNLQRILRLLTTYGVFAEHLLTDPSSDQVLRKYSLTDIGKTLVTDADGLSYGA  118

Query  419  YVLQHHQDALMKAWPLVHXAVVDSSSE  499
            YVLQH+Q+ LM AWPLVH AVVDS++E
Sbjct  119  YVLQHYQEELMTAWPLVHEAVVDSTTE  145



>ref|XP_010050337.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 119/147 (81%), Gaps = 4/147 (3%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  E+  A+  ARL I+ELANMISVPMSLNAVVRL V DA+WQGGSNAPLSASEIL+   
Sbjct  1    MADETSDARNAARLRILELANMISVPMSLNAVVRLGVPDALWQGGSNAPLSASEILARSP  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHI----NADASERRYSLGEVGKTLVTDKDGLSYGA  418
             +  GDA+NLQR+LRML S+GVF EH+    ++ +SERRYSL EVGKTLVTD +GLSY  
Sbjct  61   AAPAGDAENLQRLLRMLASHGVFEEHVAPAASSASSERRYSLTEVGKTLVTDAEGLSYAP  120

Query  419  YVLQHHQDALMKAWPLVHXAVVDSSSE  499
            YVLQHHQDALM+AWPLVH AV+D ++E
Sbjct  121  YVLQHHQDALMRAWPLVHEAVLDPATE  147



>ref|XP_006391885.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
 gb|ESQ29171.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
Length=363

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 117/150 (78%), Gaps = 7/150 (5%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  ES  ++  ARL IMELANMISVPMSLNA VRL +ADAIW  G+N+PLSASEIL  +L
Sbjct  1    MEDESSESRNKARLAIMELANMISVPMSLNAAVRLGIADAIWNSGANSPLSASEILPRLL  60

Query  251  -PSG----GGDAQNLQRILRMLTSYGVFREHINADAS--ERRYSLGEVGKTLVTDKDGLS  409
             PS     GGD +NLQRILRMLTSYGVF EH+N DA   ER+YSL  VGKTLVTD  GLS
Sbjct  61   LPSRDSTIGGDPENLQRILRMLTSYGVFSEHLNGDAGSVERKYSLTNVGKTLVTDSGGLS  120

Query  410  YGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            Y AYVLQHHQ++LM+AWPLVH AVV+  +E
Sbjct  121  YAAYVLQHHQESLMRAWPLVHTAVVEPETE  150



>ref|XP_010546519.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=354

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 114/143 (80%), Gaps = 2/143 (1%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  ES   +  ARL IMELANMISVPMSLNA V+L VADAIW GG+N+P+SA+EILS   
Sbjct  1    MEHESSERRNRARLAIMELANMISVPMSLNAAVKLGVADAIWCGGANSPISAAEILSRCC  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  430
              G G  +NLQRILRMLTSYGVF EH + D SER+YSL +VGKTLVTD DGLSYG+YVLQ
Sbjct  61   -GGAGGPENLQRILRMLTSYGVFSEHFSGD-SERKYSLTDVGKTLVTDSDGLSYGSYVLQ  118

Query  431  HHQDALMKAWPLVHXAVVDSSSE  499
            HHQ+ALM+AWPLVH AV D + E
Sbjct  119  HHQEALMRAWPLVHTAVEDPTRE  141



>ref|XP_010271244.1| PREDICTED: uncharacterized protein LOC104607311 isoform X2 [Nelumbo 
nucifera]
Length=210

 Score =   196 bits (497),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 109/143 (76%), Gaps = 2/143 (1%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  E    + NARL I+ELANMISVPMSLNA+V L V DAIWQG SN PLSASE+L+ VL
Sbjct  1    MADEKTETRNNARLAILELANMISVPMSLNAIVCLKVPDAIWQGSSNIPLSASEVLAHVL  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  430
            P+G  +++NL+RILRM TSY VF EHI    SER+YSL E+GK LVTD +GLSY  YVLQ
Sbjct  61   PTG--NSENLRRILRMFTSYDVFSEHIADGFSERKYSLTEIGKILVTDGEGLSYAVYVLQ  118

Query  431  HHQDALMKAWPLVHXAVVDSSSE  499
            HHQD L+KAWPL H AVVD   E
Sbjct  119  HHQDTLVKAWPLQHEAVVDLKEE  141



>ref|XP_006403721.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
 gb|ESQ45174.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
Length=361

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 115/148 (78%), Gaps = 5/148 (3%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  ES  ++  ARL IMELANMISVPMSLNA V+L +ADAIW  G+N+PLSA+EIL  +L
Sbjct  1    MEDESSESRNKARLAIMELANMISVPMSLNAAVKLGIADAIWNAGANSPLSAAEILPRLL  60

Query  251  PSG-----GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  415
             S       GD +NLQRILRMLTSYGVF EHIN  + ER+YSL +VGKTLVTD  GLSY 
Sbjct  61   LSSSTTTIAGDPENLQRILRMLTSYGVFSEHINGSSVERKYSLTDVGKTLVTDSGGLSYA  120

Query  416  AYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            AYVLQHHQ+ALM+AWPLVH AV++  +E
Sbjct  121  AYVLQHHQEALMRAWPLVHTAVMEPETE  148



>ref|XP_010271241.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271242.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271243.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
Length=248

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 109/143 (76%), Gaps = 2/143 (1%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  E    + NARL I+ELANMISVPMSLNA+V L V DAIWQG SN PLSASE+L+ VL
Sbjct  1    MADEKTETRNNARLAILELANMISVPMSLNAIVCLKVPDAIWQGSSNIPLSASEVLAHVL  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  430
            P+G  +++NL+RILRM TSY VF EHI    SER+YSL E+GK LVTD +GLSY  YVLQ
Sbjct  61   PTG--NSENLRRILRMFTSYDVFSEHIADGFSERKYSLTEIGKILVTDGEGLSYAVYVLQ  118

Query  431  HHQDALMKAWPLVHXAVVDSSSE  499
            HHQD L+KAWPL H AVVD   E
Sbjct  119  HHQDTLVKAWPLQHEAVVDLKEE  141



>ref|XP_009617330.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Nicotiana tomentosiformis]
Length=366

 Score =   199 bits (505),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 119/147 (81%), Gaps = 6/147 (4%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
             E+ +   NARL IMELANMISVPMSLNA+VRL VADAIW+GGSNAPLS +EILS +  S
Sbjct  6    CEASNNNNNARLAIMELANMISVPMSLNAIVRLKVADAIWEGGSNAPLSPTEILSKIRAS  65

Query  257  ------GGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  418
                  GGGDA+NLQRILRMLTSY VF EHI  D S+RRYSL EVGKTLVTD++GLSYG+
Sbjct  66   EGGGGGGGGDAENLQRILRMLTSYDVFAEHIVDDGSQRRYSLTEVGKTLVTDENGLSYGS  125

Query  419  YVLQHHQDALMKAWPLVHXAVVDSSSE  499
            YVLQHHQDALM AW +V  AV DSS+E
Sbjct  126  YVLQHHQDALMSAWTMVDEAVNDSSTE  152



>ref|NP_190882.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
 gb|AAK56277.1|AF367289_1 AT3g53140/T4D2_70 [Arabidopsis thaliana]
 emb|CAB64217.1| caffeic acid O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM91448.1| AT3g53140/T4D2_70 [Arabidopsis thaliana]
 gb|AEE79041.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
Length=359

 Score =   198 bits (504),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 118/147 (80%), Gaps = 5/147 (3%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV-  247
            M +ES  ++  ARL IMELANMISVPMSLNA VRL +ADAIW GG+N+PLSA+EIL  + 
Sbjct  1    MENESSESRNRARLAIMELANMISVPMSLNAAVRLGIADAIWNGGANSPLSAAEILPRLH  60

Query  248  LPSG---GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  418
            LPS    GGD +NLQRILRMLTSYGVF EH+   + ER+YSL +VGKTLVTD  GLSY A
Sbjct  61   LPSHTTIGGDPENLQRILRMLTSYGVFSEHL-VGSIERKYSLTDVGKTLVTDSGGLSYAA  119

Query  419  YVLQHHQDALMKAWPLVHXAVVDSSSE  499
            YVLQHHQ+ALM+AWPLVH AVV+  +E
Sbjct  120  YVLQHHQEALMRAWPLVHTAVVEPETE  146



>ref|XP_009774776.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana sylvestris]
Length=252

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 116/152 (76%), Gaps = 6/152 (4%)
 Frame = +2

Query  62   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  241
            +E    E+ +   NARL IMELANMISVPMSLNAVVRL VADAIW+GGSNAPLS +EIL+
Sbjct  1    MENRNGEASNNNNNARLAIMELANMISVPMSLNAVVRLKVADAIWEGGSNAPLSPTEILA  60

Query  242  SVLPSGGGDAQ------NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDG  403
             +  S GG         NLQRILRMLTSY VF EHI  D  +RRYSL EVGKTLVTDK+G
Sbjct  61   KISGSEGGGGAGGGDAENLQRILRMLTSYDVFAEHIVDDGPQRRYSLTEVGKTLVTDKNG  120

Query  404  LSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            LSYG+Y+LQHHQDALM AW +V  AV DSS+E
Sbjct  121  LSYGSYILQHHQDALMSAWTMVDEAVNDSSTE  152



>gb|KFK34550.1| hypothetical protein AALP_AA5G160800 [Arabis alpina]
Length=360

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 111/147 (76%), Gaps = 4/147 (3%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  ES   +  ARL IMELANMISVPMSLNA VRL +AD IW  G N+PLSA+EIL  +L
Sbjct  1    MEDESSERRNKARLAIMELANMISVPMSLNAAVRLGIADVIWNDGENSPLSAAEILPRLL  60

Query  251  -PSGG---GDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  418
             PS     GD +NLQRILRMLTSY VF EH+ A + ER+YSL +VGKTLVTD  GLSY A
Sbjct  61   LPSDTTITGDPENLQRILRMLTSYDVFSEHLAAGSVERKYSLTDVGKTLVTDSGGLSYAA  120

Query  419  YVLQHHQDALMKAWPLVHXAVVDSSSE  499
            YVLQHHQ+ALM+AWPLVH AVV   +E
Sbjct  121  YVLQHHQEALMRAWPLVHTAVVQPETE  147



>ref|XP_011098295.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=355

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = +2

Query  86   ESAQKNAR-LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  262
            E  Q N+  L IMELAN++SVPMSLNAV++L V D IWQ GSN PLSA+EILS++     
Sbjct  2    ERIQTNSPILAIMELANLVSVPMSLNAVIKLKVLDTIWQDGSNNPLSAAEILSAIALGPA  61

Query  263  GDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  442
            GDA+NLQRILR+LTSYGVF EHI  D  ERRYSL EVGK L  D++GLSY  Y+LQHHQD
Sbjct  62   GDAENLQRILRLLTSYGVFDEHIGKDGRERRYSLTEVGKALAADENGLSYAPYILQHHQD  121

Query  443  ALMKAWPLVHXAVVDSSSE  499
            ALM AWP VH AV+D SSE
Sbjct  122  ALMLAWPRVHEAVLDPSSE  140



>ref|XP_010098845.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB75933.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=359

 Score =   192 bits (487),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 113/148 (76%), Gaps = 7/148 (5%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  ES   +  ARL ++ELANMISVPMSLNAVVRL V DAIWQ GSN+PLSAS+IL+ VL
Sbjct  1    MEDESSEKRNQARLKVLELANMISVPMSLNAVVRLGVPDAIWQSGSNSPLSASQILTRVL  60

Query  251  P-----SGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  415
            P     +   D  NLQR+LR LTSYGVF EHI+ +   R+YSL +VGKTLVTD DGLSY 
Sbjct  61   PSSSSSAASADPDNLQRLLRTLTSYGVFSEHISGEI--RKYSLTDVGKTLVTDSDGLSYA  118

Query  416  AYVLQHHQDALMKAWPLVHXAVVDSSSE  499
             YVLQHHQDALM+AW L+H AVVD ++E
Sbjct  119  PYVLQHHQDALMRAWSLLHEAVVDPTTE  146



>emb|CDX76223.1| BnaA04g04870D [Brassica napus]
Length=268

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 114/148 (77%), Gaps = 7/148 (5%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV-  247
            M + S  ++  ARL IMELANMISVPMSLNA VRL +ADAIW  G N+PLSA+EIL  + 
Sbjct  1    MENGSSESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPLSATEILPRLH  60

Query  248  --LPSG--GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  415
                +G  GGD +NLQRILRMLTSYGVF EH+    + R+YS+ +VGKTLVTD DGLSY 
Sbjct  61   LTYQNGTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYA  118

Query  416  AYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            AYVLQHHQ+ALM+AWPLVH AVV+  +E
Sbjct  119  AYVLQHHQEALMRAWPLVHTAVVEPETE  146



>ref|XP_009139429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brassica rapa]
Length=359

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 114/148 (77%), Gaps = 7/148 (5%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV-  247
            M + S  ++  ARL IMELANMISVPMSLNA VRL +ADAIW  G N+PLSA+EIL  + 
Sbjct  1    MENGSSESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPLSAAEILPRLH  60

Query  248  --LPSG--GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  415
                +G  GGD +NLQRILRMLTSYGVF EH+    + R+YS+ +VGKTLVTD DGLSY 
Sbjct  61   LTYQNGTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYA  118

Query  416  AYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            AYVLQHHQ+ALM+AWPLVH AVV+  +E
Sbjct  119  AYVLQHHQEALMRAWPLVHTAVVEPETE  146



>ref|XP_011101457.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=360

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MELAN++SVPMSLNAV++L V D IWQ G N PLSA+EILS+V      DA+NLQRILR+
Sbjct  1    MELANLVSVPMSLNAVIKLKVLDTIWQDGFNNPLSAAEILSAVAVGPHADAENLQRILRL  60

Query  299  LTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXA  478
            LTSYGVF EHI  D S RRYSL EVGK L TD++GLSY  YVLQHHQDA+M AWPLVH A
Sbjct  61   LTSYGVFNEHIAGDGSGRRYSLTEVGKALATDENGLSYAPYVLQHHQDAIMLAWPLVHEA  120

Query  479  VVDSSSE  499
            V+D SSE
Sbjct  121  VLDPSSE  127



>emb|CDX95399.1| BnaC04g27590D [Brassica napus]
Length=359

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 7/148 (5%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV-  247
            M + S  ++  ARL IMELANMISVPMSLNA VRL +ADAIW  G N+P+SA+EIL  + 
Sbjct  1    MENGSSESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPVSAAEILPRLH  60

Query  248  --LPSG--GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  415
                +G  GGD +NLQRILRMLTSYGVF EH+    + R+YS+ +VGKTLVTD DGLSY 
Sbjct  61   LTYQNGTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYA  118

Query  416  AYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            AYVLQHHQ+ALM+AWPLVH AVV+  +E
Sbjct  119  AYVLQHHQEALMRAWPLVHTAVVEPETE  146



>ref|XP_004502926.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=361

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = +2

Query  89   SAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  268
             AQ   RL I+E+A+M+SVPMSL AV+ + V DAIWQGG+N PLSASEIL+ V P+GGGD
Sbjct  13   KAQSKERLAILEVAHMMSVPMSLVAVLNMKVPDAIWQGGNNTPLSASEILAVVRPNGGGD  72

Query  269  AQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDAL  448
            A+NLQRILR+LT+Y +F E +N+   ER+YSL +VGKTL+ D DGLSY AYVLQHHQ+AL
Sbjct  73   AENLQRILRLLTTYDIFDEQLNSKG-ERKYSLSDVGKTLIADADGLSYAAYVLQHHQEAL  131

Query  449  MKAWPLVHXAVVDSSSE  499
            M+AW LV  AV D + E
Sbjct  132  MRAWALVGEAVEDPTVE  148



>gb|KHN47498.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=337

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (72%), Gaps = 20/141 (14%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
             ES   +K A L IMELANMISVPM+LNAVVRLNVADA+WQGG+NAPLSASEIL  +LP 
Sbjct  4    EESTEQRKQAMLAIMELANMISVPMALNAVVRLNVADALWQGGANAPLSASEILPRILPG  63

Query  257  GGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHH  436
                              GVFREH+   A ER YSL EVGKTLVTD+ GLSY  YVLQHH
Sbjct  64   ------------------GVFREHLA--AGERNYSLTEVGKTLVTDEQGLSYAHYVLQHH  103

Query  437  QDALMKAWPLVHXAVVDSSSE  499
            QDALM+AWPLVH AVVD + E
Sbjct  104  QDALMRAWPLVHEAVVDPTKE  124



>gb|AAP03054.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=181

 Score =   171 bits (433),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 10/149 (7%)
 Frame = +2

Query  80   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP--  253
            E+  A+ NARL I+ELAN+ISVPMSL A+VRL V +AIW  GSN P+SA+EILS  LP  
Sbjct  14   ETSEARNNARLKIIELANLISVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDA  72

Query  254  SGGGDAQNLQRILRMLTSYGVFREHIN------ADASERRYSLGEVGKTLVT-DKDGLSY  412
                DA+NLQR+LR+LTS+GVF EH++      +  SERRY L EVG+TLV+ D+   S+
Sbjct  73   PATADAENLQRLLRVLTSFGVFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSH  132

Query  413  GAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            GAYVLQHHQ+ L+KAWP +H A++D+S+E
Sbjct  133  GAYVLQHHQETLLKAWPFLHTAILDASTE  161



>ref|XP_003602597.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=358

 Score =   175 bits (443),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = +2

Query  89   SAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  268
             +Q  ARL I+ELA+++SVP SL AV+++ V +AIWQGG+N PLSAS+ILS V P+GGGD
Sbjct  10   KSQSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGNNTPLSASQILSIVRPNGGGD  69

Query  269  AQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDAL  448
            A+NLQRILR+LT+Y +F E ++++  +R+YSL EVGK LV D DGLSYG YVLQH+QD  
Sbjct  70   AENLQRILRLLTTYAIFAEDLSSNG-KRKYSLTEVGKALVPDDDGLSYGTYVLQHYQDQY  128

Query  449  MKAWPLVHXAVVDSSSE  499
            ++AWPLV  AV D + E
Sbjct  129  LRAWPLVGEAVEDPTVE  145



>emb|CAB65279.1| O-diphenol-O-methyl transferase [Medicago sativa subsp. x varia]
Length=358

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 107/135 (79%), Gaps = 1/135 (1%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  274
            Q  ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA+
Sbjct  12   QSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAE  71

Query  275  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  454
            NLQRILR+LT+Y +F E ++++  +R+YSL ++GK LV D DGLSY  YVLQH+QD  ++
Sbjct  72   NLQRILRLLTTYAIFAEDLSSNG-KRKYSLTDIGKALVPDDDGLSYATYVLQHYQDQYLR  130

Query  455  AWPLVHXAVVDSSSE  499
            AWPLV  AV D+S E
Sbjct  131  AWPLVGDAVEDASVE  145



>gb|AFK47565.1| unknown [Medicago truncatula]
Length=224

 Score =   166 bits (421),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  274
            Q  ARL I+ELA+++SVP SLNAV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA+
Sbjct  12   QSEARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAE  71

Query  275  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  454
            NLQRILR+LT+Y +F E ++++  ER+YSL +VGK LV D  GL+  ++ +QHHQD  ++
Sbjct  72   NLQRILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLR  130

Query  455  AWPLVHXAVVDSSSE  499
            AWPLV  AV D + E
Sbjct  131  AWPLVGDAVEDPTVE  145



>gb|AAP03058.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=375

 Score =   170 bits (431),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 10/149 (7%)
 Frame = +2

Query  80   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP--  253
            E+  A+ NARL I+ELAN+ISVPMSL A+VRL V +AIW  GSN P+SA+EILS  LP  
Sbjct  14   ETSEARNNARLKIIELANLISVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDA  72

Query  254  SGGGDAQNLQRILRMLTSYGVFREHIN------ADASERRYSLGEVGKTLVT-DKDGLSY  412
                DA+NLQR+LR+LTS+GVF EH++      +  SERRY L EVG+TLV+ D+   S+
Sbjct  73   PATADAENLQRLLRVLTSFGVFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSH  132

Query  413  GAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            GAYVLQHHQ+ L+KAWP +H A++D+S+E
Sbjct  133  GAYVLQHHQETLLKAWPFLHTAILDASTE  161



>ref|XP_003602596.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|AES72847.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=264

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  274
            Q  ARL I+ELA+++SVP SLNAV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA+
Sbjct  12   QSEARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAE  71

Query  275  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  454
            NLQRILR+LT+Y +F E ++++  ER+YSL +VGK LV D  GL+  ++ +QHHQD  ++
Sbjct  72   NLQRILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLR  130

Query  455  AWPLVHXAVVDSSSE  499
            AWPLV  AV D + E
Sbjct  131  AWPLVGDAVEDPTVE  145



>ref|XP_003602595.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|ACJ84599.1| unknown [Medicago truncatula]
 gb|AES72846.1| caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AFK37235.1| unknown [Medicago truncatula]
Length=358

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  274
            Q  ARL I+ELA+++SVP SLNAV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA+
Sbjct  12   QSEARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAE  71

Query  275  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  454
            NLQRILR+LT+Y +F E ++++  ER+YSL +VGK LV D  GL+  ++ +QHHQD  ++
Sbjct  72   NLQRILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLR  130

Query  455  AWPLVHXAVVDSSSE  499
            AWPLV  AV D + E
Sbjct  131  AWPLVGDAVEDPTVE  145



>ref|XP_009382782.1| PREDICTED: caffeic acid 3-O-methyltransferase [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 107/144 (74%), Gaps = 4/144 (3%)
 Frame = +2

Query  74   GSESESAQ--KNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  247
            G E  +++  K  RL +MELANMISVPM+LNAVVRLNV DAIWQ GSN+PL+A+EIL+ +
Sbjct  8    GREDPTSEVGKQGRLAMMELANMISVPMALNAVVRLNVPDAIWQSGSNSPLTAAEILALL  67

Query  248  LPSGGGDAQN--LQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAY  421
             P     +    LQR+LR+L S+GVF E+  A +  RRYSL +VG+TLV   DG SY AY
Sbjct  68   RPPPPSSSDPSVLQRLLRLLASHGVFAENRCATSGARRYSLTDVGRTLVPSGDGASYAAY  127

Query  422  VLQHHQDALMKAWPLVHXAVVDSS  493
            VLQHHQDAL++AWP +H AV+D +
Sbjct  128  VLQHHQDALVRAWPRLHEAVLDPA  151



>ref|XP_010935842.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Elaeis 
guineensis]
Length=346

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 103/142 (73%), Gaps = 10/142 (7%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI--LSSVLPSGGGD  268
            QK A L +MEL+NMI+VPMSL+AVVRLNV  AIWQ G+N+PLSA+EI  L    P    D
Sbjct  51   QKKANLAMMELSNMIAVPMSLHAVVRLNVPAAIWQSGTNSPLSAAEILPLLRPPPPPSTD  110

Query  269  AQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVT-------DKDGLSYGAYVL  427
              NLQR+LR+L S+GVF EH++  +  RR+SL  VG+TLV+        +DG SY AYVL
Sbjct  111  PGNLQRLLRLLASHGVFTEHLSP-SGVRRFSLTPVGQTLVSAASSNGGGEDGPSYAAYVL  169

Query  428  QHHQDALMKAWPLVHXAVVDSS  493
            QHHQDAL++AWP +H AV+D +
Sbjct  170  QHHQDALVRAWPRLHEAVLDPA  191



>ref|XP_010935841.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 103/142 (73%), Gaps = 10/142 (7%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI--LSSVLPSGGGD  268
            QK A L +MEL+NMI+VPMSL+AVVRLNV  AIWQ G+N+PLSA+EI  L    P    D
Sbjct  51   QKKANLAMMELSNMIAVPMSLHAVVRLNVPAAIWQSGTNSPLSAAEILPLLRPPPPPSTD  110

Query  269  AQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVT-------DKDGLSYGAYVL  427
              NLQR+LR+L S+GVF EH++  +  RR+SL  VG+TLV+        +DG SY AYVL
Sbjct  111  PGNLQRLLRLLASHGVFTEHLSP-SGVRRFSLTPVGQTLVSAASSNGGGEDGPSYAAYVL  169

Query  428  QHHQDALMKAWPLVHXAVVDSS  493
            QHHQDAL++AWP +H AV+D +
Sbjct  170  QHHQDALVRAWPRLHEAVLDPA  191



>gb|AAP03053.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=191

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 97/129 (75%), Gaps = 10/129 (8%)
 Frame = +2

Query  140  SVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG--GDAQNLQRILRMLTSYG  313
            +VPMSL A+VRL V +AIW  GSN P+SA+EILS  LP      DA+NLQR+LR+LTS+G
Sbjct  6    NVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDAPPTADAENLQRLLRVLTSFG  64

Query  314  VFREHINADAS------ERRYSLGEVGKTLVT-DKDGLSYGAYVLQHHQDALMKAWPLVH  472
            VF EH++  +S      ERRY L EVG+TLV+ D+   S+GAYVLQHHQ+ L+KAWP +H
Sbjct  65   VFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSHGAYVLQHHQETLLKAWPFLH  124

Query  473  XAVVDSSSE  499
             A++D+S+E
Sbjct  125  TAILDASTE  133



>gb|AGW45465.1| beta-alanine n-methyltransferase, partial [Reaumuria trigyna]
Length=204

 Score =   142 bits (358),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 86/111 (77%), Gaps = 2/111 (2%)
 Frame = +2

Query  173  LNVADAIWQGGSNAPLSASEILSSVLP-SGGGDAQNLQRILRMLTSYGVFREHI-NADAS  346
            L V +AIW  GSN PL+A+EILS +LP S   D +NLQR+LR+LT+Y +F EH+ +    
Sbjct  1    LKVPEAIWAHGSNKPLTATEILSHILPNSPTADPENLQRMLRLLTTYNIFVEHLSDTTPV  60

Query  347  ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            +RRYSL EVG+TLV D DGLSYG Y++QHHQDAL+++WPLVH AVVD  +E
Sbjct  61   QRRYSLTEVGETLVPDSDGLSYGDYIMQHHQDALVRSWPLVHMAVVDPVTE  111



>dbj|BAJ96291.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 92/133 (69%), Gaps = 5/133 (4%)
 Frame = +2

Query  98   KNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN  277
              ARL +MELANMI+VPM+L AV+RL V  A+W GG+N PLSA+E+    LP+G  D   
Sbjct  21   PEARLAMMELANMIAVPMALTAVIRLGVPAAVWAGGANLPLSAAEL----LPAGHPDPSV  76

Query  278  LQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTD-KDGLSYGAYVLQHHQDALMK  454
            L+R+LR+L S GVF EH      ERRY+L  VG+TLV     G SY  YVLQHHQDAL+ 
Sbjct  77   LERLLRLLASRGVFSEHAADGGRERRYALTAVGRTLVPSAPSGASYADYVLQHHQDALVL  136

Query  455  AWPLVHXAVVDSS  493
            AWP +H AV+D +
Sbjct  137  AWPRLHEAVLDPA  149



>gb|KDO38249.1| hypothetical protein CISIN_1g043063mg [Citrus sinensis]
Length=301

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = +2

Query  206  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  385
            +N PLSAS+IL+ +LPSGGGDA+NLQRILR+LT+YGVF EH      ER+YSL E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTNYGVFSEH-REFGGERKYSLTEIGKSL  74

Query  386  VTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            VTD +G SY  YVLQHHQDALM AWPLVH A++D + E
Sbjct  75   VTDAEGQSYAPYVLQHHQDALMSAWPLVHEAILDPTIE  112



>ref|XP_006423903.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
 gb|ESR37143.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
Length=294

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +2

Query  206  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  385
            +N PLS S+IL+ +LPSGGGDA+NLQ ILR+LTSYGVF EH      ER+YSL E+GK+L
Sbjct  16   ANTPLSVSQILTCILPSGGGDAENLQCILRLLTSYGVFSEH-REFRGERKYSLTEIGKSL  74

Query  386  VTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            VTD +GLSY  YVLQHHQDA M AWPLVH AV+D + E
Sbjct  75   VTDAEGLSYAPYVLQHHQDAFMSAWPLVHEAVLDPTIE  112



>gb|KDO41959.1| hypothetical protein CISIN_1g021707mg [Citrus sinensis]
Length=309

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +2

Query  206  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  385
            +N PLS S+IL+ +LPSGGGDA+NLQ ILR+LTSYGVF EH      ER+YSL E+GK+L
Sbjct  16   ANTPLSVSQILTCILPSGGGDAENLQCILRLLTSYGVFSEH-REFRGERKYSLTEIGKSL  74

Query  386  VTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            VTD +GLSY  YVLQHHQDA M AWPLVH AV+D + E
Sbjct  75   VTDAEGLSYAPYVLQHHQDAFMSAWPLVHEAVLDPTIE  112



>ref|XP_006436414.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
 gb|ESR49654.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
Length=317

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +2

Query  206  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  385
            +N PLSAS+IL+ +LPSGGGDA+NLQRILR+LTSYGVF EH      +R YSL E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTSYGVFSEH-REFGGKRMYSLTEIGKSL  74

Query  386  VTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            VTD +GLSY  YVLQHHQDALM  WPLVH A++D + E
Sbjct  75   VTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIE  112



>ref|XP_006485837.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=337

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +2

Query  206  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  385
            +N PLSAS+IL+ +LPSGGGDA+NLQRILR+LTSYGVF EH      +R YSL E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTSYGVFSEH-REFGGKRMYSLTEIGKSL  74

Query  386  VTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            VTD +GLSY  YVLQHHQDALM  WPLVH A++D + E
Sbjct  75   VTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIE  112



>ref|XP_010683979.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 102/152 (67%), Gaps = 13/152 (9%)
 Frame = +2

Query  80   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  259
            E+   +  ARL IMELANMISVPM+LNAVVRL V  AIW  G+N PL+A+ I+S +LP+ 
Sbjct  18   ETSETRNKARLAIMELANMISVPMALNAVVRLKVPAAIWSCGANTPLTAAAIISLILPNN  77

Query  260  G-GDAQNLQRILRMLTSYGVFREH--INADASERRYSLGEVGKTLVTDKDGL--------  406
               DA NL R+LR+L++YGVF EH  +  D   RRYSL EVG+TLV    G         
Sbjct  78   PEADADNLARLLRLLSTYGVFSEHPPLYGDIF-RRYSLTEVGRTLVAGDGGGGGGDDGGG  136

Query  407  -SYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
             S+G YVLQHHQ+AL++AW  V  AVV  +S+
Sbjct  137  SSHGEYVLQHHQEALVRAWLQVDRAVVGPTSK  168



>ref|XP_004954455.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=344

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 91/128 (71%), Gaps = 6/128 (5%)
 Frame = +2

Query  116  IMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILR  295
            +MELANMISVPM+L AV+RL V  A+W GG+NAPLSA+E+    LP G  D   L+R+LR
Sbjct  1    MMELANMISVPMALTAVIRLGVPSAVWAGGANAPLSAAEL----LPEGHPDPSVLERLLR  56

Query  296  MLTSYGVFREHINADA-SERRYSLGEVGKTLV-TDKDGLSYGAYVLQHHQDALMKAWPLV  469
            +L S GVF EH    A S RR++L  VG+TLV +   G SY  YVLQHHQDAL+ AWP +
Sbjct  57   LLASRGVFSEHGGGSAGSPRRFALTAVGRTLVPSGPSGASYADYVLQHHQDALVSAWPRL  116

Query  470  HXAVVDSS  493
            H AV+D +
Sbjct  117  HEAVLDPA  124



>ref|XP_011101495.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Sesamum 
indicum]
Length=113

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 83/114 (73%), Gaps = 6/114 (5%)
 Frame = +2

Query  86   ESAQKNAR-LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG-  259
            E +Q N+  L IMEL N++SVPMSL AV++L V D I Q GSN PLS +EI  S LPS  
Sbjct  2    ERSQINSPILAIMELVNLVSVPMSLKAVIQLKVLDTIRQDGSNNPLSPAEI--SYLPSRL  59

Query  260  --GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  415
                DA+NLQRILR+LTSYGVF EHI AD SERRYSL EVGK L  DK+GLSY 
Sbjct  60   ALARDAENLQRILRLLTSYGVFNEHIGADGSERRYSLKEVGKALAADKNGLSYA  113



>ref|XP_006451708.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
 gb|ESR64948.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
Length=305

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +2

Query  206  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  385
            +N PLSAS+IL+ +LPSG GDA+NLQRILR+LTSYGVF EH      + +YS+ E+GK+L
Sbjct  4    ANTPLSASQILTHILPSGSGDAENLQRILRLLTSYGVFSEH-REFGGQMKYSITEIGKSL  62

Query  386  VTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            VTD +GLSY  YVLQHHQDALM  WPLVH AV+D + E
Sbjct  63   VTDAEGLSYAPYVLQHHQDALMSMWPLVHEAVLDPTIE  100



>ref|XP_006485822.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=274

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +2

Query  206  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  385
            +N PLSAS+IL+ +LPSG GDA+NLQRILR+LTSYGVF EH      + +YS+ E+GK+L
Sbjct  16   ANTPLSASQILTHILPSGSGDAENLQRILRLLTSYGVFSEH-REFGGQMKYSITEIGKSL  74

Query  386  VTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            VTD +GLSY  YVLQHHQDALM  WPLV+ AV+D + E
Sbjct  75   VTDAEGLSYAPYVLQHHQDALMSMWPLVYEAVLDPTIE  112



>ref|XP_002453074.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
 gb|EES06050.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
Length=377

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 92/134 (69%), Gaps = 9/134 (7%)
 Frame = +2

Query  101  NARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL  280
             ARL +MELANM+SVPM+L AV+RL V  AIW GG+NAP SA+E+    LP+G  D   L
Sbjct  26   EARLAMMELANMVSVPMALTAVIRLGVPAAIWAGGANAPRSAAEL----LPAGHPDPSVL  81

Query  281  QRILRMLTSYGVFREHINAD----ASERRYSLGEVGKTLVTD-KDGLSYGAYVLQHHQDA  445
            +R+LR+L S GVF E  +       + RR++L  VG+TLV +   G SY  YVLQHHQDA
Sbjct  82   ERLLRLLASRGVFSESTSTSEDRTTTTRRFALTAVGRTLVPEGASGASYADYVLQHHQDA  141

Query  446  LMKAWPLVHXAVVD  487
            L+ AWP +H AV+D
Sbjct  142  LVAAWPRLHEAVLD  155



>ref|NP_001149617.1| LOC100283243 [Zea mays]
 gb|ACG36095.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 92/134 (69%), Gaps = 7/134 (5%)
 Frame = +2

Query  101  NARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL  280
             ARL +MELANM+SVPM+L AV+RL V  A+W GG+NAP+SA+++    LP G  D   L
Sbjct  24   EARLAMMELANMVSVPMALAAVIRLGVPXAVWAGGANAPMSAADL----LPPGHPDPSVL  79

Query  281  QRILRMLTSYGVFREHINADASERR--YSLGEVGKTLVTDK-DGLSYGAYVLQHHQDALM  451
            +R+LR+L S GVF E   +  + RR  ++L  VG+TLV     G SY  YVLQHHQDAL+
Sbjct  80   ERLLRLLASRGVFSESTESTPTTRRRLFALTAVGRTLVPGPASGASYADYVLQHHQDALV  139

Query  452  KAWPLVHXAVVDSS  493
             AWP +H AV+D +
Sbjct  140  AAWPRLHEAVLDPA  153



>gb|ACN25427.1| unknown [Zea mays]
 gb|AFW63931.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 92/134 (69%), Gaps = 7/134 (5%)
 Frame = +2

Query  101  NARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL  280
             ARL +MELANM+SVPM+L AV+RL V  A+W GG+NAP+SA+++    LP G  D   L
Sbjct  24   EARLAMMELANMVSVPMALAAVIRLGVPAAVWAGGANAPMSAADL----LPPGHPDPSVL  79

Query  281  QRILRMLTSYGVFREHINADASERR--YSLGEVGKTLVTDK-DGLSYGAYVLQHHQDALM  451
            +R+LR+L S GVF E   +  + RR  ++L  VG+TLV     G SY  YVLQHHQDAL+
Sbjct  80   ERLLRLLASRGVFSESTESTPTTRRRLFALTAVGRTLVPGPASGASYADYVLQHHQDALV  139

Query  452  KAWPLVHXAVVDSS  493
             AWP +H AV+D +
Sbjct  140  AAWPRLHEAVLDPA  153



>ref|XP_003572969.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brachypodium distachyon]
Length=362

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 95/145 (66%), Gaps = 7/145 (5%)
 Frame = +2

Query  68   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  247
            A   + E +   ARL +MELANMISVPM+L A +RL V  AIW  G+NAPLSA+++    
Sbjct  4    AASEDEELSPAEARLAMMELANMISVPMALTAAIRLGVPGAIWADGANAPLSAADL----  59

Query  248  LPSGGGDAQNLQRILRMLTSYGVFREHINADASE--RRYSLGEVGKTLVT-DKDGLSYGA  418
            LP+   D   L+R+LR+L S GVF EH     +E  RR++L  VG+TLV     G SY  
Sbjct  60   LPADHPDPSVLERVLRLLASRGVFSEHHGPGPAEPTRRFALTAVGRTLVPAGPSGASYAD  119

Query  419  YVLQHHQDALMKAWPLVHXAVVDSS  493
            YVLQHHQDAL+ AWP +H A++D +
Sbjct  120  YVLQHHQDALVLAWPRLHEALLDPA  144



>gb|EEC74273.1| hypothetical protein OsI_09508 [Oryza sativa Indica Group]
Length=345

 Score =   132 bits (332),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 99/147 (67%), Gaps = 11/147 (7%)
 Frame = +2

Query  74   GSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP  253
            G + E +   ARL +MELANMISVPM+L AV+RL V   +W GG+NAPL+A+++    LP
Sbjct  4    GGDGELSPAEARLAMMELANMISVPMALTAVIRLGVPAKLWAGGANAPLTAADL----LP  59

Query  254  SGGGDAQNLQRILRMLTSYGVFREHIN-ADASERRYSLGEVGKTLVTDKDGL------SY  412
            +G  D   L+R+LR+L S GVF EH   +  S RR+SL  VG+TLV    G       SY
Sbjct  60   AGHPDPSVLERLLRLLASRGVFSEHTGSSSPSPRRFSLTAVGRTLVPGGGGSPSGSGASY  119

Query  413  GAYVLQHHQDALMKAWPLVHXAVVDSS  493
              YVLQHHQDAL++AWPL+H AV+D S
Sbjct  120  ADYVLQHHQDALVRAWPLLHEAVLDPS  146



>ref|NP_001048569.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAD22923.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD22855.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAF10483.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAG97074.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58073.1| hypothetical protein OsJ_08933 [Oryza sativa Japonica Group]
Length=365

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 99/147 (67%), Gaps = 11/147 (7%)
 Frame = +2

Query  74   GSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP  253
            G + E +   ARL +MELANMISVPM+L AV+RL V   +W GG+NAPL+A+++    LP
Sbjct  4    GGDGELSPAEARLAMMELANMISVPMALTAVIRLGVPAKLWAGGANAPLAAADL----LP  59

Query  254  SGGGDAQNLQRILRMLTSYGVFREHIN-ADASERRYSLGEVGKTLVTDKDGL------SY  412
            +G  D   L+R+LR+L S GVF EH   +  S RR+SL  VG+TLV    G       SY
Sbjct  60   AGHPDPSVLERLLRLLASRGVFSEHTGSSSPSPRRFSLTAVGRTLVPGGGGSPSGSGASY  119

Query  413  GAYVLQHHQDALMKAWPLVHXAVVDSS  493
              YVLQHHQDAL++AWPL+H AV+D S
Sbjct  120  ADYVLQHHQDALVRAWPLLHEAVLDPS  146



>ref|XP_010243879.1| PREDICTED: uncharacterized protein LOC104587837 [Nelumbo nucifera]
Length=130

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M  E    Q N RL I+ELAN+I+VPMSLNA+V L VADAI QG SN PLSASEIL+ VL
Sbjct  1    MADEKTKTQNNTRLAILELANIINVPMSLNAIVCLKVADAIQQGSSNVPLSASEILACVL  60

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINADASER  352
            P+  GD  NLQ ILRMLTSY VF EHI  D+S++
Sbjct  61   PT--GDPDNLQCILRMLTSYDVFSEHIVDDSSKQ  92



>gb|AES72848.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=335

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 90/137 (66%), Gaps = 24/137 (18%)
 Frame = +2

Query  89   SAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  268
             +Q  ARL I+ELA+++SVP SL AV+++ V +AIWQGG+N PLSAS+ILS V P+GGGD
Sbjct  10   KSQSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGNNTPLSASQILSIVRPNGGGD  69

Query  269  AQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDAL  448
            A+NLQRILR+LT+Y +F E ++++  +R+YSL E                       D  
Sbjct  70   AENLQRILRLLTTYAIFAEDLSSNG-KRKYSLTE-----------------------DQY  105

Query  449  MKAWPLVHXAVVDSSSE  499
            ++AWPLV  AV D + E
Sbjct  106  LRAWPLVGEAVEDPTVE  122



>ref|XP_010275846.1| PREDICTED: uncharacterized protein LOC104610771 [Nelumbo nucifera]
Length=277

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 88/168 (52%), Gaps = 45/168 (27%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVP------MSLNAVVRLNVAD---------------  187
            M  E+   + N RL I+ELANMI  P          A  R+                   
Sbjct  1    MADETMETRDNGRLAILELANMIKSPNVPQRHHPPQASKRIKACPGQPWPGRRTGFFRCR  60

Query  188  ----AIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERR  355
                 IWQGGSN PLSASEIL+ VLP    D +N Q IL+ML+SYG+F EHI        
Sbjct  61   TTLVTIWQGGSNVPLSASEILAYVLPIS--DPENFQHILQMLSSYGIFSEHI--------  110

Query  356  YSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
                      VT+++GL Y AY+L+HHQDAL+KAWP++H AVVD   E
Sbjct  111  ----------VTNREGLFYVAYILKHHQDALVKAWPILHEAVVDLEEE  148



>ref|XP_006838729.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
 gb|ERN01298.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
Length=352

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 90/146 (62%), Gaps = 6/146 (4%)
 Frame = +2

Query  62   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  241
            +E + +   +   +    +MEL N I+V MSL A+ +L+V   IWQ G N PL+A EI +
Sbjct  1    MEGVSNNGSNGASHTTWAMMELTNSIAVSMSLRAMAKLDVPKIIWQNGENTPLTALEIAT  60

Query  242  SVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAY  421
             +    G  + NL+R+LR+LT++GVF E +   +  RR+SL  +G+ +V D+   S GA+
Sbjct  61   KLGSEAG--SSNLERMLRLLTAHGVFNETMLGPSEGRRFSLTGLGREIV-DR---SMGAF  114

Query  422  VLQHHQDALMKAWPLVHXAVVDSSSE  499
            +L    DAL+ AW L+H AV++ SSE
Sbjct  115  ILYRLDDALLDAWRLLHEAVLEPSSE  140



>gb|KCW89310.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=285

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 4/72 (6%)
 Frame = +2

Query  296  MLTSYGVFREHINADAS----ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWP  463
            ML S+GVF EH+   AS    ERRYSL EVGKTLVTD +GLSY  YVLQHHQDALM+AWP
Sbjct  1    MLASHGVFEEHVAPAASSASSERRYSLTEVGKTLVTDAEGLSYAPYVLQHHQDALMRAWP  60

Query  464  LVHXAVVDSSSE  499
            LVH AV+D ++E
Sbjct  61   LVHEAVLDPATE  72



>ref|XP_008387516.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=284

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 3/71 (4%)
 Frame = +2

Query  296  MLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPL  466
            MLTSYGVF EH+ N D  + +R++SL  +G+TLVTD++GLSYG YVLQHHQD LM AWP+
Sbjct  1    MLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQHHQDVLMGAWPM  60

Query  467  VHXAVVDSSSE  499
            VH AVVDS+ E
Sbjct  61   VHEAVVDSTVE  71



>gb|KDO38695.1| hypothetical protein CISIN_1g037818mg, partial [Citrus sinensis]
Length=199

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 60/98 (61%), Gaps = 29/98 (30%)
 Frame = +2

Query  206  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  385
            +N PLSAS+IL+ +LPSG GDA+NLQRILR+LTSYG                        
Sbjct  16   ANTPLSASQILTRILPSGDGDAENLQRILRLLTSYG------------------------  51

Query  386  VTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
                 GLSY  Y+LQHHQDALM AWPLVH AV+D + E
Sbjct  52   -----GLSYAPYMLQHHQDALMSAWPLVHEAVLDPTIE  84



>ref|XP_006425490.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
 gb|ESR38730.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
Length=298

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 61/98 (62%), Gaps = 21/98 (21%)
 Frame = +2

Query  206  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  385
            +N  LSAS+IL+ +L SGGGDA+NLQRIL   T                     E+GK+L
Sbjct  4    ANTHLSASQILTRILSSGGGDAENLQRILLQPT---------------------EIGKSL  42

Query  386  VTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            VTD +GLSY  YVLQHH DALM AWPLVH  V+D + E
Sbjct  43   VTDAEGLSYAPYVLQHHHDALMSAWPLVHEVVLDPTIE  80



>ref|XP_006441597.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
 gb|ESR54837.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
Length=181

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQR  286
            MELANMISVPMSL A +RL+V DAI QGG+N PLSAS+IL+ +LPSGGGDA+NLQR
Sbjct  1    MELANMISVPMSLTAAIRLHVPDAIRQGGANTPLSASQILTCILPSGGGDAENLQR  56



>gb|KDO39478.1| hypothetical protein CISIN_1g036218mg, partial [Citrus sinensis]
Length=79

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 54/86 (63%), Gaps = 19/86 (22%)
 Frame = +2

Query  98   KNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN  277
            K  RL +MELANMISVPMSL A +RL+                  IL+ +LPSGGGDA+N
Sbjct  11   KKVRLAVMELANMISVPMSLTAAIRLH------------------ILTRILPSGGGDAEN  52

Query  278  LQRILRMLTSYGVFREHINADASERR  355
            LQRIL +LTSYGVF EH      ERR
Sbjct  53   LQRILCLLTSYGVFSEH-REFGGERR  77



>ref|XP_002986612.1| hypothetical protein SELMODRAFT_124122 [Selaginella moellendorffii]
 gb|EFJ12469.1| hypothetical protein SELMODRAFT_124122 [Selaginella moellendorffii]
Length=235

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 77/132 (58%), Gaps = 5/132 (4%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDA  271
            Q + RL IME   M  +P +LNAV++L + D I     +APLS++EI++ +   G  G  
Sbjct  7    QDDDRLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSG  65

Query  272  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKD--GLSYGAYVLQHHQDA  445
             NL RILR+L+S GVF+E ++ D   R+Y +  + + LVT+    GL   ++V+ +    
Sbjct  66   ANLDRILRVLSSVGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIANQDVV  124

Query  446  LMKAWPLVHXAV  481
             MK W  ++ +V
Sbjct  125  FMKTWEFLYQSV  136



>ref|XP_002965284.1| hypothetical protein SELMODRAFT_83100 [Selaginella moellendorffii]
 gb|EFJ34122.1| hypothetical protein SELMODRAFT_83100 [Selaginella moellendorffii]
Length=235

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 77/132 (58%), Gaps = 5/132 (4%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDA  271
            Q + RL IME   M  +P +LNAV++L + D I     +APLS++EI++ +   G  G  
Sbjct  7    QDDDRLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSG  65

Query  272  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKD--GLSYGAYVLQHHQDA  445
             NL RILR+L+S GVF+E ++ D   R+Y +  + + LVT+    GL   ++V+ +    
Sbjct  66   ANLDRILRVLSSIGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIVNQDVV  124

Query  446  LMKAWPLVHXAV  481
             MK W  ++ +V
Sbjct  125  FMKTWEFLYQSV  136



>gb|KCW89309.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=345

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 66/125 (53%), Gaps = 36/125 (29%)
 Frame = +2

Query  227  SEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD--------ASERRYSLGEVGKT  382
            S + S+  P+G  DA+NLQR+LRML S+G F E   A           ERR+SL EV KT
Sbjct  10   SPLGSTAAPAG--DAENLQRLLRMLASHGAFEERFPATSASSASSGCFERRFSLTEVRKT  67

Query  383  LVTDKDGLSYGAYV--------------------------LQHHQDALMKAWPLVHXAVV  484
            LVTD +GLSY AYV                           +   DALM+AWPLVH AV+
Sbjct  68   LVTDAEGLSYAAYVSSSTTRPKKAMERREICLPESRKKRRQKKASDALMRAWPLVHEAVL  127

Query  485  DSSSE  499
            D ++E
Sbjct  128  DPATE  132



>ref|XP_006649184.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Oryza brachyantha]
Length=313

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 68/141 (48%), Gaps = 46/141 (33%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            M +  + +   ARL +MELANMISVPM+L AV+RL                      S  
Sbjct  1    MAAGDDLSPAEARLAMMELANMISVPMALTAVIRLGF--------------------SPD  40

Query  251  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  430
            P+G G                          S RR++L  VG+TLV    G SY  YVLQ
Sbjct  41   PAGSG--------------------------SLRRFALTAVGRTLVPGPSGASYADYVLQ  74

Query  431  HHQDALMKAWPLVHXAVVDSS  493
            HHQDAL++AWP +H AV+D +
Sbjct  75   HHQDALVRAWPRLHEAVLDPA  95



>gb|ADE88153.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase-like 
2 [Selaginella moellendorffii]
Length=357

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 77/132 (58%), Gaps = 5/132 (4%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDA  271
            Q + RL IME   M  +P +LNAV++L + D I     +APLS++EI++ +   G  G  
Sbjct  7    QDDDRLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSG  65

Query  272  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKD--GLSYGAYVLQHHQDA  445
             NL RILR+L+S GVF+E ++ D   R+Y +  + + LVT+    GL   ++V+ +    
Sbjct  66   ANLDRILRVLSSIGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIVNQDVV  124

Query  446  LMKAWPLVHXAV  481
             MK W  ++ +V
Sbjct  125  FMKTWEFLYQSV  136



>ref|XP_002986521.1| hypothetical protein SELMODRAFT_124205 [Selaginella moellendorffii]
 gb|EFJ12378.1| hypothetical protein SELMODRAFT_124205 [Selaginella moellendorffii]
Length=238

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 76/132 (58%), Gaps = 5/132 (4%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDA  271
            Q + RL IME   M  +P +LNAV++L + D I     +APLS++EI++ +   G  G  
Sbjct  10   QDDDRLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSG  68

Query  272  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTD--KDGLSYGAYVLQHHQDA  445
             NL RILR+L+S GVF+E ++ D   R+Y +  + + LVT+    GL   ++V  +    
Sbjct  69   ANLDRILRVLSSVGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNSGLPLSSWVTLNQDVV  127

Query  446  LMKAWPLVHXAV  481
             MK W  ++ +V
Sbjct  128  FMKTWEFLYQSV  139



>ref|XP_002962074.1| hypothetical protein SELMODRAFT_76630 [Selaginella moellendorffii]
 gb|EFJ37334.1| hypothetical protein SELMODRAFT_76630 [Selaginella moellendorffii]
Length=385

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 10/134 (7%)
 Frame = +2

Query  107  RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL----PSGGGDAQ  274
            R  IMEL  + +VPM+L A +RL+V   I   G +A LSA+EI++ +     P+ GG   
Sbjct  19   RQRIMELGLLCNVPMALTAAIRLDVFQIIASAGCDAMLSAAEIVARIPGCQSPALGGIVL  78

Query  275  NLQRILRMLTSYGVFREHINAD----ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  442
            N  RILR+L S G+FRE +  D    A+ RRY L  + + L+ D  G S   ++  +H +
Sbjct  79   N--RILRVLASRGIFREDVERDDPAPAAIRRYGLTNLCRFLLKDDRGASLAPWISLNHDE  136

Query  443  ALMKAWPLVHXAVV  484
             LM+ W  +  AV+
Sbjct  137  ILMRPWQFLADAVL  150



>ref|XP_002971011.1| hypothetical protein SELMODRAFT_94918 [Selaginella moellendorffii]
 gb|EFJ27609.1| hypothetical protein SELMODRAFT_94918 [Selaginella moellendorffii]
Length=385

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 10/134 (7%)
 Frame = +2

Query  107  RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL----PSGGGDAQ  274
            R  IMEL  + +VPM+L A +RL+V   I   G +A LSA+EI++ +     P+ GG   
Sbjct  19   RQRIMELGLLCNVPMALTAAIRLDVFQIIASAGCDAMLSAAEIVARIPGCQSPALGGIVL  78

Query  275  NLQRILRMLTSYGVFREHINAD----ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  442
            N  RILR+L S G+FRE +  D    A+ RRY L  + + L+ D  G S   ++  +H +
Sbjct  79   N--RILRVLASRGIFREDVERDDPAPAAIRRYGLTNLCRFLLKDDRGASLAPWISLNHDE  136

Query  443  ALMKAWPLVHXAVV  484
             LM+ W  +  AV+
Sbjct  137  ILMRPWQFLADAVL  150



>ref|XP_002988275.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|EFJ10694.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 72/128 (56%), Gaps = 3/128 (2%)
 Frame = +2

Query  107  RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP-SGGGDAQNLQ  283
            RL IMELA M SVPM+L   V ++VA+ I + G    LSA+EI+S +   S       L 
Sbjct  14   RLQIMELATMCSVPMALKVAVEMDVAERIEKAGPGGLLSAAEIVSQIPECSSPMSPIYLD  73

Query  284  RILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWP  463
            RI+R+L S  +F+E    +   R+Y L  + K L+ D+ G+S   +VL +     M+ W 
Sbjct  74   RIMRVLASRKIFKE--VDEGGVRKYGLTSMCKHLIKDERGVSLAHHVLMNQDKVFMETWQ  131

Query  464  LVHXAVVD  487
             +H AV+D
Sbjct  132  YLHEAVLD  139



>ref|XP_002963872.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|ADE88151.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase 
[Selaginella moellendorffii]
 gb|EFJ35743.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 72/128 (56%), Gaps = 3/128 (2%)
 Frame = +2

Query  107  RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP-SGGGDAQNLQ  283
            RL IMELA M SVPM+L   V ++VA+ I + G    LSA+EI+S +   S       L 
Sbjct  14   RLQIMELATMCSVPMALKVAVEMDVAERIEKAGPGGLLSAAEIVSQIPECSSPMSPIYLD  73

Query  284  RILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWP  463
            RI+R+L S  +F+E    +   R+Y L  + K L+ D+ G+S   +VL +     M+ W 
Sbjct  74   RIMRVLASRKIFKE--VDEGGVRKYGLTSMCKHLIKDERGVSLAHHVLMNQDKVFMETWQ  131

Query  464  LVHXAVVD  487
             +H AV+D
Sbjct  132  YLHEAVLD  139



>emb|CCC55423.1| caffeic acid O-3-methyltransferase [Pinus pinaster]
Length=364

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 78/151 (52%), Gaps = 10/151 (7%)
 Frame = +2

Query  71   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS SES++ NA+       L  MEL N   +PM++ A + L+V   I   G+   LS  
Sbjct  1    MGSASESSEMNAKIVNEDEWLLGMELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPR  60

Query  230  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  400
            +I++ +  +    A  L RILR L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRALASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQD  120

Query  401  GLSYGAYVLQHHQDALMKAWPLVHXAVVDSS  493
            G+S    VL +    LM++W  +  AV+D S
Sbjct  121  GVSLAPLVLMNQDKVLMESWYYLKDAVLDGS  151



>gb|KDO39806.1| hypothetical protein CISIN_1g025363mg [Citrus sinensis]
Length=254

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  356  YSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVDSSSE  499
            YSL E+GK+LVTD +GLSY  YVLQHHQDALM  WPLVH A++D + E
Sbjct  2    YSLTEIGKSLVTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIE  49



>gb|KHF97637.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=308

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 85/163 (52%), Gaps = 12/163 (7%)
 Frame = +2

Query  29   RIEKQITGKKEIEAMGSESESAQKN------ARLTIMELANMISVPMSLNAVVRLNVADA  190
            +I  Q  GK +    G+E E+  +        +L +  LAN + +PM L + + LN+ D 
Sbjct  2    QIRSQNFGKVKQPETGAEKETMSQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDT  60

Query  191  IWQGGSNAPLSASEILSSVLPSGGGDAQNL-QRILRMLTSYGVFREHINA---DASERRY  358
            I   G  A LS S+I +S LPS   DA  L  R+LR+L S+ + +  + A   +  ER Y
Sbjct  61   ILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLY  119

Query  359  SLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
              G + K LV ++DG S    +L HH    M++W  ++ A+++
Sbjct  120  GAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYHLNDAILE  162



>gb|ABR18380.1| unknown [Picea sitchensis]
Length=365

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 76/151 (50%), Gaps = 10/151 (7%)
 Frame = +2

Query  71   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS SE+++ N +       L  MEL N   +PM + A + L+V   I   G+   LS  
Sbjct  1    MGSASENSEMNMKIVNEDEWLLGMELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPR  60

Query  230  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  400
            +I++ +  +    A  L RILR+L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTPLCKYLVNNQD  120

Query  401  GLSYGAYVLQHHQDALMKAWPLVHXAVVDSS  493
            G+S    VL +    LM+ W  +  AV++ S
Sbjct  121  GVSLAPLVLMNQDKVLMETWYYLKDAVLEGS  151



>gb|KHF97352.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
 gb|KHG01818.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
 gb|KHG22578.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=286

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 77/141 (55%), Gaps = 6/141 (4%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPS  59

Query  257  GGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYV  424
               DA  L  R+LR+L S+ + +  + A      ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  425  LQHHQDALMKAWPLVHXAVVD  487
            L HH    M++W  ++ A+++
Sbjct  120  LLHHDQVFMQSWYHLNDAILE  140



>emb|CAI30878.1| caffeate O-methyltransferase [Picea abies]
 gb|ABK23738.1| unknown [Picea sitchensis]
Length=364

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 76/151 (50%), Gaps = 10/151 (7%)
 Frame = +2

Query  71   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS SE+++ N +       L  MEL N   +PM + A + L+V   I   G+   LS  
Sbjct  1    MGSASENSEMNTKIVNEDEWLLGMELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPR  60

Query  230  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  400
            +I++ +  +    A  L RILR+L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQD  120

Query  401  GLSYGAYVLQHHQDALMKAWPLVHXAVVDSS  493
            G+S    VL +    LM +W  +  AV++ S
Sbjct  121  GVSLAPLVLMNQDKVLMDSWYYLKDAVLEGS  151



>gb|ABK22490.1| unknown [Picea sitchensis]
Length=364

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 76/151 (50%), Gaps = 10/151 (7%)
 Frame = +2

Query  71   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS SE+++ N +       L  MEL N   +PM + A + L+V   I   G+   LS  
Sbjct  1    MGSASENSEMNTKVVNEDEWLLGMELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPR  60

Query  230  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  400
            +I++ +  +    A  L RILR+L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTPLCKYLVMNQD  120

Query  401  GLSYGAYVLQHHQDALMKAWPLVHXAVVDSS  493
            G+S    VL +    LM +W  +  AV++ S
Sbjct  121  GVSLAPLVLMNQDKVLMDSWYYLKDAVLEGS  151



>gb|AAV36348.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36366.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 67/128 (52%), Gaps = 3/128 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  299  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            L S+ V    +  +    +ER Y L  + K LV ++DG+S    VL +    LM++W  V
Sbjct  76   LASHSVLSCSVTTNENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYV  135

Query  470  HXAVVDSS  493
              AV+D S
Sbjct  136  KDAVLDGS  143



>ref|NP_200227.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
 sp|Q9FK25.1|OMT1_ARATH RecName: Full=Flavone 3'-O-methyltransferase 1; Short=AtOMT1; 
AltName: Full=Caffeate O-methyltransferase 1; AltName: Full=Quercetin 
3'-O-methyltransferase 1 [Arabidopsis thaliana]
 dbj|BAB11578.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAL32915.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM10127.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM64849.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AED96460.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
Length=363

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 82/150 (55%), Gaps = 14/150 (9%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + + GS  P+S +
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPT  58

Query  230  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  397
            EI +S LP+   +A   L RILR+LTSY V       ++ D  ER Y LG V K L  ++
Sbjct  59   EI-ASKLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNE  117

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG+S  A  L +    LM++W  +  A++D
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAILD  147



>gb|AAB96879.1| O-methyltransferase 1 [Arabidopsis thaliana]
Length=363

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 82/150 (55%), Gaps = 14/150 (9%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + + GS  P+S +
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPT  58

Query  230  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  397
            EI +S LP+   +A   L RILR+LTSY V       ++ D  ER Y LG V K L  ++
Sbjct  59   EI-ASKLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNE  117

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG+S  A  L +    LM++W  +  A++D
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAILD  147



>ref|XP_008788729.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase [Phoenix 
dactylifera]
Length=367

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 77/148 (52%), Gaps = 3/148 (2%)
 Frame = +2

Query  53   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  232
            K+ +  M  E ++A + A +  ++LA+   +PM+L   + L+V + I + GS A LS +E
Sbjct  6    KQGVPTMSLEKQAADEEACMYALQLASASILPMTLKNAIELDVLEIIAKAGSAAKLSPAE  65

Query  233  ILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASE---RRYSLGEVGKTLVTDKDG  403
            + + +       A  L R+LR+L SY V    +  DA     RRY    V K L  ++DG
Sbjct  66   VAAQLPTKNPMAAAMLDRMLRLLASYNVLTCSVEVDADGKPLRRYGPAPVCKWLTKNEDG  125

Query  404  LSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            +S  A  L +    LM++W  +  AV+D
Sbjct  126  VSMAALTLMNQDKILMESWYYLKDAVLD  153



>gb|KJB16304.1| hypothetical protein B456_002G222400 [Gossypium raimondii]
Length=404

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 82/154 (53%), Gaps = 7/154 (5%)
 Frame = +2

Query  38   KQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAP  217
            KQ     E E M S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A 
Sbjct  36   KQPETGAEKETM-SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGAF  93

Query  218  LSASEILSSVLPSGGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTL  385
            LS S+I +S LPS   DA  L  R+LR+L S+ + +  + A      ER Y  G + K L
Sbjct  94   LSPSQI-ASALPSKNPDAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFL  152

Query  386  VTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            V ++DG S    +L HH    M++W  ++ A+++
Sbjct  153  VKNQDGGSIAPLLLLHHDQVFMQSWYHLNDAILE  186



>gb|ABO41840.1| putative caffeic acid methyltransferase [Gossypium arboreum]
Length=358

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 77/141 (55%), Gaps = 6/141 (4%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPS  59

Query  257  GGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYV  424
               DA  L  R+LR+L S+ + +  + A      ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  425  LQHHQDALMKAWPLVHXAVVD  487
            L HH    M++W  ++ A+++
Sbjct  120  LLHHDQVFMQSWYHLNDAILE  140



>ref|XP_006280681.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
 gb|EOA13579.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
Length=363

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 82/150 (55%), Gaps = 14/150 (9%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS +E+           A L  M+LA+   +PM+L A + L++ + + +  S  P+S +
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMALKAALELDLLEIMAKNAS--PMSPT  58

Query  230  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  397
            EI +S LP+   +A   L RILR+LTSY V       ++ D+ ER Y LG V K L  ++
Sbjct  59   EI-ASKLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDSVERIYGLGPVCKYLTKNE  117

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG+S  A  L +    LM++W  +  AV+D
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAVLD  147



>gb|AHA44835.1| caffeate O-methyltransferase [Larix kaempferi]
Length=364

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 77/151 (51%), Gaps = 10/151 (7%)
 Frame = +2

Query  71   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS +E+++ N +       L  MEL N   +PM++ A + L+V   I   G+   LS  
Sbjct  1    MGSAAENSEMNTKIVNEDEWLLGMELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPR  60

Query  230  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  400
            +I++ +  +    A  L RILR+L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTALCKYLVKNQD  120

Query  401  GLSYGAYVLQHHQDALMKAWPLVHXAVVDSS  493
            G+S    VL +    LM+ W  +  AV++ +
Sbjct  121  GVSLAPLVLMNQDKVLMECWYYLKDAVLEGA  151



>ref|XP_002864309.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40568.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=363

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 82/150 (55%), Gaps = 14/150 (9%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + + GS  P+S +
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPT  58

Query  230  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  397
            EI +S LP+   +A   L RILR+LTSY V       ++ D  ER Y LG V K L  ++
Sbjct  59   EI-ASHLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNE  117

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG+S  A  L +    LM++W  +  A++D
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAILD  147



>gb|ABO41845.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=358

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 77/141 (55%), Gaps = 6/141 (4%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPS  59

Query  257  GGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYV  424
               DA  L  R+LR+L S+ + +  + A      ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCAVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  425  LQHHQDALMKAWPLVHXAVVD  487
            L HH    M++W  ++ A+++
Sbjct  120  LLHHDQVFMQSWYHLNDAILE  140



>gb|AFM73596.1| caffeate O-methyltransferase, partial [Populus simonii]
Length=300

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 67/122 (55%), Gaps = 7/122 (6%)
 Frame = +2

Query  140  SVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGV  316
            +VPM+L A + L+V + I +GG  A LSA EI +  LP+   DA   L R+LR+L SY V
Sbjct  5    AVPMALKAAIELDVLEIIAKGGPGAHLSALEI-ARCLPTQNADAPIMLDRMLRLLASYNV  63

Query  317  FREHI-----NADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAV  481
                I        + ERRY L  V K L+ ++DG+S    VL +     M++W  +  AV
Sbjct  64   LTCSIVSLDGGCGSIERRYGLAPVCKFLIRNQDGVSIAPLVLMNQDKVTMESWYHLKEAV  123

Query  482  VD  487
            +D
Sbjct  124  LD  125



>gb|AAV36304.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36306.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36314.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36318.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36320.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36322.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36326.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36328.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36332.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36336.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36340.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36342.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36344.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36352.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36356.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36358.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36360.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36362.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 67/128 (52%), Gaps = 3/128 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  299  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            L S+ V    +  +    +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  76   LASHSVLSCSVTTNENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  135

Query  470  HXAVVDSS  493
              AV+D S
Sbjct  136  KDAVLDGS  143



>gb|AHY28755.1| caffeate O-methyltransferase, partial [Pinus palustris]
Length=189

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 67/128 (52%), Gaps = 3/128 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  19   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  78

Query  299  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            L S+ V    +  +    +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  79   LASHSVLSCSVTTNENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  138

Query  470  HXAVVDSS  493
              AV+D S
Sbjct  139  KDAVLDGS  146



>gb|ABO41834.1| putative caffeic acid methyltransferase [Gossypium raimondii]
Length=358

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 77/141 (55%), Gaps = 6/141 (4%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQI-ASALPS  59

Query  257  GGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYV  424
               DA  L  R+LR+L S+ + +  + A      ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  425  LQHHQDALMKAWPLVHXAVVD  487
            L HH    M++W  ++ A+++
Sbjct  120  LLHHDQVFMQSWYHLNDAILE  140



>emb|CDX78145.1| BnaA09g33400D [Brassica napus]
Length=547

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 61/101 (60%), Gaps = 22/101 (22%)
 Frame = +2

Query  35   EKQITGKKEIEA----MGSESESAQKNARLTIME------LANMISVPMSLNAVVRLNVA  184
            E++   K+E EA    MG+ + S+ K+     ME      LANMISVPMSLNA VRL +A
Sbjct  459  ERKNREKEEQEAVVVKMGNVAISSPKSKPEKKMEEENKARLANMISVPMSLNAAVRLGIA  518

Query  185  DAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRMLTS  307
            DAIW  G+N+ LSASEIL             LQRILRMLTS
Sbjct  519  DAIWNSGANSTLSASEILP------------LQRILRMLTS  547



>gb|ABO41846.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=345

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 77/141 (55%), Gaps = 6/141 (4%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVILPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPS  59

Query  257  GGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYV  424
               DA  L  R+LR+L S+ + +  + A      ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  425  LQHHQDALMKAWPLVHXAVVD  487
            + HH    M++W  ++ A+++
Sbjct  120  VLHHDQVFMQSWYHLNDAILE  140



>gb|KDO40925.1| hypothetical protein CISIN_1g0357381mg, partial [Citrus sinensis]
Length=235

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +2

Query  122  ELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRML  301
            +LA  I +PM++ AV  L + + I + G  A LSAS+I + +          L RILR+L
Sbjct  18   QLARGIVLPMAMQAVYELGIFEIIDKAGPGAKLSASDIAAQLTTKNKDAPMMLDRILRLL  77

Query  302  TSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAV  481
             SY V    ++A  + R YSL  V K  V +KDG+S G  +   H    ++ W  +  A+
Sbjct  78   ASYSVVECSLDASGARRLYSLNSVSKYYVPNKDGVSLGPGIQITHDKVFLECWSQLKHAI  137

Query  482  VD  487
            ++
Sbjct  138  LE  139



>dbj|BAD87408.1| O-diphenol-O-methyl transferase-like [Oryza sativa Japonica Group]
 dbj|BAD87053.1| O-diphenol-O-methyl transferase-like [Oryza sativa Japonica Group]
Length=116

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 13/97 (13%)
 Frame = +2

Query  74   GSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP  253
            G + + +  +A LT+MEL NMISV M+L A +RL+V   +W  G+NAP           P
Sbjct  26   GGDGDLSPTDACLTVMELVNMISVLMALTAAIRLDVPAKLWARGANAP----------FP  75

Query  254  SGGGDAQNLQRILRMLTSYGVFREHINADASERRYSL  364
            +G  +   L+R+LR+LTS  VF EH     S R ++L
Sbjct  76   TGHPNPFVLERLLRLLTSCSVFCEH---KGSPRHFAL  109



>ref|XP_010241050.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Nelumbo nucifera]
Length=364

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 80/150 (53%), Gaps = 11/150 (7%)
 Frame = +2

Query  53   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  232
            K +I+    E E A   A    M+LA+   VPM L A + L+V + I + G+ A +S SE
Sbjct  5    KTQIKIADQEEEEACNYA----MQLASASVVPMVLKAAIELDVLEIIAEAGAGAHISTSE  60

Query  233  ILSSVLPSGGGDAQ-NLQRILRMLTSYGV----FREHINADASERRYSLGEVGKTLVTDK  397
            I +S LP+   DA   L R+LR+L S+ +     R H +    ER Y L  V K LV ++
Sbjct  61   I-ASHLPTQNPDAPVMLDRMLRLLASFSILTCSLRTHDDGRV-ERLYGLAPVCKFLVKNE  118

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG+S    VL +    LM++W  +  AV+D
Sbjct  119  DGVSMAPLVLMNQDKVLMESWYHLKDAVLD  148



>gb|AER35881.1| S-adenosyl-L-methionine:flavonoid O-methyltransferase [Ginkgo 
biloba]
Length=362

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 65/128 (51%), Gaps = 3/128 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL N   +PM++ A V L+V   I   G  A +S  EI++ +  +    A  L RILR+
Sbjct  20   MELGNFSCLPMAMKAAVELDVLQIIANAGHGAQISPREIVTHIPTTNPDAAITLDRILRV  79

Query  299  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            L S+ V    +  D    + R Y L  + K LV +KDG+S    VL +     M++W  +
Sbjct  80   LASHSVLSSSVTTDENGKTGRVYGLTPLCKYLVQNKDGVSLAPLVLMNQDKVFMESWYYL  139

Query  470  HXAVVDSS  493
              AV+D S
Sbjct  140  KDAVLDGS  147



>gb|EPS67212.1| hypothetical protein M569_07558 [Genlisea aurea]
Length=364

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 79/143 (55%), Gaps = 5/143 (3%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            + S ++S ++ A L  M+LA+   +PM L + + LN+ + I   G+ + +S +E L++ L
Sbjct  9    LPSPTDSDEEGAFLFAMQLASASVLPMVLKSAIELNLLELIKTSGAGSFVSPAE-LAAQL  67

Query  251  PSGGGDAQN-LQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGA  418
            P+   DA   + RILR+L  Y V    +   A    ERRY LG V K L  ++DG+S   
Sbjct  68   PASNADAPVVIDRILRLLACYDVLSCRVETLADGGIERRYGLGPVCKFLTKNEDGVSMAP  127

Query  419  YVLQHHQDALMKAWPLVHXAVVD  487
             VL +    LM++W  +  AV++
Sbjct  128  LVLMNQDKVLMESWYHLKDAVLE  150



>ref|XP_010069184.1| PREDICTED: uncharacterized protein LOC104456144 [Eucalyptus grandis]
Length=144

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 41/63 (65%), Gaps = 8/63 (13%)
 Frame = +2

Query  260  GGDAQNLQRILRMLTSYGVFREHINAD--------ASERRYSLGEVGKTLVTDKDGLSYG  415
             GDA+NLQR+LRML S+G F E   A           ERR+SL EV KTLVTD +GLSY 
Sbjct  19   AGDAENLQRLLRMLASHGAFEERFPATSASSASSGCFERRFSLTEVRKTLVTDAEGLSYA  78

Query  416  AYV  424
            AYV
Sbjct  79   AYV  81



>gb|AAV36346.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 66/128 (52%), Gaps = 3/128 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  299  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            L S+ V    +       +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  76   LASHSVLSCSVTTSENGKAERFYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  135

Query  470  HXAVVDSS  493
              AV+D S
Sbjct  136  KDAVLDGS  143



>gb|AAV36308.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36310.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36312.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36316.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36324.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36330.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36334.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36338.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36350.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36364.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 66/128 (52%), Gaps = 3/128 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  299  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            L S+ V    +       +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  76   LASHSVLSCSVTTSENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  135

Query  470  HXAVVDSS  493
              AV+D S
Sbjct  136  KDAVLDGS  143



>gb|AAV36354.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 66/128 (52%), Gaps = 3/128 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  299  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            L S+ V    +       +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  76   LASHSVLSCSVTTSENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  135

Query  470  HXAVVDSS  493
              AV+D S
Sbjct  136  KDAVLDGS  143



>dbj|BAJ34520.1| unnamed protein product [Thellungiella halophila]
Length=364

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 81/151 (54%), Gaps = 15/151 (10%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + +  +  P+S S
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAK--NTKPMSPS  58

Query  230  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTD  394
            EI +S LP+   +A   L RILR+LT+Y V     R   N D  ER Y LG V K L  +
Sbjct  59   EI-ASHLPTKNPEAPVMLDRILRLLTAYSVLTCSNRTLPNGDGVERLYGLGPVCKYLTKN  117

Query  395  KDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            +DG+S  A  L +    LM++W  +  A++D
Sbjct  118  EDGVSIAALCLMNQDKVLMESWYHLKDAILD  148



>gb|ACD56610.1| putative caffeic acid protein [Gossypioides kirkii]
Length=358

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 76/141 (54%), Gaps = 6/141 (4%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G    LS S+I +S LPS
Sbjct  2    SQEDQDEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGTFLSPSQI-ASCLPS  59

Query  257  GGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYV  424
               DA  L  R+LR+L S+ + +  + A      ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  425  LQHHQDALMKAWPLVHXAVVD  487
            L HH    M++W  ++ A+++
Sbjct  120  LLHHDQVFMQSWYHLNDAILE  140



>ref|XP_006401613.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
 gb|ESQ43066.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
Length=364

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 81/151 (54%), Gaps = 15/151 (10%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + +  +  P+S S
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAK--NTKPMSPS  58

Query  230  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTD  394
            EI +S LP+   +A   L RILR+LT+Y V     R   N D  ER Y LG V K L  +
Sbjct  59   EI-ASHLPTKNPEAPVMLDRILRLLTAYSVLTCSNRTLPNGDGVERLYGLGPVCKYLTKN  117

Query  395  KDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            +DG+S  A  L +    LM++W  +  A++D
Sbjct  118  EDGVSIAALCLMNQDKVLMESWYHLKDAILD  148



>gb|ABO41852.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=358

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 74/140 (53%), Gaps = 4/140 (3%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I S++   
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQIASALPSK  60

Query  257  GGGDAQNLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYVL  427
              G    L R+LR+L S+ + +  + A      ER Y  G + K LV ++DG S    +L
Sbjct  61   NPGAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLLL  120

Query  428  QHHQDALMKAWPLVHXAVVD  487
             HH    M++W  ++ A+++
Sbjct  121  LHHDQVFMQSWYHLNDAILE  140



>ref|XP_007136428.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
 gb|ESW08422.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
Length=365

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 81/151 (54%), Gaps = 9/151 (6%)
 Frame = +2

Query  47   TGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  226
            TG+ +I    + S  + + A L  M+LA+   +PM L + + L++ + I +GG    LS 
Sbjct  4    TGETQI----TPSHVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIIAKGGPGVHLSP  59

Query  227  SEILSSVLPSGGGDAQ-NLQRILRMLTSYGV--FREHINADAS-ERRYSLGEVGKTLVTD  394
            S+I +S LP+   +A   L RILR+L SY +  F      D   ER Y L  V K LV +
Sbjct  60   SQI-ASQLPTRNPEAPVMLDRILRLLASYNILSFTLRTLPDGKVERLYGLAPVAKYLVKN  118

Query  395  KDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            +DG+S  A  L +    LM++W  +  AV+D
Sbjct  119  EDGVSIAALNLMNQDKVLMESWYYLKDAVLD  149



>ref|XP_011084578.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=131

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 69/128 (54%), Gaps = 5/128 (4%)
 Frame = +2

Query  89   SAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  268
            S ++ A L  MELA+   +PM L + + L++ + I + G  A +S S+ L++ LP+   D
Sbjct  5    SEEEEAFLFAMELASASVLPMVLKSAIELDLLELIKKAGPGASVSPSQ-LAAQLPTKNPD  63

Query  269  AQNL-QRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHH  436
            A  +  R+LR+L +Y V R  +        ER YSL  V K L  ++DG+S   + L   
Sbjct  64   AATMIDRMLRLLAAYSVVRCSLKPLPDGGVERLYSLAPVCKFLTRNEDGVSLAPFALLIQ  123

Query  437  QDALMKAW  460
               LM++W
Sbjct  124  DKVLMESW  131



>gb|AHY28752.1| caffeate O-methyltransferase, partial [Pinus echinata]
Length=359

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 67/128 (52%), Gaps = 3/128 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  19   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  78

Query  299  LTSYGVFREHINADA---SERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            L S+ V    +  +    +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  79   LASHSVLSCSVTTNENGNAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  138

Query  470  HXAVVDSS  493
              AV+D S
Sbjct  139  KDAVLDGS  146



>ref|XP_002864307.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40566.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 76/149 (51%), Gaps = 12/149 (8%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + + GS  P+S +
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPT  58

Query  230  EILSSVLPSGGGDAQNLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDKD  400
            EI S +     G    L RILR+LTS+ V       ++ D  ER Y LG V K L  ++D
Sbjct  59   EIASHLPTKNPGAPVMLDRILRLLTSHSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNED  118

Query  401  GLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            G+S     L      LM++W  +  A++D
Sbjct  119  GVSIAGLCLTSQDKVLMESWYHLKDAILD  147



>dbj|BAK42963.1| caffeic acid O-methylltransferase [Chrysanthemum x morifolium]
Length=355

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 78/142 (55%), Gaps = 4/142 (3%)
 Frame = +2

Query  71   MGSESESAQKN--ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            MGS +  A+K+  A L  M+LA+   +PM L + + L++ + I + G  A +S +E+ + 
Sbjct  1    MGSSALDAKKDEEAFLFAMQLASASVLPMVLKSAIELDLLEIIAKAGPGAYVSPTELAAQ  60

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAY  421
            +      +A   L RI R+L SY V    +N D SER Y L  V K LV ++DG+S    
Sbjct  61   LPKVENPEAPVMLDRICRLLASYSVLTCKLN-DQSERLYGLAPVCKYLVKNEDGVSNAPL  119

Query  422  VLQHHQDALMKAWPLVHXAVVD  487
            +L +    LM++W  +  AV+D
Sbjct  120  LLMNQDKILMESWYHLKDAVLD  141



>gb|AHY28754.1| caffeate O-methyltransferase, partial [Pinus elliottii]
Length=359

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 3/128 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  19   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  78

Query  299  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            L S+ V    +  +    +ER Y L  + K L+ ++DG+S    VL +    LM++W  +
Sbjct  79   LASHSVLSCSVTTNENGKAERLYGLTPLCKYLIKNQDGVSLAPLVLMNQDKVLMESWYYL  138

Query  470  HXAVVDSS  493
              AV+D S
Sbjct  139  KDAVLDGS  146



>gb|KDO44005.1| hypothetical protein CISIN_1g018576mg [Citrus sinensis]
Length=353

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 76/141 (54%), Gaps = 4/141 (3%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            MGS  +  +  +     +LA    +PM++ AV  L +   I + G  A LSAS+I ++ L
Sbjct  1    MGSIVDGERDQSFAYANQLAMGTVLPMAMQAVYELGIFQIIDKAGPGAKLSASDI-AAQL  59

Query  251  PSGGGDAQN-LQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVL  427
            P+   DA   L RILR+L SY V    ++   + RRYSL  V K  V +KDG+S G   L
Sbjct  60   PTKNKDAPTMLDRILRLLASYSVVECSLDGSGARRRYSLNSVSKYYVPNKDGVSLGP-AL  118

Query  428  QHHQD-ALMKAWPLVHXAVVD  487
            Q  QD   +++W  +  A+++
Sbjct  119  QMIQDKVFLESWSHLKDAILE  139



>ref|XP_006431772.1| hypothetical protein CICLE_v10001661mg [Citrus clementina]
 gb|ESR45012.1| hypothetical protein CICLE_v10001661mg [Citrus clementina]
Length=353

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 76/141 (54%), Gaps = 4/141 (3%)
 Frame = +2

Query  71   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  250
            MGS  +  +  +     +LA    +PM++ AV  L +   I + G  A LSAS+I ++ L
Sbjct  1    MGSIVDGERDQSFAYANQLAMGTVLPMAMQAVYELGIFQIIDKAGPGAKLSASDI-AAQL  59

Query  251  PSGGGDAQN-LQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVL  427
            P+   DA   L RILR+L SY V    ++   + RRYSL  V K  V +KDG+S G   L
Sbjct  60   PTKNKDAPTMLDRILRLLASYSVVECSLDGSGARRRYSLNSVSKYYVPNKDGVSLGP-AL  118

Query  428  QHHQD-ALMKAWPLVHXAVVD  487
            Q  QD   +++W  +  A+++
Sbjct  119  QMIQDKVFLESWSHLKDAILE  139



>ref|XP_009119948.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Brassica rapa]
 emb|CDY14330.1| BnaA10g07250D [Brassica napus]
Length=362

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 80/149 (54%), Gaps = 13/149 (9%)
 Frame = +2

Query  71   MGSESESAQKNARLT-------IMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS +E+     ++T        ++LA+   +PM+L + + L++ + + +  S  P+SAS
Sbjct  1    MGSTAETHSTPVQVTDDETALFAIQLASASVLPMALKSAIELDLLEIMARNCS--PMSAS  58

Query  230  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA--DASERRYSLGEVGKTLVTDKD  400
            EI SS LP+   +A   L RILR+LT+Y V    +    D  +R Y LG V K  + ++D
Sbjct  59   EI-SSHLPTKNPEAPVMLDRILRLLTAYSVLTCSVRTLPDGVDRLYGLGPVCKYFIKNED  117

Query  401  GLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            G+S     L +H    M +W  +  AV+D
Sbjct  118  GVSIAPLCLLNHDKVFMGSWYYLKDAVLD  146



>dbj|BAD18975.1| phloroglucinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=371

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 75/142 (53%), Gaps = 11/142 (8%)
 Frame = +2

Query  80   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  259
            E E   K A    + LAN++ +PM L + + LNV D IW  G    LS S+I ++ LP+ 
Sbjct  21   EEEELGKQA----IRLANVVILPMVLKSALELNVIDIIWGAGDGESLSPSDI-AAQLPTK  75

Query  260  GGDAQN-LQRILRMLTSYGVFR--EHINADAS-ERRYSLGEVGKTLVTDKDG--LSYGAY  421
              +A   L R+LR+L S+ + +      +D   ER YS G + K LV D++G   S G  
Sbjct  76   NSNAPAVLDRMLRLLASHSILKCSARTGSDGQVERLYSAGPICKFLVKDQNGGTRSVGPL  135

Query  422  VLQHHQDALMKAWPLVHXAVVD  487
             L HH    M+ W  ++ A+++
Sbjct  136  FLLHHDKVFMEGWFHLNDAILE  157



>gb|EEC84528.1| hypothetical protein OsI_31257 [Oryza sativa Indica Group]
Length=620

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 49/74 (66%), Gaps = 5/74 (7%)
 Frame = +2

Query  281  QRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDG---LSYGAYVLQHHQDALM  451
             R+LR+L S GVF EH ++  S RR+SL  V +TLV    G    SY  YVLQHHQD L+
Sbjct  347  HRLLRLLASRGVFSEHTSS--SPRRFSLTTVSRTLVPAGGGSSAASYADYVLQHHQDELV  404

Query  452  KAWPLVHXAVVDSS  493
            +AW L+H AV+D +
Sbjct  405  RAWSLLHEAVLDPA  418



>gb|AIJ28474.1| O-methyltransferase [Vaccinium corymbosum]
Length=370

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 81/155 (52%), Gaps = 17/155 (11%)
 Frame = +2

Query  71   MGSESES------------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNA  214
            MGSESE+             ++ A L  M+LA+   +PM L + + L++ + + + G  A
Sbjct  1    MGSESENQTSSTSTPVGSEEEEEACLFAMQLASASVLPMVLKSAIELDLLETMAKAGPGA  60

Query  215  PLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKT  382
             +S +E L++ LP+   DA   L RILR+LTSY V     + +     ER Y+L  V K 
Sbjct  61   FVSPTE-LAAQLPTQNPDAAVMLDRILRLLTSYSVLNCSVKSLPGGGVERLYALAPVCKY  119

Query  383  LVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            L  + DG+S    +L +    LM++W  +  AV+D
Sbjct  120  LTRNSDGVSMAPLLLMNQDKVLMESWYYLKDAVLD  154



>gb|AEQ59236.1| putative S-adenosyl-L-methionine:flavonoid O-methyltransferase 
[Ginkgo biloba]
Length=296

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 3/128 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL N   +PM++ A V L+V   I   G  A +S  EI++ +  +    A  L RI R+
Sbjct  20   MELGNFSCLPMAMKAAVELDVLQIIANAGHGAQISPREIVTHIPTTNPDAAITLARIFRV  79

Query  299  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            L S+ V    +  D    +ER Y L  + K L  +KDG+S    +L       M++W  +
Sbjct  80   LASHSVLSSSVTTDENGKTERVYGLTPLYKYLEQNKDGVSLAPLLLMSQDKVFMESWYYL  139

Query  470  HXAVVDSS  493
              AV+D S
Sbjct  140  KDAVLDGS  147



>gb|AHY28757.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=359

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 66/128 (52%), Gaps = 3/128 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  19   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  78

Query  299  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            L S+ V    +       +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  79   LASHSVLSCSVTTSENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  138

Query  470  HXAVVDSS  493
              AV+D S
Sbjct  139  KDAVLDGS  146



>gb|ABU53653.1| caffeic acid O-3-methyltransferase [Populus deltoides]
Length=364

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (53%), Gaps = 7/146 (5%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGV----FREHINADASERRYSLGEVGKTLVTDKDGLS  409
             LP+   DA   L RILR+L SY +     ++H +    ER Y L  V K L  ++DG+S
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVS  123

Query  410  YGAYVLQHHQDALMKAWPLVHXAVVD  487
                 L +    LM++W  +  A++D
Sbjct  124  VSPLCLMNQDKVLMESWYYLKDAILD  149



>gb|AET34455.1| putative S-adenosyl-L-methionine: flavonoid O-methyltransferase 
[Ginkgo biloba]
Length=270

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 3/128 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL N   +PM++ A V L+V   I   G  A +S  EI++ +  +    A  L RI R+
Sbjct  20   MELGNFSCLPMAMKAAVELDVLQIIANAGHGAQISPREIVTHIPTTNPDAAITLARIFRV  79

Query  299  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            L S+ V    +  D    +ER Y L  + K L  +KDG+S    +L       M++W  +
Sbjct  80   LASHSVLSSSVTTDENGKTERVYGLTPLYKYLEQNKDGVSLAPLLLMSQDKVFMESWYYL  139

Query  470  HXAVVDSS  493
              AV+D S
Sbjct  140  KDAVLDGS  147



>gb|ACN41351.2| putative caffeic acid O-methyltransferase [Betula pendula]
Length=365

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 79/150 (53%), Gaps = 12/150 (8%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS +E+       + + A L  M+LA+   +PM L + + L++ + + + G  A LS S
Sbjct  1    MGSTAETQMTPTQVSDEEANLFAMQLASASVLPMILKSAIELDLLEIMAKAGPGAYLSPS  60

Query  230  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK  397
            EI +S LP+   DA   L RILR+L SY V    +        ER Y LG V K L  ++
Sbjct  61   EI-ASQLPTTNPDAPVMLDRILRLLASYSVLTYSLRTLPDGRVERLYGLGPVCKFLTKNE  119

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG+S  A  L +    LM++W  +  AV++
Sbjct  120  DGVSIAALNLMNQDKVLMESWYYLKDAVLE  149



>gb|AAF60951.1| O-methyltransferase [Populus trichocarpa x Populus deltoides]
Length=364

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (53%), Gaps = 7/146 (5%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGV----FREHINADASERRYSLGEVGKTLVTDKDGLS  409
             LP+   DA   L RILR+L SY +     ++H +    ER Y L  V K L  ++DG+S
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVS  123

Query  410  YGAYVLQHHQDALMKAWPLVHXAVVD  487
                 L +    LM++W  +  A++D
Sbjct  124  VSPLCLMNQDKVLMESWYYLKDAILD  149



>prf||1906376A O-methyltransferase
Length=364

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (53%), Gaps = 7/146 (5%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGV----FREHINADASERRYSLGEVGKTLVTDKDGLS  409
             LP+   DA   L RILR+L SY +     ++H +    ER Y L  V K L  ++DG+S
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILICSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVS  123

Query  410  YGAYVLQHHQDALMKAWPLVHXAVVD  487
                 L +    LM++W  +  A++D
Sbjct  124  VSPLCLMNQDKVLMESWYYLKDAILD  149



>gb|KHG13754.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=387

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 79/158 (50%), Gaps = 5/158 (3%)
 Frame = +2

Query  26   SRIEKQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGG  205
            S I   IT     E   + ++ +   A L  M+LA+   +PM L + + L++ + + + G
Sbjct  15   SFITPDITMGSIGETQMTPTQVSDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAG  74

Query  206  SNAPLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEV  373
              A LS  E+ +S LP+   DA   L RILR+L SY V    +        ER Y LG V
Sbjct  75   PGAFLSPKEV-ASKLPTTNPDAPVMLDRILRLLASYNVLTCSLRTFPGGKVERLYGLGPV  133

Query  374  GKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
             K L  ++DG++  A  L +    LM++W  +  AV+D
Sbjct  134  CKFLTKNEDGVTLSALSLMNQDKVLMESWYYLKDAVLD  171



>gb|ABK23795.1| unknown [Picea sitchensis]
Length=365

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 70/131 (53%), Gaps = 3/131 (2%)
 Frame = +2

Query  110  LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRI  289
            L  MEL N   +PM++ A + L+V   I   G+   L++++I++ +  +    A +L RI
Sbjct  22   LLCMELGNFSCLPMAMKAAIELDVFQIIANAGNGVQLASTQIVARIQTTNPDAAISLNRI  81

Query  290  LRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  460
            L++L S+ V    +  D    +E  Y L  + K LV ++DG+S   +VL +     M++W
Sbjct  82   LKVLASHSVLSCSVTMDENGKAECLYGLTSLCKYLVKNRDGISLAPWVLMNQDKVFMESW  141

Query  461  PLVHXAVVDSS  493
              +  AV++ S
Sbjct  142  HYLKDAVLEGS  152



>gb|AAD29845.1|AF064697_1 O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 70/134 (52%), Gaps = 3/134 (2%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  274
            ++ A L  M+LA+   +PM L A + L+V + I + G  A ++ SEI S +  S      
Sbjct  15   EEEACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGQGAYVAPSEIASQLSTSNSQAPI  74

Query  275  NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDA  445
             L RILR+L SY V   ++        ER Y L  V K LV ++DG+S    VL +    
Sbjct  75   ILDRILRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKV  134

Query  446  LMKAWPLVHXAVVD  487
            LM++W  +  AV+D
Sbjct  135  LMESWYHLKDAVLD  148



>ref|XP_007223223.1| hypothetical protein PRUPE_ppa007212mg [Prunus persica]
 gb|EMJ24422.1| hypothetical protein PRUPE_ppa007212mg [Prunus persica]
Length=377

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 71/129 (55%), Gaps = 7/129 (5%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL-QRILR  295
            + LAN++ +PM L + + LN+ D I   G    LS SEI +S LP+   DA  L  R+LR
Sbjct  32   IRLANVVILPMVLKSAIELNIIDIISAAGDGKFLSPSEIAAS-LPTKNPDASVLLDRMLR  90

Query  296  MLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK-DGL-SYGAYVLQHHQDALMKAW  460
            +LTS+ + +  +        ER Y  G + K LV D+ DG+ S G  +L HH    M++W
Sbjct  91   LLTSHSILKCSVRTGQDGKVERLYGAGALCKFLVKDQHDGVGSVGPLLLLHHDKVFMESW  150

Query  461  PLVHXAVVD  487
               + AV++
Sbjct  151  CHFNDAVLE  159



>gb|ABK21417.1| unknown [Picea sitchensis]
Length=365

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 65/128 (51%), Gaps = 3/128 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL N   +PM++ A V L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  25   MELGNFSCLPMAMKAAVELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  84

Query  299  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            L S+ V    +  D    +ER Y L  + K LV ++DG+S    VL +     M+ W  +
Sbjct  85   LASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLINQDKVFMETWYYL  144

Query  470  HXAVVDSS  493
              AV++ S
Sbjct  145  KDAVLEGS  152



>gb|AGG91492.1| caffeic acid 3-O-methyltransferase [Betula platyphylla]
Length=365

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 77/145 (53%), Gaps = 5/145 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L + + L++ + + + G  A LS SE+ +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMILKSAIELDLLEIMAKAGPGAYLSPSEV-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L SY V    +        ER Y LG V K L  ++DG+S 
Sbjct  65   QLPTTNPDAPVMLDRILRLLASYSVLTYSLRTLPDGRVERLYGLGPVCKFLTKNEDGVSI  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVVD  487
             A  L +    LM++W  +  AV++
Sbjct  125  AALNLMNQDKVLMESWYYLKDAVLE  149



>ref|XP_002525818.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF36570.1| o-methyltransferase, putative [Ricinus communis]
Length=365

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 76/144 (53%), Gaps = 5/144 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L + + L++ + + + G +A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPSAFLSPSEI-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L SY V    +        ER Y L  V K L+ ++DG+S 
Sbjct  65   QLPTKNPDAPVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLAPVCKFLIKNEDGVSI  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVV  484
                L +    LM++W  +  AV+
Sbjct  125  APLCLMNQDKVLMESWYYLKDAVL  148



>gb|KJB52493.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
 gb|KJB52494.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
Length=275

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 79/158 (50%), Gaps = 5/158 (3%)
 Frame = +2

Query  26   SRIEKQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGG  205
            S I   IT     E   + ++ + + A    M+LA+   +PM L + + L++ + + + G
Sbjct  15   SFITPDITMGSIGETQMTPTQVSDEEANSFAMQLASASVLPMVLKSAIELDLLEIMAKAG  74

Query  206  SNAPLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEV  373
              A LS  E+ +S LP+   DA   L RILR+L SY V    +        ER Y LG V
Sbjct  75   PGAFLSPKEV-ASKLPTTNPDAPVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLGPV  133

Query  374  GKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
             K L  ++DG++  A  L +    LM++W  +  AV+D
Sbjct  134  CKFLTKNEDGVTLSALSLMNQDKVLMESWYYLKDAVLD  171



>gb|KDP28404.1| hypothetical protein JCGZ_14175 [Jatropha curcas]
Length=383

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 69/129 (53%), Gaps = 4/129 (3%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN-LQRILR  295
            M+L N   +PM+L   + L + + +   G N  LSA EI + ++P+   +A   L+RILR
Sbjct  39   MQLVNASVLPMTLKTAIDLGILNILASAGPNVNLSAEEI-AVLIPTRNPEAPGMLERILR  97

Query  296  MLTSYGVFREHINADA--SERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  469
            +L SY V    +  +   +ER+Y LG V K  V D+DG+S    +   H    +++W  +
Sbjct  98   LLVSYSVLGCSVGFEVQGTERKYCLGPVAKYFVRDEDGVSLAPLMALTHDKVFLESWSGL  157

Query  470  HXAVVDSSS  496
              A+++  +
Sbjct  158  KDAILEGGT  166



>ref|XP_011025357.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Populus euphratica]
 ref|XP_011025358.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Populus euphratica]
Length=358

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 78/143 (55%), Gaps = 4/143 (3%)
 Frame = +2

Query  62   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  241
            IE   S+ + A+       M+LA    +PM+L+  ++L + + I + G +  LSAS+I +
Sbjct  5    IENQASQVDEAKDEHFGYAMQLALSSVLPMTLHTAIQLGIFEIIAKAGPDVKLSASDI-A  63

Query  242  SVLPSGGGDAQN-LQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  418
            + +P+   DA   L RILR+L S+ V    +  D SER YSL  V K  V +K+G+S   
Sbjct  64   AKMPTDNPDAPKMLDRILRLLASHQVLCCFV--DGSERFYSLAPVSKYFVPNKNGVSLAP  121

Query  419  YVLQHHQDALMKAWPLVHXAVVD  487
            ++     +  +++W  +  AV++
Sbjct  122  FMALIQDNVFLQSWSQLKDAVLE  144



>ref|XP_010103059.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB94708.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=264

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 70/135 (52%), Gaps = 3/135 (2%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS S+++S 
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKTALDLDLLEIMAKAGPGAYLSPSDVVSQ  65

Query  245  VLPSGGGDAQNLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYG  415
            +     G    L R+LR+L SY +      ++     ER Y LG V K L  ++DG+S G
Sbjct  66   LPTKNPGAPVMLDRVLRLLASYSILTYSLRNLPDGKVERLYGLGPVCKYLTKNEDGVSIG  125

Query  416  AYVLQHHQDALMKAW  460
            +  L +    LM++W
Sbjct  126  SLCLMNQDKVLMESW  140



>gb|ACT32028.1| caffeic acid O-methyltransferase 1 [Gossypium hirsutum]
Length=366

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 75/145 (52%), Gaps = 5/145 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ +   A L  M+LA+   +PM L + + L++ + + + G  A LS  E+ +S
Sbjct  6    ETQMTPTQVSDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKEV-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L SY V    +        ER Y LG V K L  ++DG++ 
Sbjct  65   KLPTTNPDAPVMLDRILRLLASYNVLTCSLRTFPGGKVERLYGLGPVCKFLTRNEDGVTL  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVVD  487
             A  L +    LM++W  +  AV+D
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLD  149



>gb|ABK25932.1| unknown [Picea sitchensis]
Length=353

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 70/131 (53%), Gaps = 3/131 (2%)
 Frame = +2

Query  110  LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRI  289
            L  MEL N   +PM++ A + L+V   I   G+   L++++I++ +  +    A +L RI
Sbjct  10   LLCMELGNFSCLPMAMKAAIELDVFQIIANAGNGVQLASTQIVARIPTTNPDAAISLDRI  69

Query  290  LRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  460
            L++L S+ V    +  D    +E  Y L  + K LV ++DG+S   +VL +     M++W
Sbjct  70   LKVLASHSVLSCSVTMDENGKAEGLYGLTPLCKYLVKNRDGISLAPWVLMNQDKVFMESW  129

Query  461  PLVHXAVVDSS  493
              +  AV++ S
Sbjct  130  HYLKDAVLEGS  140



>gb|KDP24164.1| hypothetical protein JCGZ_25821 [Jatropha curcas]
Length=360

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 0/117 (0%)
 Frame = +2

Query  137  ISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGV  316
            I +PM +   + L + D I + G +A LSAS+I + +  S       L RILR+L S  V
Sbjct  29   IVLPMVMQTAIELGIFDIIAKAGPDAKLSASDIAAQLSASNPSAPSMLDRILRLLASNSV  88

Query  317  FREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
                + ++  +R Y L    K  V +KDG+S G +++ +     M++WP V  A+++
Sbjct  89   LGCSLASNTQQRLYHLISASKYFVKNKDGVSLGPFMILNQDKVYMESWPSVKDAILE  145



>ref|XP_011043758.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Populus euphratica]
Length=365

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 75/145 (52%), Gaps = 5/145 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVVD  487
                L +    LM++W  +  A++D
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILD  149



>emb|CDY43839.1| BnaC03g14720D [Brassica napus]
Length=364

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 75/150 (50%), Gaps = 13/150 (9%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS +E+           A L  M+LA+   +PM L + + L++ + + +  S  P+S S
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMVLKSALDLDLLEIMAKNSS--PMSPS  58

Query  230  EILSSVLPSGGGDAQNLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTDK  397
            EI S +          L RILR+LTSY +     R     D+ ER Y LG V K L  ++
Sbjct  59   EIASKLQTKNPEAPVMLDRILRLLTSYSILTCSNRTIPGGDSVERIYGLGPVCKYLTKNE  118

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG+S  A  L +    LM++W  +  AV+D
Sbjct  119  DGVSIAALCLMNQDKVLMESWYHLKDAVLD  148



>gb|AFZ78575.1| caffeic acid O-methyltransferase [Populus tomentosa]
Length=365

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 75/145 (52%), Gaps = 5/145 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVVD  487
                L +    LM++W  +  A++D
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILD  149



>ref|XP_002320237.1| eugenol O-methyltransferase family protein [Populus trichocarpa]
 gb|ABK92890.1| unknown [Populus trichocarpa]
 gb|EEE98552.1| eugenol O-methyltransferase family protein [Populus trichocarpa]
Length=358

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 73/124 (59%), Gaps = 4/124 (3%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA-QNLQRILR  295
            M+LA    +PM++ + ++L + + I + G +A LSAS++ ++ LP+   DA   L RILR
Sbjct  24   MQLALSSVLPMTMYSAIQLGIFEIIAKAGPDAKLSASDV-AAQLPTKNPDAPMMLDRILR  82

Query  296  MLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHX  475
            +L S+ V     + D SER YSL  V K  V +KDG+S G ++     +  +++W  +  
Sbjct  83   LLASHDVLG--CSVDGSERLYSLAPVSKHYVRNKDGVSLGPFMALIQDNVFLQSWSQLKD  140

Query  476  AVVD  487
            AV++
Sbjct  141  AVLE  144



>gb|AAD29841.1|AF064693_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=364

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 68/131 (52%), Gaps = 3/131 (2%)
 Frame = +2

Query  104  ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQ  283
            A L  M+LA+   +PM L A + L+V + I + G  A ++ SEI S +  S       L 
Sbjct  20   AYLHAMQLASASVLPMVLKAAIELDVLEIIAKAGKGAYVAPSEIASQLSTSNSQAPTVLD  79

Query  284  RILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  454
            R+LR+L SY V      ++     ER Y L  V K LV ++DG+S    VL +    LM+
Sbjct  80   RMLRLLASYKVLTCNLRNLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLME  139

Query  455  AWPLVHXAVVD  487
            +W  +  AV+D
Sbjct  140  SWYHLKDAVLD  150



>gb|AAD29842.1|AF064694_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 70/134 (52%), Gaps = 3/134 (2%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  274
            ++ A L  M+LA+   +PM L A + L+V + I + G  A ++ +EI S +  S      
Sbjct  15   EEEACLHAMQLASASVLPMVLKAAIELSVLEIIAKAGQGAYVAPTEIASQLSTSNSQAPI  74

Query  275  NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDA  445
             L RILR+L SY V   ++        ER Y L  V K LV ++DG+S    VL +    
Sbjct  75   ILDRILRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSIAPLVLMNQDKV  134

Query  446  LMKAWPLVHXAVVD  487
            LM++W  +  AV+D
Sbjct  135  LMESWYHLKDAVLD  148



>sp|Q00763.1|COMT1_POPTM RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus tremuloides]
 emb|CAA44006.1| lignin bispecific acid/5-hydroxyferulic acid methyltransferase 
[Populus tremuloides]
 gb|AAB61731.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Populus 
tremuloides]
Length=365

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 75/145 (52%), Gaps = 5/145 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVVD  487
                L +    LM++W  +  A++D
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILD  149



>sp|Q9XGW0.1|COMT1_OCIBA RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Ocimum basilicum]
 gb|AAD38189.1|AF154917_1 caffeic acid O-methyltransferase [Ocimum basilicum]
Length=361

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 77/148 (52%), Gaps = 10/148 (7%)
 Frame = +2

Query  71   MGSESESAQKNAR-----LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI  235
            MGS + + Q N+      L  M+LA+   +PM L + + L++ + I + G+ A +S  + 
Sbjct  1    MGSATNTPQINSDEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKSGAGAFVSPVD-  59

Query  236  LSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDG  403
            L++ LP+   DA   L RILR+LTSY +    +        ER Y L  V K L  ++DG
Sbjct  60   LAAQLPTTNPDAHVMLDRILRLLTSYAILECRLKTLPDGGVERLYGLAPVCKFLTKNEDG  119

Query  404  LSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            +S     L +    LM++W  +  AVVD
Sbjct  120  VSMAPLTLMNQDKVLMESWYHLSDAVVD  147



>gb|AFK40372.1| unknown [Lotus japonicus]
Length=365

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 79/150 (53%), Gaps = 12/150 (8%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS  E+       + + A L  M+LA+   +PM L + + L++ + I + G+ A LS +
Sbjct  1    MGSTGETQITPTHVSDEEANLFAMQLASASVLPMVLKSAIELDLLEFIAKAGTGAQLSPA  60

Query  230  EILSSVLPSGGGDAQN-LQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK  397
            EI +S LP+   DA   L R+LR+L  Y +    +  +     +R Y L  V K LV ++
Sbjct  61   EI-ASQLPTTNPDAPTVLDRMLRLLACYNILTCSVRTEQDGKVQRLYGLAPVAKYLVKNE  119

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG+S  A  L +    LM++W  +  AV++
Sbjct  120  DGVSISALNLMNQDKVLMESWYHLKDAVLE  149



>ref|XP_002317838.1| Chain A family protein [Populus trichocarpa]
 gb|ABK92533.1| unknown [Populus trichocarpa]
 gb|ACC63886.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa]
 gb|ACJ76441.1| caffeic acid 3-O-methyltransferase 1 [Populus trichocarpa]
 gb|EEE96058.1| Chain A family protein [Populus trichocarpa]
Length=364

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 75/145 (52%), Gaps = 5/145 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVVD  487
                L +    LM++W  +  A++D
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILD  149



>ref|XP_010671332.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 65/118 (55%), Gaps = 5/118 (4%)
 Frame = +2

Query  146  PMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN-LQRILRMLTSYGVFR  322
            PM L AV+ L+V + I + G NA LS +EI++  LPS   DA   L R+LR+L SY +  
Sbjct  30   PMVLKAVIELDVLEIIKRAGPNAQLSPAEIVAQ-LPSKNPDAATMLDRMLRLLASYSILS  88

Query  323  EHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
              +        ER Y L  V + L  ++DG++ GA  L +    LM++W  +  AV+D
Sbjct  89   YSLRTLPDGKVERLYGLAPVCQFLTKNQDGVTLGALSLMNQDKILMESWYHLKDAVLD  146



>gb|KDO44721.1| hypothetical protein CISIN_1g036188mg, partial [Citrus sinensis]
Length=210

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +2

Query  122  ELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRML  301
            +LA  + +PM++ AV  L + + + + G    LSAS+I + +L         L RILR+L
Sbjct  18   QLATGVVLPMAIQAVYELGIFEILDKAGPGTKLSASDIAAQLLTKNKDAPMMLDRILRLL  77

Query  302  TSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAV  481
             SY V    ++A  + R YSL  V K  V +KDG+  G  +       ++++W  +  A+
Sbjct  78   ASYSVVECSLDASGARRLYSLNSVSKYYVPNKDGVLLGPLIQIIQDKVILESWSQLKDAI  137

Query  482  VD  487
            ++
Sbjct  138  LE  139



>gb|AAD29844.1|AF064696_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=364

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 68/131 (52%), Gaps = 3/131 (2%)
 Frame = +2

Query  104  ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQ  283
            A L  M+LA+   +PM L A + L+V + I + G  A ++ SEI S +  S       L 
Sbjct  20   ACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGKGAYVAPSEIASQLSTSNSQAPTVLD  79

Query  284  RILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  454
            R+LR+L SY V      ++     ER Y L  V K LV ++DG+S    VL +    LM+
Sbjct  80   RMLRLLASYKVLTCNLRNLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLME  139

Query  455  AWPLVHXAVVD  487
            +W  +  AV+D
Sbjct  140  SWYHLKDAVLD  150



>gb|AAD29843.1|AF064695_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 70/134 (52%), Gaps = 3/134 (2%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  274
            ++ A L  M+LA+   +PM L A + L+V + I + G  A ++ +EI S +  S      
Sbjct  15   EEEACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGQGAYVAPTEIASQLSTSNSQAPI  74

Query  275  NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDA  445
             L R+LR+L SY V   ++        ER Y L  V K LV ++DG+S    VL +    
Sbjct  75   ILDRVLRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSIAPLVLMNQDKV  134

Query  446  LMKAWPLVHXAVVD  487
            LM++W  +  AV+D
Sbjct  135  LMESWYHLKDAVLD  148



>gb|AAL57301.1|AF387790_1 O-methyltransferase [Sorghum bicolor]
Length=362

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 79/147 (54%), Gaps = 9/147 (6%)
 Frame = +2

Query  71   MGSESES----AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEIL  238
            MGS +E     A + A +  M+LA+   +PM+L   + L + + + +    A L+A E++
Sbjct  1    MGSTAEDVAAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKA-LAAEEVV  59

Query  239  S--SVLPSGGGDAQNLQRILRMLTSYGVFREHI-NADAS-ERRYSLGEVGKTLVTDKDGL  406
            +   V P+    A  + RILR+L SY V +  + + D   ERRYS   VGK L  ++DG+
Sbjct  60   ARLPVAPTNPAAADMVDRILRLLASYDVVKCQMEDKDGKYERRYSAAPVGKWLTPNEDGV  119

Query  407  SYGAYVLQHHQDALMKAWPLVHXAVVD  487
            S  A  L +    LM++W  +  AV+D
Sbjct  120  SMAALALMNQDKVLMESWYYLKDAVLD  146



>ref|XP_009132451.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Brassica rapa]
 emb|CDY43052.1| BnaA03g11990D [Brassica napus]
Length=364

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 75/150 (50%), Gaps = 13/150 (9%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS +E+           A L  M+LA+   +PM L + + L++ + + +  S  P+S S
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMVLKSALDLDLLEIMAKNSS--PMSPS  58

Query  230  EILSSVLPSGGGDAQNLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTDK  397
            EI S +          L RILR+LTSY +     R     D+ ER Y LG V K L  ++
Sbjct  59   EIASKLQTKNPEAPVMLDRILRLLTSYSILTCSNRTIPGGDSVERIYGLGPVCKYLTKNE  118

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG+S  A  L +    LM++W  +  A++D
Sbjct  119  DGVSIAALCLMNQDKVLMESWYHLKDAILD  148



>gb|AFO69477.1| caffeic acid O-methyltransferase [Sorghum bicolor]
Length=362

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 79/147 (54%), Gaps = 9/147 (6%)
 Frame = +2

Query  71   MGSESES----AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEIL  238
            MGS +E     A + A +  M+LA+   +PM+L   + L + + + +    A L+A E++
Sbjct  1    MGSTAEDVAAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKA-LAAEEVV  59

Query  239  S--SVLPSGGGDAQNLQRILRMLTSYGVFREHI-NADAS-ERRYSLGEVGKTLVTDKDGL  406
            +   V P+    A  + R+LR+L SY V R  + + D   ERRYS   VGK L  ++DG+
Sbjct  60   ARLPVAPTNPAAADMVDRMLRLLASYDVVRCQMEDKDGKYERRYSAAPVGKWLTPNEDGV  119

Query  407  SYGAYVLQHHQDALMKAWPLVHXAVVD  487
            S  A  L +    LM++W  +  AV+D
Sbjct  120  SMAALALMNQDKVLMESWYYLKDAVLD  146



>gb|AAO43609.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AEM63601.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AEM63610.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AEM63611.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AEM63612.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AFO69478.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AFO69479.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AHN09802.1| caffeic acid O-methyltransferase [Sorghum sudanense]
Length=362

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 79/147 (54%), Gaps = 9/147 (6%)
 Frame = +2

Query  71   MGSESES----AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEIL  238
            MGS +E     A + A +  M+LA+   +PM+L   + L + + + +    A L+A E++
Sbjct  1    MGSTAEDVAAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKA-LAAEEVV  59

Query  239  S--SVLPSGGGDAQNLQRILRMLTSYGVFREHI-NADAS-ERRYSLGEVGKTLVTDKDGL  406
            +   V P+    A  + R+LR+L SY V R  + + D   ERRYS   VGK L  ++DG+
Sbjct  60   ARLPVAPTNPAAADMVDRMLRLLASYDVVRCQMEDKDGKYERRYSAAPVGKWLTPNEDGV  119

Query  407  SYGAYVLQHHQDALMKAWPLVHXAVVD  487
            S  A  L +    LM++W  +  AV+D
Sbjct  120  SMAALALMNQDKVLMESWYYLKDAVLD  146



>sp|Q8W013.1|COMT1_CATRO RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Catharanthus roseus]
 gb|AAK20170.1| caffeic acid O-methyltransferase [Catharanthus roseus]
Length=363

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 75/135 (56%), Gaps = 5/135 (4%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  274
            ++ A L+ M LA+   +PM L + + L++ + I + G  A +S SE L++ LP+   DA 
Sbjct  16   EEEACLSAMRLASASVLPMVLKSAIELDLLELIKKSGPGAYVSPSE-LAAQLPTQNPDAP  74

Query  275  -NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  442
              L RILR+L SY V     + +     ER YSL  V K L  ++DG+S  A +L +   
Sbjct  75   VMLDRILRLLASYSVLNCTLKDLPDGGIERLYSLAPVCKFLTKNEDGVSMAALLLMNQDK  134

Query  443  ALMKAWPLVHXAVVD  487
             LM++W  +  AV++
Sbjct  135  VLMESWYHLKDAVLE  149



>gb|KFK27028.1| hypothetical protein AALP_AA8G324800 [Arabis alpina]
Length=365

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 79/152 (52%), Gaps = 16/152 (11%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS +E+           A L  M+LA+   +PM+L   + L++ + + +  S  P+S S
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKTALELDLLEIMAKNSS--PMSPS  58

Query  230  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA-----DASERRYSLGEVGKTLVT  391
            EI +S LP+   +A   L RILR+LT+Y V            DA ER Y LG V K L  
Sbjct  59   EI-ASHLPTKNLEAPVMLDRILRLLTAYSVLTCSNRTLPGGGDAVERTYGLGPVCKYLTK  117

Query  392  DKDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            ++DG+S  A  L +    LM++W  +  A++D
Sbjct  118  NEDGVSIAALCLMNQDKVLMESWYHLKDAILD  149



>ref|XP_006436320.1| hypothetical protein CICLE_v10031951mg [Citrus clementina]
 gb|ESR49560.1| hypothetical protein CICLE_v10031951mg [Citrus clementina]
Length=264

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 66/116 (57%), Gaps = 2/116 (2%)
 Frame = +2

Query  143  VPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFR  322
            +PM++ AV  L + + + + G  A L AS+I + +L         L RILR+L SY V  
Sbjct  25   LPMTIQAVYELGIFEILDKVGPGAKLCASDIAAQLLTKNKDAPMMLDRILRLLASYSVVE  84

Query  323  EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD-ALMKAWPLVHXAVVD  487
              ++A  ++R YSL  V K  V +KDG+  G  +LQ +QD  L+++W  +  A+++
Sbjct  85   CSLDASGAQRLYSLNSVSKYYVPNKDGVLLGP-LLQMNQDKVLLESWSQLKDAILE  139



>dbj|BAO79380.1| 5-hydroxyconiferylaldehyde O-methyltransferase [Anthriscus sylvestris]
Length=365

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 72/135 (53%), Gaps = 5/135 (4%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  274
            ++ A +  M+LA+   +PM L + + LN+ +AI + G  A +S SE L++ LPS   D  
Sbjct  18   EEEACMFAMQLASASVLPMVLKSAIELNLLEAIAKAGPGAYVSPSE-LAAGLPSSQPDTP  76

Query  275  -NLQRILRMLTSYGVFREHIN---ADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  442
              L RILR+L SY V +  +        ER Y L  V K L  + DG+S    +L +   
Sbjct  77   VMLDRILRLLASYSVLKCQLRDLPHGRVERLYGLAPVCKFLTKNSDGVSMAPLLLMNQDK  136

Query  443  ALMKAWPLVHXAVVD  487
             LM++W  +  AV+D
Sbjct  137  ILMESWYHLKDAVLD  151



>ref|XP_010934914.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=367

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 76/148 (51%), Gaps = 3/148 (2%)
 Frame = +2

Query  53   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  232
            K+ + A   E+++  + + +  ++LA+   +PM+L A + L V + I + GS   LS ++
Sbjct  6    KQGMPAPSVENQAGDEASCMYALQLASSSILPMTLKAAIELGVLEIIAKAGSVGKLSPAQ  65

Query  233  ILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASE---RRYSLGEVGKTLVTDKDG  403
            + + +       A  L R+LR+L SY +    +  DA     RRY    V K L  ++DG
Sbjct  66   VAAQLPTENPMAATMLDRMLRLLASYNILTCSVEVDADGKPLRRYGPAPVCKWLTKNEDG  125

Query  404  LSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            +S  A  L +    LM++W  +  AV+D
Sbjct  126  VSMAALTLMNQDKVLMESWYYLKDAVLD  153



>gb|ABK23414.1| unknown [Picea sitchensis]
Length=365

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 68/131 (52%), Gaps = 3/131 (2%)
 Frame = +2

Query  110  LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRI  289
            L  MEL N   +PM++ A + L+V   I   G+   LS+ +I++ +  +    A +L RI
Sbjct  22   LLCMELGNFSYLPMAMKAAIELDVFQIIANAGNGVQLSSRQIVAHIPTTNPDAAISLDRI  81

Query  290  LRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  460
            L++L S+ V    +  D    +E  Y L  + K +V ++DG+S   +VL +     M+ W
Sbjct  82   LKVLASHSVLSCSVTTDENGKAEGLYGLTPLCKYIVKNRDGISLAPWVLMNQDKVFMETW  141

Query  461  PLVHXAVVDSS  493
              +  AV++ S
Sbjct  142  HYLKDAVLEGS  152



>gb|ABR18103.1| unknown [Picea sitchensis]
Length=365

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 68/131 (52%), Gaps = 3/131 (2%)
 Frame = +2

Query  110  LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRI  289
            L  MEL N   +PM++ A + L+V   I   G+   LS+ +I++ +  +    A +L RI
Sbjct  22   LLCMELGNFSYLPMAMKAAIELDVFQIIANAGNGVQLSSRQIVAHIPTTNPDAAISLDRI  81

Query  290  LRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  460
            L++L S+ V    +  D    +E  Y L  + K +V ++DG+S   +VL +     M+ W
Sbjct  82   LKVLASHSVLSCSVTTDENGKAEGLYGLTPLCKYIVKNRDGISLAPWVLMNQDKVFMETW  141

Query  461  PLVHXAVVDSS  493
              +  AV++ S
Sbjct  142  HYLKDAVLEGS  152



>gb|KJB52492.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
Length=387

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 79/158 (50%), Gaps = 5/158 (3%)
 Frame = +2

Query  26   SRIEKQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGG  205
            S I   IT     E   + ++ + + A    M+LA+   +PM L + + L++ + + + G
Sbjct  15   SFITPDITMGSIGETQMTPTQVSDEEANSFAMQLASASVLPMVLKSAIELDLLEIMAKAG  74

Query  206  SNAPLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEV  373
              A LS  E+ +S LP+   DA   L RILR+L SY V    +        ER Y LG V
Sbjct  75   PGAFLSPKEV-ASKLPTTNPDAPVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLGPV  133

Query  374  GKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
             K L  ++DG++  A  L +    LM++W  +  AV+D
Sbjct  134  CKFLTKNEDGVTLSALSLMNQDKVLMESWYYLKDAVLD  171



>ref|XP_002515087.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF47071.1| o-methyltransferase, putative [Ricinus communis]
Length=359

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 68/127 (54%), Gaps = 3/127 (2%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ-NLQRILR  295
            M+LA   ++PMSL+A + L V + I + G  + LSASEI + +      DA   L R+LR
Sbjct  24   MQLALGSALPMSLHAAIELGVFEIIAKAGPESKLSASEITAEIPDVQNPDAAITLDRVLR  83

Query  296  MLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHX  475
            +L S+ V    +N    ER YSL  V K  V ++DG+S G ++        + +W  +  
Sbjct  84   LLASHNVLGCSLN--GLERLYSLNPVSKYFVPNQDGISLGPFMALIQDKVFLDSWTKLKD  141

Query  476  AVVDSSS  496
            AV++  S
Sbjct  142  AVLEGGS  148



>gb|AGR85824.1| caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=306

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 77/145 (53%), Gaps = 5/145 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L + + L++ + + + G  A LS  E+ ++
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGASLSPKEV-AA  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L SY +    + +      ER Y LG V K L  ++DG++ 
Sbjct  65   QLPTTNPDAPVMLDRILRLLASYSILTCSLRSLPDGKVERLYGLGPVCKFLTKNEDGVTL  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVVD  487
             A  L +    LM++W  +  AV++
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLE  149



>ref|XP_011084580.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=367

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 73/140 (52%), Gaps = 5/140 (4%)
 Frame = +2

Query  53   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  232
            K +I       +S ++ A L  MELA+  ++PM L + + L++ + I + G  A +S S+
Sbjct  6    KTQIPTASMADQSEEEEAFLYAMELASASALPMVLKSAIELDLLELIKKAGPGASVSPSQ  65

Query  233  ILSSVLPSGGGDAQNL-QRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKD  400
             L++ LP+   DA  +  R+LR+L +Y V R   + +     ER YSL  V K L  ++D
Sbjct  66   -LAAQLPTKNPDAATMIDRMLRLLAAYSVVRCSLKPLPDGGVERLYSLAPVCKFLTRNED  124

Query  401  GLSYGAYVLQHHQDALMKAW  460
            G+S     L       M++W
Sbjct  125  GVSVAPVALMLQDKVFMESW  144



>gb|ADO16247.1| caffeic acid O-methyltransferase [Ocimum tenuiflorum]
Length=361

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 77/148 (52%), Gaps = 10/148 (7%)
 Frame = +2

Query  71   MGSESESAQKNAR-----LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI  235
            MGS + + Q N+      L  M+LA+   +PM L + + L++ + I + G+ A +S  + 
Sbjct  1    MGSATNTPQINSDEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKSGAGAFVSPVD-  59

Query  236  LSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDG  403
            L++ LP+   DA   L RILR+LTSY +    +        ER Y L  V K L  ++DG
Sbjct  60   LAAQLPTTNPDAHVMLDRILRLLTSYAILECRLKTLPNGGVERLYGLAPVCKFLTRNEDG  119

Query  404  LSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            +S     L +    LM++W  +  AV+D
Sbjct  120  VSMAPLTLMNQDKVLMESWYHLKDAVLD  147



>ref|XP_011039447.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Populus euphratica]
Length=358

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 72/124 (58%), Gaps = 4/124 (3%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA-QNLQRILR  295
            M+LA    +PM++ + ++L + + I + G +A LSAS++ ++ LP+   DA   L RILR
Sbjct  24   MQLALSSVLPMTMYSAIQLGIFEIIAEAGPDAKLSASDV-AAQLPTKNPDAPMMLDRILR  82

Query  296  MLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHX  475
            +L S+ V     + D SER YSL  V K  V +KDG+S   ++     +  +++W  +  
Sbjct  83   LLASHDVLV--CSVDGSERLYSLAPVSKHFVRNKDGVSLAPFMALIQDNVFLQSWSQLKD  140

Query  476  AVVD  487
            AV++
Sbjct  141  AVLE  144



>prf||2119166A caffeic acid O-methyltransferase
Length=365

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 70/140 (50%), Gaps = 10/140 (7%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS  E+       + + A L  M+LA+   +PM L + + L+V + I + G    LS +
Sbjct  1    MGSTGETQITPTVVSDEEANLFAMQLASASVLPMVLKSAIELDVLEIIAKAGPGVHLSPA  60

Query  230  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKD  400
            +I ++V  +    A  L R+LR+L  Y +    +        ER Y L  V K LV ++D
Sbjct  61   DIAANVPTTNPDAAVMLDRMLRLLACYNILNHSLRTLPDGKVERLYGLAPVAKFLVKNED  120

Query  401  GLSYGAYVLQHHQDALMKAW  460
            G+S  A  L +H   LM++W
Sbjct  121  GVSLSALNLMNHDKVLMESW  140



>ref|XP_010934913.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 74/148 (50%), Gaps = 3/148 (2%)
 Frame = +2

Query  53   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  232
            K+ + A   E+++  + A L  ++L +   +PM+L A + L+V + I + G    LS ++
Sbjct  6    KQGMPAPSVENQAGDEAACLYALQLVSSSILPMTLKAAIELDVLEIIAKAGPEGKLSPAQ  65

Query  233  ILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASE---RRYSLGEVGKTLVTDKDG  403
            + + +       A  L R+LR+L SY +    +  DA     RRY    V K L  ++DG
Sbjct  66   VAAQLPTENSMAATMLDRMLRLLASYNILTCSVEVDADGKPLRRYGPAPVCKWLTKNEDG  125

Query  404  LSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            +S     L +    LM++W  +  AV+D
Sbjct  126  VSMAPLTLMNQDKVLMESWYYLKDAVLD  153



>ref|XP_008775842.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Phoenix 
dactylifera]
Length=367

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 71/139 (51%), Gaps = 3/139 (2%)
 Frame = +2

Query  80   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  259
            + ++A + A +  ++LA+   +PM+L A + L++ + I + G  A LS +E+ + +    
Sbjct  15   DEQAADEAACMYAVQLASSSILPMTLKAAIELDILEIIVKAGPGAKLSPAEVATQLPTEN  74

Query  260  GGDAQNLQRILRMLTSYGVFREHINADA---SERRYSLGEVGKTLVTDKDGLSYGAYVLQ  430
               A  L R+LR+L SY +    +  DA     RRY    V K L  +K+G S  A  L 
Sbjct  75   PMAATMLDRMLRLLASYNILTCSVEIDADGKPFRRYGAAPVCKWLTKNKEGASMSALTLM  134

Query  431  HHQDALMKAWPLVHXAVVD  487
            +    LM +W  +  AV+D
Sbjct  135  NQDKILMGSWYYLKDAVLD  153



>ref|XP_006436417.1| hypothetical protein CICLE_v10031953mg [Citrus clementina]
 gb|ESR49657.1| hypothetical protein CICLE_v10031953mg [Citrus clementina]
Length=264

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +2

Query  122  ELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRML  301
            +LA  + +PM++ AV  L + + + + G    LSAS+I + +L         L RILR+L
Sbjct  18   QLATGVVLPMAIQAVYELGIFEILDKAGPGTKLSASDIAAQLLTKNKDAPMMLDRILRLL  77

Query  302  TSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAV  481
             SY V    ++A  + R YSL  V K  V +KDG+  G  +       ++++W  +  A+
Sbjct  78   ASYSVVECSLDASGARRLYSLNSVSKYYVPNKDGVLLGPLIQIIQDKVILESWSQLKDAI  137

Query  482  VD  487
            ++
Sbjct  138  LE  139



>ref|XP_010107138.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXC13659.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=269

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 69/140 (49%), Gaps = 8/140 (6%)
 Frame = +2

Query  80   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  259
            E E A  +A    M L    ++P+ L   + L V D I + G  A LS++EI++ +  + 
Sbjct  21   EEEEAFSHA----MCLVTSSAMPVCLKTALELGVFDIIAKAGEGAKLSSAEIVAQMPTNN  76

Query  260  GGDAQNLQRILRMLTSYGVFREHINADAS----ERRYSLGEVGKTLVTDKDGLSYGAYVL  427
               A  L RILR+L S+ V    ++ D       R Y L  V K  VT++DG+S G ++ 
Sbjct  77   PDTATMLDRILRLLASHSVLSCSVDTDDKGSNVRRLYGLCPVSKHFVTNEDGISLGHFIA  136

Query  428  QHHQDALMKAWPLVHXAVVD  487
                +  +  WP +  ++++
Sbjct  137  MVQDNVFVNTWPQLKVSILE  156



>gb|AFK39562.1| unknown [Lotus japonicus]
Length=359

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 60/124 (48%), Gaps = 3/124 (2%)
 Frame = +2

Query  92   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  271
            + + A L  MELA   SVPM L + + L V + I + G  A LS SEI+S +      DA
Sbjct  13   SDEEALLFAMELAGASSVPMVLKSALDLGVIETIAKAGPGAYLSPSEIVSQIPSIKNPDA  72

Query  272  QN-LQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDAL  448
             + L R+LR+L SY +          ER Y L    K  V ++DG+S  +  L  H   L
Sbjct  73   PSMLNRLLRLLASYNILT--FQGSEPERHYGLSPYAKYFVNNQDGVSMISSFLMQHDKVL  130

Query  449  MKAW  460
               W
Sbjct  131  KDMW  134



>ref|XP_006441263.1| hypothetical protein CICLE_v100208142mg, partial [Citrus clementina]
 gb|ESR54503.1| hypothetical protein CICLE_v100208142mg, partial [Citrus clementina]
Length=235

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 76/150 (51%), Gaps = 5/150 (3%)
 Frame = +2

Query  50   GKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            G    E   S ++ + + A L  M+L +   +PM L + + L++ + I + G +A +S  
Sbjct  2    GSTSSETQISPAQGSDEEANLLAMQLTSASVLPMVLKSAIELDLLEIIAKAGPDAFMSPK  61

Query  230  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDK  397
            +I +S LP+   DA   L RILR+L SY V      ++     ER Y L  V K L  ++
Sbjct  62   DI-ASQLPTKNPDAHIVLDRILRLLASYSVLNCSLRNLPDGKVERLYGLAPVCKFLTKNE  120

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG++     L +    LM++W  +  AV++
Sbjct  121  DGVTLSDLCLMNQDKVLMESWYYLKDAVLE  150



>gb|AAN03726.1| caffeic acid O-methyltransferase [Coffea canephora]
Length=350

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 74/136 (54%), Gaps = 5/136 (4%)
 Frame = +2

Query  92   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  271
            A++ A L  M LA+   +PM L + + L++ + I + G  A +S SE L++ LP+   +A
Sbjct  2    AEEEACLFAMSLASASVLPMVLKSAIELDLLELIAKAGPGAYVSPSE-LAAQLPTHNPEA  60

Query  272  Q-NLQRILRMLTSYGVFREHIN--ADAS-ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  439
               L RILR+L +Y V    +N  AD   ER Y L  V K L  + DG+S    +L +  
Sbjct  61   PIMLDRILRLLATYSVLDCKLNNLADGGVERLYGLAPVCKFLTKNADGVSMAPLLLMNQD  120

Query  440  DALMKAWPLVHXAVVD  487
              LM++W  +  AV+D
Sbjct  121  KVLMESWYHLKDAVLD  136



>gb|EAY75657.1| hypothetical protein OsI_03563 [Oryza sativa Indica Group]
 gb|EAZ13379.1| hypothetical protein OsJ_03298 [Oryza sativa Japonica Group]
Length=76

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 13/82 (16%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  298
            MEL NMISV M+L A +RL+V   +W  G+NAP           P+G  +   L+R+LR+
Sbjct  1    MELVNMISVLMALTAAIRLDVPAKLWARGANAP----------FPTGHPNPFVLERLLRL  50

Query  299  LTSYGVFREHINADASERRYSL  364
            LTS  VF EH     S R ++L
Sbjct  51   LTSCSVFCEH---KGSPRHFAL  69



>sp|Q6T1F5.1|COMT1_AMMMJ RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Ammi majus]
 gb|AAR24097.1| caffeic acid O-methyltransferase [Ammi majus]
Length=365

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 73/135 (54%), Gaps = 5/135 (4%)
 Frame = +2

Query  95   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  274
            ++ A +  M+LA+   +PM L + + LN+ ++I + G  A +S S+ L++ LPS   D  
Sbjct  18   EEEACMFAMQLASASVLPMVLKSAIELNLLESIAKAGPGAYVSPSQ-LAAALPSSQPDTP  76

Query  275  -NLQRILRMLTSYGVFREHIN--ADAS-ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  442
              L RILR+L SY V    +    DA  ER Y L  V K L  + DG+S    +L +   
Sbjct  77   VMLDRILRLLASYSVLNCKLRDLPDARVERLYGLAPVCKFLTKNSDGVSMAPLLLMNQDK  136

Query  443  ALMKAWPLVHXAVVD  487
             LM++W  +  AV+D
Sbjct  137  ILMESWYHLKDAVLD  151



>sp|Q8LL87.1|COMT1_COFCA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Coffea canephora]
 gb|AAN03727.1| caffeic acid O-methyltransferase [Coffea canephora]
 emb|CDP04982.1| unnamed protein product [Coffea canephora]
Length=350

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 74/136 (54%), Gaps = 5/136 (4%)
 Frame = +2

Query  92   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  271
            A++ A L  M LA+   +PM L + + L++ + I + G  A +S SE L++ LP+   +A
Sbjct  2    AEEEACLFAMSLASASVLPMVLKSAIELDLLELIAKAGPGAYVSPSE-LAAQLPTHNPEA  60

Query  272  Q-NLQRILRMLTSYGVFREHIN--ADAS-ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  439
               L RILR+L +Y V    +N  AD   ER Y L  V K L  + DG+S    +L +  
Sbjct  61   PIMLDRILRLLATYSVLDCKLNNLADGGVERLYGLAPVCKFLTKNADGVSMAPLLLMNQD  120

Query  440  DALMKAWPLVHXAVVD  487
              LM++W  +  AV+D
Sbjct  121  KVLMESWYHLKDAVLD  136



>ref|XP_002445083.1| hypothetical protein SORBIDRAFT_07g003860 [Sorghum bicolor]
 gb|EES14578.1| hypothetical protein SORBIDRAFT_07g003860 [Sorghum bicolor]
 gb|ADW65743.1| caffeic acid O-methyltransferase [Sorghum bicolor]
Length=362

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 79/147 (54%), Gaps = 9/147 (6%)
 Frame = +2

Query  71   MGSESES----AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEIL  238
            MGS +E     A + A +  M+LA+   +PM+L   + L + + + +    A L+A E++
Sbjct  1    MGSTAEDVAAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKA-LAAEEVV  59

Query  239  S--SVLPSGGGDAQNLQRILRMLTSYGVFREHI-NADAS-ERRYSLGEVGKTLVTDKDGL  406
            +   V P+    A  + R+LR+L SY V +  + + D   ERRYS   VGK L  ++DG+
Sbjct  60   ARLPVAPTNPAAADMVDRMLRLLASYDVVKCQMEDKDGKYERRYSAAPVGKWLTPNEDGV  119

Query  407  SYGAYVLQHHQDALMKAWPLVHXAVVD  487
            S  A  L +    LM++W  +  AV+D
Sbjct  120  SMAALALMNQDKVLMESWYYLKDAVLD  146



>gb|AAF63200.1| caffeic acid O-3-methyltransferase [Populus tomentosa]
Length=360

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 75/145 (52%), Gaps = 5/145 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVVD  487
                L +    LM++W  +  A+++
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILE  149



>ref|XP_010112212.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXC32921.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=374

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 69/149 (46%), Gaps = 5/149 (3%)
 Frame = +2

Query  53   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  232
            +K +++ G   E   K      M+L     + MSL   + L V D I + G  A LS +E
Sbjct  11   RKFLDSEGRNKEEEDKENFSYAMQLVFSTVLSMSLQTAIELGVFDIIAKAGEGAKLSPAE  70

Query  233  ILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADAS-----ERRYSLGEVGKTLVTDK  397
            I + +          L RILR+L S+ + R  +  D +     +R YSLG V K   T++
Sbjct  71   ITAQMTTDNPEAPIMLDRILRVLASHSILRCSVVGDVNSESDFQRLYSLGPVAKYFATNE  130

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVV  484
            DG+S G  +        + +WP +  AV+
Sbjct  131  DGVSLGPLMALIQDKIFLDSWPQLKEAVL  159



>ref|XP_006436317.1| hypothetical protein CICLE_v10031952mg [Citrus clementina]
 gb|ESR49557.1| hypothetical protein CICLE_v10031952mg [Citrus clementina]
Length=264

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 65/116 (56%), Gaps = 2/116 (2%)
 Frame = +2

Query  143  VPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFR  322
            +PM++ AV  L + + + + G  A L AS+I + +L         L RILR+L SY V  
Sbjct  25   LPMAIQAVYELGIFEILDKVGPGAKLCASDIAAQLLTKNKDAPMMLDRILRLLASYSVVE  84

Query  323  EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD-ALMKAWPLVHXAVVD  487
              ++A  + R YSL  V K  V +KDG+  G  +LQ +QD  L+++W  +  A+++
Sbjct  85   CSLDASGARRLYSLNSVSKYYVPNKDGVLLGP-LLQMNQDKVLLESWSQLKDAILE  139



>ref|XP_006478090.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
 gb|KDO46359.1| hypothetical protein CISIN_1g017777mg [Citrus sinensis]
Length=366

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 76/150 (51%), Gaps = 5/150 (3%)
 Frame = +2

Query  50   GKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            G    E   S ++ + + A L  M+L +   +PM L + + L++ + I + G +A +S  
Sbjct  2    GSTSSETQISPAQGSDEEANLLAMQLTSASVLPMVLKSAIELDLLEIIAKAGPDAFMSPK  61

Query  230  EILSSVLPSGGGDAQN-LQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDK  397
            +I +S LP+   DA   L RILR+L SY V      ++     ER Y L  V K L  ++
Sbjct  62   DI-ASQLPTKNPDAHTVLDRILRLLASYSVLNCSLRNLPDGKVERLYGLAPVCKFLTKNE  120

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG++     L +    LM++W  +  AV++
Sbjct  121  DGVTLSDLCLMNQDKVLMESWYYLKDAVLE  150



>gb|AET00984.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=365

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 69/139 (50%), Gaps = 6/139 (4%)
 Frame = +2

Query  62   IEAMGSE--SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI  235
            IE M  E   + + + A    MEL+   + PM L + + L + + I + G NA LS+S I
Sbjct  2    IEKMEREEAKQVSDEEALFFAMELSGASAAPMVLKSALELGIIEIIAKAGPNAHLSSSNI  61

Query  236  LSSVLPSGGGDAQN-LQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDG  403
             S +      DA + L R+LR+L SY +     +H + D+ ER Y L  + K  V ++DG
Sbjct  62   ASQIPSIKNPDAPSMLDRLLRLLASYKILTCSIQHQDGDSIERLYGLHPLAKYFVNNQDG  121

Query  404  LSYGAYVLQHHQDALMKAW  460
            +S  +  L  H   L   W
Sbjct  122  VSMISSFLMQHDKVLKDMW  140



>ref|XP_006436319.1| hypothetical protein CICLE_v10031951mg [Citrus clementina]
 gb|ESR49559.1| hypothetical protein CICLE_v10031951mg [Citrus clementina]
Length=353

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 66/116 (57%), Gaps = 2/116 (2%)
 Frame = +2

Query  143  VPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFR  322
            +PM++ AV  L + + + + G  A L AS+I + +L         L RILR+L SY V  
Sbjct  25   LPMTIQAVYELGIFEILDKVGPGAKLCASDIAAQLLTKNKDAPMMLDRILRLLASYSVVE  84

Query  323  EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD-ALMKAWPLVHXAVVD  487
              ++A  ++R YSL  V K  V +KDG+  G  +LQ +QD  L+++W  +  A+++
Sbjct  85   CSLDASGAQRLYSLNSVSKYYVPNKDGVLLGP-LLQMNQDKVLLESWSQLKDAILE  139



>ref|XP_002302676.2| eugenol O-methyltransferase family protein [Populus trichocarpa]
 gb|EEE81949.2| eugenol O-methyltransferase family protein [Populus trichocarpa]
Length=359

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 81/143 (57%), Gaps = 4/143 (3%)
 Frame = +2

Query  62   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  241
            IE   S+ + A+       M+LA    +PM+L+  ++L + + I + G +  LSA++I +
Sbjct  5    IENHVSQVDEAKDENFGYAMQLALSSVLPMTLHTAIQLGIFEIIAKAGPDVKLSAADI-A  63

Query  242  SVLPSGGGDA-QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  418
            + LP+   D  + L RILR+L S+ V    +  D SER YSL  V    V +++G+S   
Sbjct  64   AKLPTDNPDTPKMLDRILRLLASHQVLCCFV--DGSERFYSLAPVSMYFVRNQNGVSLAP  121

Query  419  YVLQHHQDALMKAWPLVHXAVVD  487
            ++  +H++ ++++W  +  AV++
Sbjct  122  FMALNHENVILQSWSQLKDAVLE  144



>sp|Q43046.1|COMT1_POPKI RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus sieboldii x Populus 
grandidentata]
 dbj|BAA08558.1| caffeic acid O-methyltransferase [Populus kitakamiensis]
Length=365

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 75/145 (52%), Gaps = 5/145 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVVD  487
                L +    LM++W  +  A+++
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILE  149



>ref|XP_006478241.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Citrus 
sinensis]
Length=432

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = +2

Query  149  MSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA-QNLQRILRMLTSYGVFRE  325
            M++ AV++L + + I + G  A LSASEI + +  +   DA   L RILR+L SYG+ + 
Sbjct  104  MTMKAVIKLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRILRLLASYGIVQC  163

Query  326  HI-NADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
             + + D S R Y L +V K  V+++DG+S G  +      A + +W  +   +++
Sbjct  164  SLDDVDGSHRLYGLNDVSKYFVSNQDGVSLGPVLALIQDKAFLDSWSQLKETIIE  218



>gb|ADN27527.1| caffeic acid O-methyltransferase [Camellia sinensis]
Length=363

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 75/140 (54%), Gaps = 12/140 (9%)
 Frame = +2

Query  71   MGSESESA-----QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI  235
            MGS SE+      ++ A L  M+LA+   +PM L + + L++ + + + G  A +S SE+
Sbjct  1    MGSTSETQTIHTDEEEACLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAYVSPSEV  60

Query  236  LSSVLPSGGGDAQ-NLQRILRMLTSYGV----FREHINADASERRYSLGEVGKTLVTDKD  400
             ++ LP+   DA   L RILR+LTSY V     R+  N    ER Y L  V K L  + D
Sbjct  61   -AAQLPTKNPDAAVMLDRILRLLTSYSVLNCTLRDLPNG-GVERLYGLAPVCKFLTRNAD  118

Query  401  GLSYGAYVLQHHQDALMKAW  460
            G+S    +L +    LM++W
Sbjct  119  GVSMAPLLLMNQDKVLMESW  138



>ref|XP_006478243.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like, partial 
[Citrus sinensis]
Length=214

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = +2

Query  149  MSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN-LQRILRMLTSYGVFRE  325
            M++ AV++L + + I + G  A LSASEI + +  +   DA   L RIL +L SYG+   
Sbjct  51   MTMKAVIKLGLLEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVEC  110

Query  326  HI-NADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
             + + D S R Y L +V K  V ++DG+S G  +     +A + +W  +   +++
Sbjct  111  SLDDVDGSHRLYGLNDVSKYFVPNQDGVSLGPVLALIQDEAFLDSWSQLKETIIE  165



>gb|KDP36008.1| hypothetical protein JCGZ_10407 [Jatropha curcas]
Length=365

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 72/136 (53%), Gaps = 5/136 (4%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+  ++PM L + + L++ + I + G  A LS  +I +S
Sbjct  6    ETQMTPAQVSDEEANLFAMQLASASTLPMVLKSAIELDLLEIIAKAGPGAFLSPHDI-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L SY +    +     +  ER Y L  V K L  ++DG+S+
Sbjct  65   QLPTKNPDAPLVLDRILRLLASYSILTCSLRTLPDEKFERLYGLAPVCKFLTKNEDGVSF  124

Query  413  GAYVLQHHQDALMKAW  460
             +  +      LM++W
Sbjct  125  ASICVMIQDKVLMESW  140



>ref|XP_006485684.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=353

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +2

Query  122  ELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRML  301
            +LA  + +PM++ AV  L + + + + G    LSAS+I + +L         L RILR+L
Sbjct  18   QLATGVVLPMAIQAVYELGIFEILDKAGPGTKLSASDIAAQLLTKNKDAPMMLDRILRLL  77

Query  302  TSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAV  481
             SY V    ++A  + R YSL  V K  V +KDG+  G  +       ++++W  +  A+
Sbjct  78   ASYSVVECSLDASGARRLYSLNSVSKYYVPNKDGVLLGPLIQIIQDKVILESWSQLKDAI  137

Query  482  VD  487
            ++
Sbjct  138  LE  139



>ref|XP_010911558.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 74/139 (53%), Gaps = 3/139 (2%)
 Frame = +2

Query  80   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  259
            E ++A + A +  + L++   +PM+L A + L++ + I + G  A LS +E+ + +    
Sbjct  15   EEQTADETACMYALLLSSSSILPMTLKAAIELDLLEIIVKAGPGAKLSPTEMAAQLPTKN  74

Query  260  GGDAQNLQRILRMLTSYGV--FREHINADASE-RRYSLGEVGKTLVTDKDGLSYGAYVLQ  430
               A  L R+LR+L SY +  F   ++AD    RRY    V K L  ++DG+S  A  L 
Sbjct  75   PMAAPMLDRMLRLLASYNILTFSVEVDADGKPLRRYGAAPVCKWLTKNEDGVSMAAVSLM  134

Query  431  HHQDALMKAWPLVHXAVVD  487
            +    LM++W  +  AV+D
Sbjct  135  NQDKILMESWYYLKDAVLD  153



>ref|XP_006436416.1| hypothetical protein CICLE_v10031953mg [Citrus clementina]
 gb|ESR49656.1| hypothetical protein CICLE_v10031953mg [Citrus clementina]
Length=353

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +2

Query  122  ELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRML  301
            +LA  + +PM++ AV  L + + + + G    LSAS+I + +L         L RILR+L
Sbjct  18   QLATGVVLPMAIQAVYELGIFEILDKAGPGTKLSASDIAAQLLTKNKDAPMMLDRILRLL  77

Query  302  TSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHXAV  481
             SY V    ++A  + R YSL  V K  V +KDG+  G  +       ++++W  +  A+
Sbjct  78   ASYSVVECSLDASGARRLYSLNSVSKYYVPNKDGVLLGPLIQIIQDKVILESWSQLKDAI  137

Query  482  VD  487
            ++
Sbjct  138  LE  139



>gb|AAF28353.1|AF220491_1 O-methyltransferase [Fragaria x ananassa]
Length=365

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 78/150 (52%), Gaps = 12/150 (8%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS  E+       + + A L  M+LA+   +PM L A + L++ + + + G  + LS S
Sbjct  1    MGSTGETQMTPTHVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGSFLSPS  60

Query  230  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDK  397
            + L+S LP+   +A   L R+LR+L SY +    +        ER Y LG V K L  ++
Sbjct  61   D-LASQLPTKNPEAPVMLDRMLRLLASYSILTCSLRTLPDGKVERLYCLGPVCKFLTKNE  119

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG+S  A  L +    L+++W  +  AV+D
Sbjct  120  DGVSIAALCLMNQDKVLVESWYHLKDAVLD  149



>ref|NP_001242325.1| uncharacterized protein LOC100805999 [Glycine max]
 gb|ACU21012.1| unknown [Glycine max]
Length=365

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 79/151 (52%), Gaps = 9/151 (6%)
 Frame = +2

Query  47   TGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  226
            TG+ +I    + +  + + A L  M+LA+   +PM L + + L++ + I + G    LS 
Sbjct  4    TGETQI----TPTHVSDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGVHLSP  59

Query  227  SEILSSVLPSGGGDAQ-NLQRILRMLTSYGV--FREHINADAS-ERRYSLGEVGKTLVTD  394
            ++I SS LP+   DA   L RILR+L  Y +  F      D   ER Y L  V K LV +
Sbjct  60   TDI-SSQLPTQNPDAPVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKN  118

Query  395  KDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            +DG+S  A  L +    LM++W  +  AV++
Sbjct  119  EDGVSIAALNLMNQDKVLMESWYYLKDAVLE  149



>ref|XP_008347322.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=140

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 68/136 (50%), Gaps = 5/136 (4%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + +   L  M+LAN   +PM L   + L++ + + + G  A +S ++ L+S
Sbjct  6    ETQMTPTQVSDQETNLFAMQLANAPVLPMVLKTALELDLLEIMAKVGPGAFVSPAD-LAS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L R+LR+L SY +    +        ER Y LG V K L  ++DG+S 
Sbjct  65   QLPTKNPDAPVMLDRMLRLLASYSILTHSLRTLPDGNVERLYGLGPVCKFLTKNEDGVSI  124

Query  413  GAYVLQHHQDALMKAW  460
                L      LM++W
Sbjct  125  APLCLMSQDKVLMESW  140



>gb|ABI54119.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 76/145 (52%), Gaps = 5/145 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G  A +S ++ LSS
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFVSPAD-LSS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L R+LR+L SY +    +        ER Y LG V K L   +DG S 
Sbjct  65   QLPTKNPDAPVMLDRMLRVLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKSEDGASI  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVVD  487
            G+  L +    LM++W  +  AV++
Sbjct  125  GSLCLMNQDKVLMESWYNLKDAVLE  149



>gb|KJB23956.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=251

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 75/145 (52%), Gaps = 5/145 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+L +   +PM L + + L++ + + + G  A LS  E L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LAS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K +  ++DG++ 
Sbjct  65   QLPTSNPDAPVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTL  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVVD  487
             A  L +    LM++W  +  AV++
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLE  149



>gb|KHN23296.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 79/151 (52%), Gaps = 9/151 (6%)
 Frame = +2

Query  47   TGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  226
            TG+ +I    + +  + + A L  M+LA+   +PM L + + L++ + I + G    LS 
Sbjct  4    TGETQI----TPTHVSDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGVHLSP  59

Query  227  SEILSSVLPSGGGDAQ-NLQRILRMLTSYGV--FREHINADAS-ERRYSLGEVGKTLVTD  394
            ++I SS LP+   DA   L RILR+L  Y +  F      D   ER Y L  V K LV +
Sbjct  60   TDI-SSQLPTQNPDAPVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKN  118

Query  395  KDGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            +DG+S  A  L +    LM++W  +  AV++
Sbjct  119  EDGVSIAALNLMNQDKVLMESWYYLKDAVLE  149



>dbj|BAO79382.1| hypothetical plant O-methyltransferase [Anthriscus sylvestris]
Length=365

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 73/138 (53%), Gaps = 5/138 (4%)
 Frame = +2

Query  86   ESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  265
            +  ++ A +  M+LA+   +PM L + + L++ ++I Q G  A +S +E L++ LPS   
Sbjct  15   DDEEEEACMFAMQLASASVLPMVLKSAIELDLLESIAQAGPGAYVSPAE-LAAKLPSSQP  73

Query  266  DAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQH  433
            D    L RILR+L SY V +     +     ER Y+L  V K L  + DG+S    +L +
Sbjct  74   DTPVMLDRILRLLASYSVLKCKLRDLPQGGVERLYALAPVCKFLTKNSDGVSMAPLLLMN  133

Query  434  HQDALMKAWPLVHXAVVD  487
                LM++W  +   V+D
Sbjct  134  QDKILMESWYHLKDTVLD  151



>ref|XP_008219627.1| PREDICTED: LOW QUALITY PROTEIN: caffeic acid 3-O-methyltransferase-like 
[Prunus mume]
Length=371

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 69/129 (53%), Gaps = 7/129 (5%)
 Frame = +2

Query  119  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL-QRILR  295
            + LAN + +PM L + + LN+ D I   G    LS SEI +S LP+   +A  L  R+LR
Sbjct  31   IRLANAVILPMVLKSAIELNIIDIISAAGDGKFLSPSEIAAS-LPTKNPNAPVLLDRMLR  89

Query  296  MLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK-DGL-SYGAYVLQHHQDALMKAW  460
            + TS+ + +  +        ER Y  G + K LV D+ DG+ S G  +L HH    M++W
Sbjct  90   LFTSHSILKCSVRTGQDGKVERLYGAGALCKFLVKDQHDGVGSVGPLLLLHHDKVFMESW  149

Query  461  PLVHXAVVD  487
               + AV++
Sbjct  150  CHFNDAVLE  158



>ref|XP_008376825.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 76/150 (51%), Gaps = 12/150 (8%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS  E+         K   L  M+LAN   +PM L   + L++ + + + G  A +S++
Sbjct  1    MGSTGETQMPPTQVTDKETNLFAMQLANAPVLPMVLKTALELDLLEIMVKAGPGAFVSSA  60

Query  230  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA--DAS-ERRYSLGEVGKTLVTDK  397
            + LSS LP+   DA   L R+LR+L SY +    +    D + ER Y LG V K L  ++
Sbjct  61   D-LSSQLPTKNPDAPVMLDRMLRLLASYSILTYSLRTLPDGNVERLYGLGPVCKFLTKNE  119

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG+S     L      LM++W  +  AV++
Sbjct  120  DGVSIAPLCLMSQDKVLMESWYHLKDAVLE  149



>gb|AGJ84131.1| putative caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=365

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 76/145 (52%), Gaps = 5/145 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+LA+   +PM L + + L++ + + + G  A LS  E+ +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPMEV-AS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K L  ++DG++ 
Sbjct  65   QLPTANPDAPVMLDRILRLLATYSILTCSLRTLPDGRVERLYGLGPVCKFLTKNQDGVAL  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVVD  487
             A  L +    LM++W  +  AV++
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLE  149



>gb|AHM25237.1| noraucuparin O-methyltransferase [Sorbus aucuparia]
Length=365

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 77/146 (53%), Gaps = 5/146 (3%)
 Frame = +2

Query  62   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  241
            +E   +  + + + A L  M+LA+   +PM L A + L++ + + + G  A +S ++ L+
Sbjct  5    VETQMTPIQVSDEEANLFAMQLASGSILPMVLKAAIELDLLEVMAKAGPGAFVSPAD-LA  63

Query  242  SVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLS  409
            S LP+   DA   L R+LR+L SY +    +        ER Y LG V K L  ++DG S
Sbjct  64   SQLPTKNPDAPVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGAS  123

Query  410  YGAYVLQHHQDALMKAWPLVHXAVVD  487
             G+  L +    LM++W  +  AV++
Sbjct  124  IGSLCLMNQDKVLMESWYHLKDAVLE  149



>ref|XP_007019090.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
 gb|EOY16315.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
Length=358

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 67/132 (51%), Gaps = 6/132 (5%)
 Frame = +2

Query  77   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  256
            ++ +  Q+  +L +  LAN + +PM L + + LN+ D I   G    LS S+I S  LP+
Sbjct  2    TQEDQDQELGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGTFLSPSQIASG-LPT  59

Query  257  GGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYV  424
               +A  L  R+LR+L SY + +  +    S   ER Y  G + K LV ++D  S     
Sbjct  60   KNPEASVLLDRMLRLLASYSILKCSVRTKESGEVERLYGAGPLCKFLVKNQDEGSVAPLF  119

Query  425  LQHHQDALMKAW  460
            L HH    M++W
Sbjct  120  LLHHDKVFMESW  131



>gb|AFK45226.1| unknown [Lotus japonicus]
Length=359

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 59/124 (48%), Gaps = 3/124 (2%)
 Frame = +2

Query  92   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  271
            + + A L  MELA   SVPM L + + L V + I + G  A LS SEI S +      DA
Sbjct  13   SDEEALLFAMELAGASSVPMVLKSALDLGVIETIAKAGPGAYLSPSEIASQIPSIKNPDA  72

Query  272  QN-LQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDAL  448
             + L R+LR+L SY +          ER Y L    K  V ++DG+S  +  L  H   L
Sbjct  73   PSMLNRLLRLLASYNILT--FQGSEPERHYGLSPYAKYFVNNQDGVSMISSFLMQHDKVL  130

Query  449  MKAW  460
               W
Sbjct  131  KDMW  134



>gb|KHG13289.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=365

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 75/145 (52%), Gaps = 5/145 (3%)
 Frame = +2

Query  65   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  244
            E   + ++ + + A L  M+L +   +PM L + + L++ + + + G  A LS  E L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LAS  64

Query  245  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  412
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K L  ++DG++ 
Sbjct  65   QLPTNNPDAPVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFLTKNEDGVTL  124

Query  413  GAYVLQHHQDALMKAWPLVHXAVVD  487
             A  L +    LM++W  +  AV++
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLE  149



>ref|XP_008376828.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 76/150 (51%), Gaps = 12/150 (8%)
 Frame = +2

Query  71   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  229
            MGS  E+         K   L  M+LAN   +PM L   + L++ + + + G  A +S++
Sbjct  1    MGSTGETQMPPTQVTDKETNLFAMQLANAPVLPMVLKTALELDLLEIMVKAGPGAFVSSA  60

Query  230  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA--DAS-ERRYSLGEVGKTLVTDK  397
            + LSS LP+   DA   L R+LR+L SY +    +    D + ER Y LG V K L  ++
Sbjct  61   D-LSSQLPTKNPDAPVMLDRMLRLLASYSILTYSLRTLPDGNVERLYGLGPVCKFLTKNE  119

Query  398  DGLSYGAYVLQHHQDALMKAWPLVHXAVVD  487
            DG+S     L      LM++W  +  AV++
Sbjct  120  DGVSIAPLCLMSQDKVLMESWYHLKDAVLE  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567283606695