BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF012J12

Length=479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    135   3e-33   Nicotiana tomentosiformis
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    133   2e-32   Solanum lycopersicum
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    133   2e-32   Sesamum indicum [beniseed]
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    133   2e-32   Dimocarpus longan [longan]
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    131   7e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    130   2e-31   Nelumbo nucifera [Indian lotus]
emb|CDP02660.1|  unnamed protein product                                130   2e-31   Coffea canephora [robusta coffee]
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...    129   3e-31   Sesamum indicum [beniseed]
ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    129   3e-31   Solanum tuberosum [potatoes]
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...    126   4e-30   Nicotiana sylvestris
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg                125   1e-29   Erythranthe guttata [common monkey flower]
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...    124   3e-29   Solanum peruvianum [Peruvian tomato]
ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...    124   3e-29   Solanum lycopersicum
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...    123   4e-29   Solanum pennellii
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...    123   6e-29   Solanum tuberosum [potatoes]
emb|CBI35733.3|  unnamed protein product                                122   1e-28   Vitis vinifera
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...    122   2e-28   Vitis vinifera
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...    121   3e-28   Morus notabilis
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    118   2e-27   Nicotiana sylvestris
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265             118   4e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...    116   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg             114   6e-26   Capsella rubella
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...    114   7e-26   
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    114   7e-26   Nicotiana tomentosiformis
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor           113   1e-25   
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...    113   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    113   1e-25   
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein         113   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg             113   1e-25   
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...    111   6e-25   Citrus sinensis [apfelsine]
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                   111   6e-25   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg             111   6e-25   Citrus clementina [clementine]
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor           110   1e-24   Glycine max [soybeans]
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg             110   1e-24   Prunus persica
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...    110   2e-24   
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg             109   4e-24   
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...    108   4e-24   
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807             108   1e-23   
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    108   1e-23   Fragaria vesca subsp. vesca
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...    107   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...    107   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...    107   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...    107   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...    107   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             107   2e-23   Populus trichocarpa [western balsam poplar]
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                    105   6e-23   Arabis alpina [alpine rockcress]
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    105   7e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS74129.1|  hypothetical protein M569_00625                         105   7e-23   Genlisea aurea
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...    105   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    104   1e-22   Populus euphratica
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...    104   2e-22   Eucalyptus grandis [rose gum]
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...    104   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             103   3e-22   Capsella rubella
gb|KJB48795.1|  hypothetical protein B456_008G087500                    103   4e-22   Gossypium raimondii
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    103   4e-22   Tarenaya hassleriana [spider flower]
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                    103   5e-22   Arabis alpina [alpine rockcress]
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...    103   5e-22   Brassica rapa
gb|KDP32143.1|  hypothetical protein JCGZ_12604                         103   6e-22   Jatropha curcas
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    102   8e-22   
ref|XP_010675918.1|  PREDICTED: leucine-rich repeat receptor-like...    102   1e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    101   2e-21   Gossypium arboreum [tree cotton]
gb|KJB18113.1|  hypothetical protein B456_003G034400                    100   6e-21   Gossypium raimondii
gb|KJB18115.1|  hypothetical protein B456_003G034500                    100   6e-21   Gossypium raimondii
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...  99.8    7e-21   Cicer arietinum [garbanzo]
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor         99.8    8e-21   Glycine max [soybeans]
ref|NP_001237688.1|  receptor-like protein kinase precursor           98.6    2e-20   Glycine max [soybeans]
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...  98.2    2e-20   Cucumis sativus [cucumbers]
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...  98.2    3e-20   Gossypium arboreum [tree cotton]
ref|XP_010685023.1|  PREDICTED: receptor-like protein 12              95.9    1e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g           96.3    1e-19   Phaseolus vulgaris [French bean]
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...  94.4    6e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...  93.6    1e-18   Ricinus communis
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...  91.7    5e-18   
ref|XP_006852730.1|  hypothetical protein AMTR_s00033p00083200        91.3    6e-18   
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  89.7    2e-17   
ref|XP_010518800.1|  PREDICTED: leucine-rich repeat receptor-like...  89.7    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...  89.0    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES94465.2|  LRR receptor-like kinase family protein               89.0    4e-17   Medicago truncatula
ref|XP_003611507.1|  Receptor-like protein kinase                     89.0    5e-17   
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...  88.6    6e-17   Elaeis guineensis
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...  88.2    8e-17   Elaeis guineensis
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...  87.4    1e-16   Brassica rapa
ref|XP_010676066.1|  PREDICTED: LRR receptor-like serine/threonin...  87.0    2e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...  86.7    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395647.1|  PREDICTED: leucine-rich repeat receptor-like...  85.9    5e-16   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP18494.1|  unnamed protein product                              83.2    3e-15   Coffea canephora [robusta coffee]
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g           83.2    4e-15   Phaseolus vulgaris [French bean]
ref|XP_004955796.1|  PREDICTED: probable LRR receptor-like serine...  82.8    5e-15   Setaria italica
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...  81.6    1e-14   Cucumis melo [Oriental melon]
ref|XP_008790445.1|  PREDICTED: leucine-rich repeat receptor-like...  80.5    3e-14   Phoenix dactylifera
ref|XP_010686227.1|  PREDICTED: probable LRR receptor-like serine...  79.3    5e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003608587.1|  Receptor-like protein kinase                     79.7    5e-14   Medicago truncatula
ref|XP_010936307.1|  PREDICTED: leucine-rich repeat receptor-like...  79.3    7e-14   
gb|EYU26654.1|  hypothetical protein MIMGU_mgv1a001213mg              79.0    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_008370076.1|  PREDICTED: probable LRR receptor-like serine...  79.0    1e-13   
ref|XP_011019593.1|  PREDICTED: probably inactive leucine-rich re...  78.6    1e-13   Populus euphratica
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  77.8    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418700.1|  PREDICTED: leucine-rich repeat receptor-like...  78.2    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY63395.1|  BnaCnng41990D                                        76.6    3e-13   Brassica napus [oilseed rape]
ref|NP_001042048.1|  Os01g0152800                                     77.4    3e-13   
ref|XP_008812886.1|  PREDICTED: probable LRR receptor-like serine...  77.4    3e-13   Phoenix dactylifera
gb|EAY72573.1|  hypothetical protein OsI_00439                        77.4    3e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_010690942.1|  PREDICTED: probable LRR receptor-like serine...  77.0    4e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002308597.2|  hypothetical protein POPTR_0006s25380g           76.6    6e-13   
gb|AAX93041.1|  hypothetical protein LOC_Os11g07260                   76.6    6e-13   Oryza sativa Japonica Group [Japonica rice]
emb|CDP10862.1|  unnamed protein product                              75.9    7e-13   Coffea canephora [robusta coffee]
ref|NP_001065874.2|  Os11g0173800                                     76.3    7e-13   
ref|XP_009396215.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  75.5    9e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009800500.1|  PREDICTED: putative receptor-like protein ki...  75.9    9e-13   Nicotiana sylvestris
ref|XP_008357152.1|  PREDICTED: receptor protein kinase CLAVATA1-...  75.9    1e-12   
gb|AAT64017.1|  putative leucine-rich repeat transmembrane protein    75.5    1e-12   Gossypium hirsutum [American cotton]
ref|XP_007025341.1|  Leucine-rich repeat protein kinase family pr...  75.5    1e-12   
ref|XP_008364929.1|  PREDICTED: receptor protein kinase CLAVATA1-...  75.9    1e-12   
ref|XP_007025340.1|  Leucine-rich repeat protein kinase family pr...  75.1    1e-12   
ref|XP_009409349.1|  PREDICTED: probable LRR receptor-like serine...  75.9    1e-12   
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...  75.5    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010026766.1|  PREDICTED: putative receptor-like protein ki...  75.5    2e-12   
ref|XP_010065839.1|  PREDICTED: putative receptor-like protein ki...  75.5    2e-12   Eucalyptus grandis [rose gum]
ref|XP_009337767.1|  PREDICTED: probable LRR receptor-like serine...  75.5    2e-12   Pyrus x bretschneideri [bai li]
gb|KCW74133.1|  hypothetical protein EUGRSUZ_E02764                   74.7    2e-12   Eucalyptus grandis [rose gum]
gb|EEC67765.1|  hypothetical protein OsI_35299                        75.1    2e-12   Oryza sativa Indica Group [Indian rice]
gb|KCW60108.1|  hypothetical protein EUGRSUZ_H02842                   75.1    2e-12   Eucalyptus grandis [rose gum]
ref|XP_011083584.1|  PREDICTED: receptor protein kinase CLAVATA1      75.1    2e-12   Sesamum indicum [beniseed]
ref|XP_009618942.1|  PREDICTED: putative receptor-like protein ki...  75.1    2e-12   
ref|XP_010533421.1|  PREDICTED: putative receptor-like protein ki...  75.1    2e-12   Tarenaya hassleriana [spider flower]
ref|XP_009107554.1|  PREDICTED: probable LRR receptor-like serine...  74.7    2e-12   
ref|XP_009618941.1|  PREDICTED: putative receptor-like protein ki...  75.1    2e-12   Nicotiana tomentosiformis
ref|XP_008791706.1|  PREDICTED: putative receptor-like protein ki...  75.1    2e-12   
ref|XP_010269666.1|  PREDICTED: probable LRR receptor-like serine...  74.7    2e-12   
ref|XP_007151443.1|  hypothetical protein PHAVU_004G046800g           74.3    2e-12   Phaseolus vulgaris [French bean]
ref|XP_008797566.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  74.3    2e-12   Phoenix dactylifera
gb|AHJ14779.1|  CLAVATA1                                              74.7    2e-12   Rhododendron ovatum
emb|CDY26403.1|  BnaA02g23670D                                        74.7    2e-12   Brassica napus [oilseed rape]
ref|XP_007026751.1|  LRR receptor-like serine/threonine-protein k...  74.7    3e-12   
gb|ACD56664.1|  putative leucine-rich repeat transmembrane protein    74.3    3e-12   Gossypium arboreum [tree cotton]
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1      74.7    3e-12   
ref|XP_007017845.1|  Leucine-rich receptor-like protein kinase fa...  74.7    3e-12   
ref|XP_010654174.1|  PREDICTED: putative receptor-like protein ki...  74.7    3e-12   Vitis vinifera
emb|CDY02555.1|  BnaA08g01620D                                        70.9    3e-12   
emb|CAN83822.1|  hypothetical protein VITISV_030954                   74.7    3e-12   Vitis vinifera
ref|XP_010910648.1|  PREDICTED: putative receptor-like protein ki...  73.2    3e-12   Elaeis guineensis
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  73.9    3e-12   Phoenix dactylifera
ref|XP_006645505.1|  PREDICTED: putative receptor-like protein ki...  74.3    3e-12   Oryza brachyantha
ref|XP_010257839.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  73.9    4e-12   Nelumbo nucifera [Indian lotus]
gb|EAY80122.1|  hypothetical protein OsI_35294                        74.3    4e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  73.9    4e-12   Elaeis guineensis
ref|XP_006358680.1|  PREDICTED: probable LRR receptor-like serine...  74.3    4e-12   
ref|XP_010925613.1|  PREDICTED: probable LRR receptor-like serine...  73.6    4e-12   
gb|EEE51731.1|  hypothetical protein OsJ_33139                        74.3    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009400102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  73.6    4e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009400110.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  73.6    4e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADB85326.1|  putative receptor protein kinase                      71.2    4e-12   Phyllostachys edulis [kikko-chiku]
ref|XP_010925612.1|  PREDICTED: probable LRR receptor-like serine...  73.6    4e-12   Elaeis guineensis
gb|AAX93038.1|  hypothetical protein LOC_Os11g07230                   74.3    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010068376.1|  PREDICTED: putative receptor-like protein ki...  73.9    5e-12   
ref|XP_007016127.1|  Leucine-rich repeat protein kinase family pr...  73.6    6e-12   
ref|XP_009377741.1|  PREDICTED: probable LRR receptor-like serine...  73.6    6e-12   
gb|EMT21473.1|  Putative LRR receptor-like serine/threonine-prote...  73.6    6e-12   
ref|XP_008371495.1|  PREDICTED: probable LRR receptor-like serine...  73.2    6e-12   Malus domestica [apple tree]
ref|XP_008371496.1|  PREDICTED: probable LRR receptor-like serine...  73.2    6e-12   Malus domestica [apple tree]
ref|XP_010929457.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  73.2    6e-12   Elaeis guineensis
ref|XP_011470626.1|  PREDICTED: LRR receptor-like serine/threonin...  72.0    6e-12   Fragaria vesca subsp. vesca
ref|XP_007012155.1|  Probably inactive leucine-rich repeat recept...  73.6    6e-12   
dbj|BAH20868.1|  putative LRR-kinase protein                          73.6    6e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979517.1|  PREDICTED: putative receptor-like protein ki...  73.6    7e-12   Setaria italica
ref|XP_006382044.1|  hypothetical protein POPTR_0006s25380g           73.6    7e-12   
emb|CDP19927.1|  unnamed protein product                              73.2    7e-12   Coffea canephora [robusta coffee]
ref|XP_009131797.1|  PREDICTED: LRR receptor-like serine/threonin...  73.6    7e-12   Brassica rapa
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  73.2    7e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009351465.1|  PREDICTED: probable LRR receptor-like serine...  72.8    7e-12   Pyrus x bretschneideri [bai li]
ref|XP_009390158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  73.2    7e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  73.2    7e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...  73.2    7e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010412611.1|  PREDICTED: putative receptor-like protein ki...  73.2    7e-12   
ref|XP_009390157.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  73.2    7e-12   
ref|XP_006382632.1|  hypothetical protein POPTR_0005s03970g           73.2    8e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010054700.1|  PREDICTED: putative receptor-like protein ki...  73.2    8e-12   Eucalyptus grandis [rose gum]
ref|XP_007020361.1|  Serine-threonine protein kinase, putative        72.8    8e-12   
ref|XP_011036960.1|  PREDICTED: probable LRR receptor-like serine...  73.2    8e-12   Populus euphratica
ref|XP_008223897.1|  PREDICTED: probable LRR receptor-like serine...  73.2    8e-12   Prunus mume [ume]
gb|EEC68381.1|  hypothetical protein OsI_36527                        72.8    8e-12   Oryza sativa Indica Group [Indian rice]
gb|KJB69703.1|  hypothetical protein B456_011G038400                  72.8    8e-12   Gossypium raimondii
gb|KJB69702.1|  hypothetical protein B456_011G038400                  72.8    9e-12   Gossypium raimondii
gb|EEC69970.1|  hypothetical protein OsI_00442                        73.2    9e-12   Oryza sativa Indica Group [Indian rice]
gb|AAT64032.1|  putative leucine-rich repeat transmembrane protein    72.8    9e-12   Gossypium hirsutum [American cotton]
ref|XP_007213585.1|  hypothetical protein PRUPE_ppa003046mg           72.8    9e-12   
ref|XP_007214129.1|  hypothetical protein PRUPE_ppa018020mg           73.2    9e-12   
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...  73.2    9e-12   
ref|XP_011019134.1|  PREDICTED: probable LRR receptor-like serine...  73.2    9e-12   Populus euphratica
ref|XP_003612525.1|  Kinase-like protein                              73.2    9e-12   Medicago truncatula
ref|XP_009123620.1|  PREDICTED: putative receptor-like protein ki...  73.2    9e-12   Brassica rapa
ref|XP_004305136.1|  PREDICTED: probable LRR receptor-like serine...  73.2    1e-11   Fragaria vesca subsp. vesca
ref|XP_008387933.1|  PREDICTED: receptor protein kinase CLAVATA1      72.8    1e-11   Malus domestica [apple tree]
emb|CDP20234.1|  unnamed protein product                              72.8    1e-11   Coffea canephora [robusta coffee]
gb|KJB73885.1|  hypothetical protein B456_011G258600                  72.8    1e-11   Gossypium raimondii
ref|XP_009334873.1|  PREDICTED: receptor protein kinase CLAVATA1      72.8    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_010269665.1|  PREDICTED: probable LRR receptor-like serine...  72.8    1e-11   Nelumbo nucifera [Indian lotus]
ref|NP_190295.1|  putative receptor-like protein kinase               72.8    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                   72.8    1e-11   Eucalyptus grandis [rose gum]
emb|CDX91804.1|  BnaC03g31060D                                        72.8    1e-11   
ref|XP_008225339.1|  PREDICTED: probable LRR receptor-like serine...  72.4    1e-11   Prunus mume [ume]
ref|XP_006365791.1|  PREDICTED: putative receptor-like protein ki...  72.8    1e-11   
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                  72.8    1e-11   Arabis alpina [alpine rockcress]
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1      72.8    1e-11   Eucalyptus grandis [rose gum]
ref|NP_001176614.1|  Os11g0568800                                     72.8    1e-11   
ref|XP_010691757.1|  PREDICTED: uncharacterized protein LOC104905013  72.8    1e-11   
gb|KEH19631.1|  LRR receptor-like kinase                              72.8    1e-11   Medicago truncatula
ref|XP_006663536.1|  PREDICTED: probable LRR receptor-like serine...  72.8    1e-11   Oryza brachyantha
ref|XP_008370155.1|  PREDICTED: probable LRR receptor-like serine...  72.4    1e-11   
emb|CDP18498.1|  unnamed protein product                              72.4    1e-11   Coffea canephora [robusta coffee]
gb|KJB73883.1|  hypothetical protein B456_011G2584002                 69.3    2e-11   Gossypium raimondii
gb|EAZ18778.1|  hypothetical protein OsJ_34305                        72.4    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010690943.1|  PREDICTED: probable LRR receptor-like serine...  72.4    2e-11   
ref|XP_002459591.1|  hypothetical protein SORBIDRAFT_02g007200        72.0    2e-11   
gb|ACD56650.1|  putative leucine-rich repeat transmembrane protein    72.0    2e-11   Gossypioides kirkii
ref|XP_008792970.1|  PREDICTED: probable LRR receptor-like serine...  71.6    2e-11   
ref|XP_010520745.1|  PREDICTED: putative receptor-like protein ki...  72.4    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_008439728.1|  PREDICTED: probable LRR receptor-like serine...  72.0    2e-11   Cucumis melo [Oriental melon]
ref|XP_010690947.1|  PREDICTED: probable LRR receptor-like serine...  72.4    2e-11   
ref|XP_006841062.1|  hypothetical protein AMTR_s00085p00173590        72.0    2e-11   Amborella trichopoda
ref|XP_009781121.1|  PREDICTED: probable LRR receptor-like serine...  71.6    2e-11   Nicotiana sylvestris
gb|EEC68382.1|  hypothetical protein OsI_36528                        72.0    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_011039407.1|  PREDICTED: probable LRR receptor-like serine...  71.6    2e-11   Populus euphratica
ref|XP_009403877.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  71.6    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403878.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  71.6    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792202.1|  PREDICTED: probable LRR receptor-like serine...  71.6    2e-11   Phoenix dactylifera
emb|CAN71566.1|  hypothetical protein VITISV_016304                   70.5    2e-11   Vitis vinifera
ref|XP_009781120.1|  PREDICTED: probable LRR receptor-like serine...  71.6    2e-11   Nicotiana sylvestris
ref|XP_010675938.1|  PREDICTED: LRR receptor-like serine/threonin...  72.0    2e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004295585.1|  PREDICTED: probable LRR receptor-like serine...  71.6    2e-11   Fragaria vesca subsp. vesca
ref|XP_009376453.1|  PREDICTED: probable LRR receptor-like serine...  72.0    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_002269902.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      71.6    2e-11   Vitis vinifera
ref|XP_006437547.1|  hypothetical protein CICLE_v10033496mg           71.6    2e-11   
ref|XP_007213538.1|  hypothetical protein PRUPE_ppa019671mg           68.9    2e-11   
ref|XP_011039404.1|  PREDICTED: probable LRR receptor-like serine...  71.2    2e-11   Populus euphratica
ref|XP_009341868.1|  PREDICTED: probable LRR receptor-like serine...  72.0    2e-11   Pyrus x bretschneideri [bai li]
gb|KCW54708.1|  hypothetical protein EUGRSUZ_I00657                   70.1    2e-11   Eucalyptus grandis [rose gum]
ref|XP_002305057.2|  hypothetical protein POPTR_0004s05880g           71.6    3e-11   
gb|KHN30771.1|  Protein NSP-INTERACTING KINASE 1                      71.2    3e-11   Glycine soja [wild soybean]
ref|XP_004972877.1|  PREDICTED: probable LRR receptor-like serine...  70.9    3e-11   
emb|CDY36706.1|  BnaC02g31270D                                        71.6    3e-11   Brassica napus [oilseed rape]
ref|XP_004134925.1|  PREDICTED: probable LRR receptor-like serine...  71.2    3e-11   Cucumis sativus [cucumbers]
ref|XP_008224399.1|  PREDICTED: probable LRR receptor-like serine...  71.6    3e-11   
ref|XP_006402101.1|  hypothetical protein EUTSA_v10012566mg           71.6    3e-11   
ref|XP_008223875.1|  PREDICTED: probable LRR receptor-like serine...  71.6    3e-11   
emb|CDP16554.1|  unnamed protein product                              71.2    3e-11   Coffea canephora [robusta coffee]
ref|XP_006484594.1|  PREDICTED: probable LRR receptor-like serine...  71.6    3e-11   
ref|XP_009407625.1|  PREDICTED: probable LRR receptor-like serine...  71.6    3e-11   
ref|XP_008353615.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    3e-11   
ref|XP_009393965.1|  PREDICTED: leucine-rich repeat receptor-like...  71.2    3e-11   
ref|XP_008349363.1|  PREDICTED: putative receptor-like protein ki...  71.6    3e-11   
ref|XP_008385914.1|  PREDICTED: probable LRR receptor-like serine...  71.6    3e-11   Malus domestica [apple tree]
gb|KJB40660.1|  hypothetical protein B456_007G073100                  71.6    3e-11   Gossypium raimondii
ref|XP_007219655.1|  hypothetical protein PRUPE_ppa025151mg           71.6    3e-11   
ref|XP_011006423.1|  PREDICTED: probably inactive leucine-rich re...  71.6    3e-11   Populus euphratica
ref|XP_002883863.1|  predicted protein                                71.6    3e-11   
ref|XP_006437528.1|  hypothetical protein CICLE_v10033594mg           71.6    3e-11   
gb|EMT26983.1|  Putative LRR receptor-like serine/threonine-prote...  71.6    3e-11   
ref|XP_002307734.1|  receptor protein kinase                          71.2    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_008225333.1|  PREDICTED: probable LRR receptor-like serine...  71.6    3e-11   
emb|CBI30706.3|  unnamed protein product                              70.9    3e-11   Vitis vinifera
ref|XP_003555046.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  70.9    3e-11   Glycine max [soybeans]
emb|CDX77186.1|  BnaC04g39810D                                        71.2    3e-11   
ref|XP_010935096.1|  PREDICTED: leucine-rich repeat receptor-like...  71.2    3e-11   Elaeis guineensis
ref|XP_009588501.1|  PREDICTED: probable LRR receptor-like serine...  71.2    3e-11   
emb|CDY37749.1|  BnaA04g19190D                                        71.2    3e-11   Brassica napus [oilseed rape]
emb|CAH56437.1|  somatic embryogenesis receptor-like kinase 1         70.9    3e-11   Poa pratensis
ref|XP_009101570.1|  PREDICTED: probable LRR receptor-like serine...  70.9    3e-11   
dbj|BAK02009.1|  predicted protein                                    71.2    3e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK01616.1|  predicted protein                                    71.2    3e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002317403.1|  leucine-rich repeat transmembrane protein ki...  70.9    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009343564.1|  PREDICTED: LRR receptor-like serine/threonin...  70.9    4e-11   
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...  71.2    4e-11   Phoenix dactylifera
ref|XP_010026767.1|  PREDICTED: probable LRR receptor-like serine...  71.2    4e-11   
ref|XP_010907375.1|  PREDICTED: probable LRR receptor-like serine...  71.2    4e-11   Elaeis guineensis
ref|XP_008359003.1|  PREDICTED: putative receptor-like protein ki...  71.2    4e-11   
ref|XP_003612513.1|  Kinase-like protein                              71.2    4e-11   
ref|XP_008339051.1|  PREDICTED: putative receptor-like protein ki...  71.2    4e-11   
ref|XP_010058160.1|  PREDICTED: putative receptor-like protein ki...  71.2    4e-11   
ref|XP_010911433.1|  PREDICTED: putative receptor-like protein ki...  70.1    4e-11   
emb|CBI25249.3|  unnamed protein product                              71.6    4e-11   
ref|XP_009343092.1|  PREDICTED: LRR receptor-like serine/threonin...  70.1    4e-11   
emb|CDP18443.1|  unnamed protein product                              71.2    4e-11   
emb|CDP04113.1|  unnamed protein product                              71.2    4e-11   
ref|XP_003633015.1|  PREDICTED: probable LRR receptor-like serine...  70.9    4e-11   
ref|XP_002459536.1|  hypothetical protein SORBIDRAFT_02g006250        71.2    4e-11   
gb|KCW71731.1|  hypothetical protein EUGRSUZ_E00238                   71.2    4e-11   
ref|XP_004232118.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      70.9    4e-11   
ref|XP_002322110.2|  hypothetical protein POPTR_0015s04680g           71.2    4e-11   
ref|XP_006338306.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  70.9    4e-11   
ref|XP_006350351.1|  PREDICTED: probable LRR receptor-like serine...  71.2    4e-11   
ref|XP_009619542.1|  PREDICTED: probable LRR receptor-like serine...  70.5    4e-11   
ref|XP_004295533.1|  PREDICTED: leucine-rich repeat receptor-like...  70.9    4e-11   
ref|XP_009619541.1|  PREDICTED: probable LRR receptor-like serine...  70.5    4e-11   
ref|XP_006603947.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  70.5    4e-11   
emb|CDM80388.1|  unnamed protein product                              70.9    4e-11   
ref|XP_011034116.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  70.5    4e-11   
ref|XP_011034114.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  70.5    4e-11   
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...  70.9    5e-11   
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...  70.9    5e-11   
ref|XP_009614227.1|  PREDICTED: probable LRR receptor-like serine...  70.9    5e-11   
ref|XP_010999778.1|  PREDICTED: probable LRR receptor-like serine...  70.9    5e-11   
ref|XP_008232315.1|  PREDICTED: putative receptor-like protein ki...  70.9    5e-11   
emb|CAN72497.1|  hypothetical protein VITISV_010512                   67.8    5e-11   
ref|XP_009340992.1|  PREDICTED: probable LRR receptor-like serine...  70.9    5e-11   
ref|XP_008237309.1|  PREDICTED: leucine-rich repeat receptor-like...  70.9    5e-11   
gb|ABG22537.1|  receptor kinase, putative, expressed                  68.6    5e-11   
emb|CDX84254.1|  BnaC04g10160D                                        70.5    5e-11   
gb|KCW63525.1|  hypothetical protein EUGRSUZ_G01159                   70.1    5e-11   
ref|XP_007214567.1|  hypothetical protein PRUPE_ppa000837mg           70.9    5e-11   
ref|XP_009377798.1|  PREDICTED: probable LRR receptor-like serine...  70.9    5e-11   
ref|XP_011077659.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...  70.9    5e-11   
gb|AFO67893.1|  leucine-rich repeat receptor-like kinase              70.5    5e-11   
ref|XP_009145790.1|  PREDICTED: probable LRR receptor-like serine...  70.9    5e-11   
ref|XP_010484821.1|  PREDICTED: putative receptor-like protein ki...  70.1    6e-11   
ref|XP_011035599.1|  PREDICTED: probable LRR receptor-like serine...  70.9    6e-11   
ref|XP_010927979.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  70.1    6e-11   
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  70.1    6e-11   
ref|XP_009626660.1|  PREDICTED: probably inactive leucine-rich re...  70.5    6e-11   
ref|XP_009347340.1|  PREDICTED: probable LRR receptor-like serine...  70.5    6e-11   
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  70.1    6e-11   
ref|XP_008225951.1|  PREDICTED: leucine-rich repeat receptor-like...  70.5    6e-11   
emb|CBI21262.3|  unnamed protein product                              69.7    7e-11   
ref|XP_010100747.1|  putative LRR receptor-like serine/threonine-...  70.1    7e-11   
ref|XP_008390074.1|  PREDICTED: probable LRR receptor-like serine...  70.5    7e-11   
gb|ABA91654.2|  Leucine Rich Repeat family protein, expressed         70.5    7e-11   
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  70.1    7e-11   
ref|XP_009782387.1|  PREDICTED: probable LRR receptor-like serine...  70.5    7e-11   
ref|XP_002875847.1|  hypothetical protein ARALYDRAFT_347851           70.5    7e-11   
ref|XP_010248542.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  70.1    7e-11   
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  70.1    7e-11   
ref|XP_010068348.1|  PREDICTED: putative receptor-like protein ki...  70.5    7e-11   
ref|XP_009409775.1|  PREDICTED: putative leucine-rich repeat rece...  70.5    7e-11   
gb|KCW63534.1|  hypothetical protein EUGRSUZ_G01170                   70.5    7e-11   
ref|XP_009350456.1|  PREDICTED: probable LRR receptor-like serine...  70.5    7e-11   
ref|NP_001176379.1|  Os11g0173500                                     70.1    7e-11   
ref|XP_010041038.1|  PREDICTED: putative receptor-like protein ki...  70.1    7e-11   
gb|KDP44808.1|  hypothetical protein JCGZ_01308                       70.5    7e-11   
ref|XP_002448922.1|  hypothetical protein SORBIDRAFT_05g001640        70.5    8e-11   
ref|XP_002526889.1|  serine-threonine protein kinase, plant-type,...  70.1    8e-11   
ref|XP_002526877.1|  serine-threonine protein kinase, plant-type,...  70.1    8e-11   
gb|KHG14943.1|  LRR receptor-like serine/threonine-protein kinase...  70.1    8e-11   
ref|XP_006587651.1|  PREDICTED: probable LRR receptor-like serine...  70.1    8e-11   
ref|XP_007219818.1|  hypothetical protein PRUPE_ppa026766mg           70.1    8e-11   
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  69.7    8e-11   
ref|XP_009417563.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  69.7    8e-11   
ref|XP_002875851.1|  hypothetical protein ARALYDRAFT_323370           70.1    8e-11   
gb|EEC69968.1|  hypothetical protein OsI_00436                        70.1    8e-11   
emb|CDX86129.1|  BnaC03g56440D                                        70.1    8e-11   
gb|KDP44811.1|  hypothetical protein JCGZ_01311                       70.1    9e-11   
gb|KDP37051.1|  hypothetical protein JCGZ_06107                       70.1    9e-11   
ref|XP_007140207.1|  hypothetical protein PHAVU_008G093200g           70.1    9e-11   
emb|CDX73202.1|  BnaC06g36500D                                        70.1    9e-11   
emb|CDY08290.1|  BnaA05g13290D                                        70.1    9e-11   
emb|CDP14590.1|  unnamed protein product                              70.1    9e-11   
ref|XP_008345430.1|  PREDICTED: probable LRR receptor-like serine...  70.1    9e-11   
ref|NP_001068117.1|  Os11g0569500                                     70.1    9e-11   
emb|CAN63733.1|  hypothetical protein VITISV_025883                   69.7    9e-11   
ref|XP_009352740.1|  PREDICTED: probable LRR receptor-like serine...  69.7    9e-11   
ref|XP_002317696.2|  hypothetical protein POPTR_0012s04160g           70.1    1e-10   
ref|XP_007140208.1|  hypothetical protein PHAVU_008G093200g           70.1    1e-10   
ref|XP_004138566.1|  PREDICTED: probable LRR receptor-like serine...  70.1    1e-10   
ref|XP_006293258.1|  hypothetical protein CARUB_v10019594mg           70.1    1e-10   
ref|XP_008349917.1|  PREDICTED: probable LRR receptor-like serine...  69.7    1e-10   
ref|XP_002324214.1|  leucine-rich repeat transmembrane protein ki...  69.7    1e-10   
dbj|BAJ84911.1|  predicted protein                                    70.1    1e-10   
gb|AGT15910.1|  kinase                                                70.1    1e-10   
gb|KCW80199.1|  hypothetical protein EUGRSUZ_C01543                   69.7    1e-10   
gb|AAB82753.1|  receptor kinase-like protein                          69.3    1e-10   
gb|KCW63531.1|  hypothetical protein EUGRSUZ_G01166                   69.3    1e-10   
ref|XP_004160745.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  69.7    1e-10   
gb|EAZ18782.1|  hypothetical protein OsJ_34308                        69.7    1e-10   
gb|EYU40960.1|  hypothetical protein MIMGU_mgv1a018813mg              69.7    1e-10   
dbj|BAB03631.1|  putative protein kinase Xa21                         69.7    1e-10   
ref|XP_009376751.1|  PREDICTED: probable LRR receptor-like serine...  69.7    1e-10   
gb|AGT17281.1|  hypothetical protein SHCRBa_021_E20_F_10              69.7    1e-10   
emb|CDP19652.1|  unnamed protein product                              69.7    1e-10   
ref|XP_010942232.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  69.3    1e-10   
emb|CAN65889.1|  hypothetical protein VITISV_030571                   69.3    1e-10   
ref|XP_007158089.1|  hypothetical protein PHAVU_002G123200g           69.7    1e-10   
ref|XP_009123618.1|  PREDICTED: putative receptor-like protein ki...  69.7    1e-10   
ref|XP_010533987.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...  69.7    1e-10   
ref|XP_006423117.1|  hypothetical protein CICLE_v10027688mg           69.7    1e-10   
ref|XP_009376752.1|  PREDICTED: probable LRR receptor-like serine...  69.7    1e-10   
gb|KJB73884.1|  hypothetical protein B456_011G258500                  69.7    1e-10   
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...  69.7    1e-10   
ref|XP_009376753.1|  PREDICTED: probable LRR receptor-like serine...  69.7    1e-10   
ref|XP_009380776.1|  PREDICTED: putative leucine-rich repeat rece...  69.7    1e-10   
ref|XP_008649738.1|  PREDICTED: probable LRR receptor-like serine...  68.9    1e-10   
gb|KJB73887.1|  hypothetical protein B456_011G258900                  68.6    1e-10   
emb|CDP19501.1|  unnamed protein product                              69.7    1e-10   
ref|NP_001042050.1|  Os01g0153000                                     69.7    1e-10   
emb|CDY46176.1|  BnaA05g20630D                                        69.3    1e-10   
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...  69.7    1e-10   
ref|XP_008356466.1|  PREDICTED: putative receptor-like protein ki...  68.2    1e-10   
gb|KJB29653.1|  hypothetical protein B456_005G112100                  69.7    1e-10   
gb|KCW69036.1|  hypothetical protein EUGRSUZ_F02590                   69.3    1e-10   
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      68.9    1e-10   
ref|XP_008649737.1|  PREDICTED: probable LRR receptor-like serine...  68.6    1e-10   
emb|CDP03470.1|  unnamed protein product                              66.2    1e-10   
ref|XP_008383876.1|  PREDICTED: probable LRR receptor-like serine...  68.2    1e-10   
emb|CDX87661.1|  BnaA07g32120D                                        69.3    1e-10   
ref|XP_010939071.1|  PREDICTED: probable LRR receptor-like serine...  69.3    2e-10   
ref|XP_008444352.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  68.9    2e-10   
gb|KDP44797.1|  hypothetical protein JCGZ_01297                       69.7    2e-10   
ref|XP_006437543.1|  hypothetical protein CICLE_v10030604mg           69.3    2e-10   
ref|XP_010690951.1|  PREDICTED: probable LRR receptor-like serine...  69.3    2e-10   
ref|XP_009141291.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    2e-10   
ref|XP_009357702.1|  PREDICTED: probable LRR receptor-like serine...  69.3    2e-10   
ref|XP_008223907.1|  PREDICTED: putative receptor-like protein ki...  69.3    2e-10   
ref|XP_002449308.1|  hypothetical protein SORBIDRAFT_05g007490        69.3    2e-10   
gb|KCW77199.1|  hypothetical protein EUGRSUZ_D01548                   69.3    2e-10   
emb|CDP18495.1|  unnamed protein product                              69.3    2e-10   
ref|XP_007207830.1|  hypothetical protein PRUPE_ppa023423mg           69.3    2e-10   
ref|XP_010065152.1|  PREDICTED: probable LRR receptor-like serine...  68.9    2e-10   
gb|KJB07488.1|  hypothetical protein B456_001G026700                  69.3    2e-10   
ref|XP_004954644.1|  PREDICTED: putative receptor-like protein ki...  69.3    2e-10   
ref|XP_009418103.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  68.6    2e-10   
ref|XP_008385922.1|  PREDICTED: LRR receptor-like serine/threonin...  69.3    2e-10   
gb|EMT09927.1|  Putative LRR receptor-like serine/threonine-prote...  69.3    2e-10   
ref|XP_010054697.1|  PREDICTED: putative receptor-like protein ki...  69.3    2e-10   
ref|XP_002985227.1|  hypothetical protein SELMODRAFT_121783           69.3    2e-10   
ref|XP_010044599.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  68.6    2e-10   
ref|XP_004512341.1|  PREDICTED: putative receptor-like protein ki...  69.3    2e-10   
ref|XP_004959075.1|  PREDICTED: probable LRR receptor-like serine...  69.3    2e-10   
ref|XP_003625388.1|  Receptor-like protein kinase                     69.3    2e-10   
ref|XP_010940158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      68.9    2e-10   
emb|CDX71113.1|  BnaC03g11970D                                        68.9    2e-10   
ref|XP_009101569.1|  PREDICTED: probable LRR receptor-like serine...  68.6    2e-10   
ref|XP_011462029.1|  PREDICTED: probable LRR receptor-like serine...  69.3    2e-10   
ref|XP_004960969.1|  PREDICTED: leucine-rich repeat receptor-like...  68.9    2e-10   
emb|CDY39449.1|  BnaAnng05800D                                        68.6    2e-10   
ref|XP_009106236.1|  PREDICTED: receptor protein kinase CLAVATA1      68.9    2e-10   
ref|XP_010257264.1|  PREDICTED: probably inactive leucine-rich re...  68.9    2e-10   
ref|XP_007154851.1|  hypothetical protein PHAVU_003G152900g           68.6    2e-10   
emb|CDY24172.1|  BnaC03g57050D                                        68.9    2e-10   
ref|XP_004142972.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  68.6    2e-10   
emb|CDY25690.1|  BnaC03g69850D                                        68.9    2e-10   
emb|CDX77614.1|  BnaC07g18680D                                        68.6    2e-10   
ref|XP_010535394.1|  PREDICTED: putative receptor-like protein ki...  68.9    2e-10   
ref|XP_004308533.1|  PREDICTED: probable LRR receptor-like serine...  68.9    2e-10   
ref|XP_004493833.1|  PREDICTED: leucine-rich repeat receptor-like...  68.9    2e-10   
ref|XP_002315684.2|  hypothetical protein POPTR_0010s05300g           68.6    2e-10   
ref|XP_004972876.1|  PREDICTED: probable LRR receptor-like serine...  68.9    2e-10   
gb|KCW71306.1|  hypothetical protein EUGRSUZ_F04393                   68.9    2e-10   
ref|XP_006398263.1|  hypothetical protein EUTSA_v10000817mg           68.6    2e-10   
ref|NP_001065873.2|  Os11g0173700                                     68.9    2e-10   
ref|XP_009349319.1|  PREDICTED: putative receptor-like protein ki...  67.8    2e-10   
ref|XP_011099082.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  68.6    2e-10   
ref|XP_002877546.1|  hypothetical protein ARALYDRAFT_347817           68.9    2e-10   
ref|XP_009799744.1|  PREDICTED: probable LRR receptor-like serine...  68.9    2e-10   
gb|EEC68386.1|  hypothetical protein OsI_36534                        68.6    2e-10   
ref|XP_009799745.1|  PREDICTED: probable LRR receptor-like serine...  68.9    2e-10   
ref|XP_006404361.1|  hypothetical protein EUTSA_v10010090mg           68.9    2e-10   
ref|XP_010092495.1|  putative LRR receptor-like serine/threonine-...  67.0    2e-10   
emb|CDY53380.1|  BnaA04g16450D                                        68.9    2e-10   
ref|XP_006378225.1|  hypothetical protein POPTR_0010s05300g           68.6    2e-10   
ref|XP_009803320.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  68.6    2e-10   
ref|XP_009803321.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  68.6    2e-10   
ref|XP_008809709.1|  PREDICTED: LRR receptor-like serine/threonin...  68.6    2e-10   
ref|XP_009144708.1|  PREDICTED: probable LRR receptor-like serine...  68.9    2e-10   
gb|KCW86687.1|  hypothetical protein EUGRSUZ_B03306                   68.6    2e-10   
ref|XP_002453589.1|  hypothetical protein SORBIDRAFT_04g008570        68.6    2e-10   
ref|XP_006292332.1|  hypothetical protein CARUB_v10018543mg           68.6    2e-10   
gb|AFW62722.1|  putative leucine-rich repeat receptor-like protei...  65.1    2e-10   
ref|NP_001152329.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  68.6    2e-10   
gb|KDP44944.1|  hypothetical protein JCGZ_01444                       68.6    2e-10   
ref|XP_002457355.1|  hypothetical protein SORBIDRAFT_03g005930        68.6    2e-10   
ref|XP_009609323.1|  PREDICTED: probable LRR receptor-like serine...  68.9    2e-10   
ref|XP_010044596.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  68.6    3e-10   
ref|XP_010044595.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  68.6    3e-10   
ref|XP_008385786.1|  PREDICTED: probable LRR receptor-like serine...  68.6    3e-10   
ref|XP_002449090.1|  hypothetical protein SORBIDRAFT_05g004660        68.6    3e-10   
ref|XP_010044598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  68.2    3e-10   
gb|KDP44787.1|  hypothetical protein JCGZ_01287                       65.9    3e-10   
ref|XP_010044597.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  68.2    3e-10   
ref|XP_007009033.1|  Serine-threonine protein kinase, plant-type,...  68.6    3e-10   
ref|XP_010044594.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  68.2    3e-10   
gb|EAY80124.1|  hypothetical protein OsI_35296                        68.6    3e-10   
ref|XP_009140910.1|  PREDICTED: probable LRR receptor-like serine...  68.6    3e-10   
ref|NP_001238576.1|  receptor protein kinase-like protein precursor   68.6    3e-10   
ref|XP_010655183.1|  PREDICTED: putative receptor-like protein ki...  68.6    3e-10   
ref|XP_010655823.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    3e-10   
ref|XP_010023506.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      68.2    3e-10   
gb|AAX93040.1|  Leucine Rich Repeat, putative                         68.6    3e-10   
ref|XP_009609321.1|  PREDICTED: probable LRR receptor-like serine...  68.6    3e-10   
ref|XP_010100900.1|  Protein NSP-INTERACTING KINASE 1                 68.6    3e-10   
gb|KCW63536.1|  hypothetical protein EUGRSUZ_G01172                   68.6    3e-10   
ref|XP_002278965.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      68.2    3e-10   
emb|CDP19838.1|  unnamed protein product                              68.6    3e-10   
gb|KJB73890.1|  hypothetical protein B456_011G259200                  68.6    3e-10   
ref|XP_009373071.1|  PREDICTED: probable LRR receptor-like serine...  68.6    3e-10   
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                   68.2    3e-10   
ref|XP_010539846.1|  PREDICTED: receptor protein kinase CLAVATA1      68.6    3e-10   
ref|XP_010541446.1|  PREDICTED: putative receptor-like protein ki...  68.6    3e-10   
emb|CBI16897.3|  unnamed protein product                              68.2    3e-10   
ref|XP_009131995.1|  PREDICTED: probable LRR receptor-like serine...  68.6    3e-10   
gb|KCW86694.1|  hypothetical protein EUGRSUZ_B03306                   67.8    3e-10   
ref|XP_008371720.1|  PREDICTED: probable LRR receptor-like serine...  68.2    3e-10   
gb|KFK34061.1|  hypothetical protein AALP_AA5G097000                  68.6    3e-10   



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  124  AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg  303
            + A KP  + E  ALLS+K A T D QS+L SWNISTSHCTW+ VTCD   HV SL++S 
Sbjct  19   SAAAKPHFLPEYRALLSLKTAITDDPQSALISWNISTSHCTWKGVTCDKYRHVTSLNISN  78

Query  304  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP Q
Sbjct  79   LNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSLISNLRYLNLSNNIFNLSFPQQ  136



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score =   133 bits (335),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 74/115 (64%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +1

Query  133  GKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNL  312
             KP  V E  ALLS+K A T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG NL
Sbjct  23   AKPPYVPEYRALLSLKTAITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFNL  82

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            +G L+P+VG L FL+NLS+A NQ SGP+P E+S I  LR+LNLSNNIF  +FP Q
Sbjct  83   TGTLTPEVGHLRFLLNLSVAVNQFSGPIPVELSFIPNLRYLNLSNNIFNLSFPPQ  137



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 92/124 (74%), Gaps = 4/124 (3%)
 Frame = +1

Query  109  RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvv  285
            R+S GA  G+   + E  ALLSIKAA T D QS+L SWN STSHCTW  VTCD    HV 
Sbjct  16   RYSTGARPGR---MPEYRALLSIKAAITEDPQSTLASWNASTSHCTWEGVTCDVSGRHVT  72

Query  286  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  465
            +LD+S L+L+G LSPDVG L FLVNLS+AAN LSGPVPP+IS I  LR+LNLSNN+F  +
Sbjct  73   ALDISNLSLTGTLSPDVGHLRFLVNLSVAANSLSGPVPPQISDIPNLRYLNLSNNVFNLS  132

Query  466  FPHQ  477
            FP Q
Sbjct  133  FPPQ  136



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            V+E  ALLSIK+A +ADSQ++L+SWN +TSHCTW  VTCDS  HV SLDL  LNLSG LS
Sbjct  21   VSEYRALLSIKSALSADSQAALSSWNATTSHCTWTGVTCDSRHHVTSLDLRDLNLSGTLS  80

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             DV  L FL NL++AANQ SGP+PPEIS +S LRFLNLSNN+F  +FP Q
Sbjct  81   SDVAHLQFLRNLTVAANQFSGPIPPEISQLSALRFLNLSNNVFNGSFPSQ  130



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  309
            AGKP+ ++E  ALLS+K A + D Q  L +WN STSHCTW  V+CDSL  VVSLDLS +N
Sbjct  23   AGKPVRISENRALLSLKTAISDDPQGFLQNWNFSTSHCTWTGVSCDSLNRVVSLDLSNMN  82

Query  310  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            +SG+LSPDVGQL  LVNL++AAN + GP+PP IS IS LR LNLSNN+F  TFP Q
Sbjct  83   ISGILSPDVGQLRNLVNLTVAANLIYGPIPPGISYISGLRLLNLSNNVFNGTFPSQ  138



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  309
            AG+PL + E  ALLSIK A + D Q+SL +WN+STSHCTW  V+CDS   VVSLDLS +N
Sbjct  20   AGRPLRIPEYRALLSIKTAISDDPQASLPNWNLSTSHCTWTGVSCDSFNRVVSLDLSNMN  79

Query  310  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            LSG+LSPDVGQL  L+NL+ AAN  SGP+P EIS IS LR LNLSNN+F  +FP +
Sbjct  80   LSGILSPDVGQLRNLINLTAAANFFSGPIPSEISHISGLRLLNLSNNVFNGSFPSE  135



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVLSP  330
            E  ALLSIK+A TAD QSSL SWN ST+HC+W  VTCDS   HV +LD+SGLNL+G LSP
Sbjct  26   EYKALLSIKSAITADPQSSLASWNDSTTHCSWSGVTCDSYGRHVTALDISGLNLTGSLSP  85

Query  331  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            DV  L  L+NLS+AANQ  GPVPPEIS+ISTLR+LNLSNNIF  TFP Q
Sbjct  86   DVSHLRLLLNLSVAANQFCGPVPPEISSISTLRYLNLSNNIFNLTFPRQ  134



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  124  AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldls  300
            + A +P  ++E  ALLSIKAA T D QS+L SWN++T+HCTW+ +TCD S  HV SLD+S
Sbjct  16   SAAARPPRMSEYRALLSIKAAITDDPQSALASWNLTTNHCTWKGITCDPSRRHVTSLDIS  75

Query  301  glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             L+L+G LSPDVGQL FLVNLS+AAN +SGPVPP+IS I  LR+LNLSNN+F  +FP
Sbjct  76   NLSLTGTLSPDVGQLRFLVNLSVAANFISGPVPPQISDIPNLRYLNLSNNVFNLSFP  132



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score =   129 bits (325),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 72/115 (63%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = +1

Query  133  GKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNL  312
             KP  V E  ALLS+K + T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG NL
Sbjct  23   AKPPYVPEYRALLSLKTSITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFNL  82

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            +G L+P+VG L FL+NLS+A NQ SGP+P E+S I  L +LNLSNNIF  +FP Q
Sbjct  83   TGTLTPEVGHLRFLLNLSVAVNQFSGPIPIELSFIPNLSYLNLSNNIFNLSFPPQ  137



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = +1

Query  124  AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldl  297
            + A KP  + E  ALLS+K A + D QS+L SWN ST  SHCTW+ VTCD   HV SL++
Sbjct  15   SAAAKPHFLPEYRALLSLKTAISDDPQSALISWNSSTTTSHCTWKGVTCDKYRHVTSLNI  74

Query  298  sglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            S LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP Q
Sbjct  75   SNLNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSVISNLRYLNLSNNIFNLSFPQQ  134



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 88/121 (73%), Gaps = 1/121 (1%)
 Frame = +1

Query  118  AGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsld  294
             G+ A  P  + E  ALLSIKAA T D QS+L SWN +T HCTWR VTCD+    V SLD
Sbjct  16   GGSAAATPPHMPEYRALLSIKAAITDDPQSALASWNATTHHCTWRGVTCDASGRRVASLD  75

Query  295  lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  474
            +S L+L+GVLSPDVG+L FLVN S AAN LSGP+PP+IS I  LR LNLSNN+F  +FP 
Sbjct  76   ISNLSLAGVLSPDVGRLRFLVNFSAAANFLSGPIPPQISDIPNLRHLNLSNNVFNLSFPA  135

Query  475  Q  477
            +
Sbjct  136  E  136



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = +1

Query  112  HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  291
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  11   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  70

Query  292  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  71   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  130

Query  472  HQ  477
             Q
Sbjct  131  SQ  132



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = +1

Query  112  HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  291
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  292  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  72   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  131

Query  472  HQ  477
             Q
Sbjct  132  SQ  133



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  309
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SLD+SG N
Sbjct  18   AGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSLDISGFN  77

Query  310  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            L+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP Q
Sbjct  78   LTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFPSQ  133



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = +1

Query  112  HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  291
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  292  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            D+SG NL+G L P+VG L FL NLS+A NQ +GP+P EIS I  L +LNLSNNIFG  FP
Sbjct  72   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPIPVEISFIPNLGYLNLSNNIFGMEFP  131

Query  472  HQ  477
             Q
Sbjct  132  PQ  133



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  309
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  39   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  98

Query  310  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP Q
Sbjct  99   LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQ  154



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  309
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  20   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  79

Query  310  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP Q
Sbjct  80   LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQ  135



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            V E  ALLS KAA T D QSSL +WN ST HCTW  +TCDS  HV SLDLSGLNLSG LS
Sbjct  26   VPEYKALLSFKAALTDDPQSSLATWNASTLHCTWFGITCDSRRHVTSLDLSGLNLSGSLS  85

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P++  L FL N+S+A NQ SGP+P EISAIS LR LNLSNN+F  TFP
Sbjct  86   PELAYLRFLSNVSLADNQFSGPIPAEISAISGLRLLNLSNNVFNGTFP  133



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  309
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW+ VTCD   HV SLD+SG N
Sbjct  20   AGKQPRIPEYQALLALKTAITDDPQLALASWNISTSHCTWKGVTCDRYRHVTSLDISGFN  79

Query  310  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            ++G L P+VG L FL NLS+  NQ SGP+P EIS I  L +LNLSNNIF   FP Q
Sbjct  80   VTGTLPPEVGNLRFLQNLSVDLNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFPPQ  135



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVL  324
            +TE  ALLS+K++FT D  S LTSWN+ST+ C+W  VTCD  L HV SLDLSGLNLSG L
Sbjct  25   ITELNALLSLKSSFTIDEHSPLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGTL  84

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            S DV  LP L NLS+AANQ+SGP+PPEIS +  LR LNLSNN+F  ++P +
Sbjct  85   SSDVSHLPLLQNLSLAANQISGPIPPEISNLYELRHLNLSNNVFNGSYPDE  135



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = +1

Query  142  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSG  318
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS   +V SLDLSGL+L+G
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  319  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             LSPDV  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP Q
Sbjct  80   TLSPDVAHLRFLANLTLAENQFSGPIPPEISALSGLRLLNLSNNVFNTTFPPQ  132



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVL  324
            +TE  ALLS+K++ T D  S L SWN+ST+ C+W  VTCD    HV SLDLSGL+LSG L
Sbjct  22   ITELQALLSLKSSLTGDEHSPLNSWNLSTTFCSWTGVTCDVSRRHVTSLDLSGLDLSGTL  81

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            S DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +
Sbjct  82   SSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRHLNLSNNVFNGSYPDE  132



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVL  324
            +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS   +V SLDLSGL+L+G L
Sbjct  21   MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTL  80

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP Q
Sbjct  81   SPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPRQ  131



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  309
            AGK   + E  ALL++K A   D Q +L SWN STSHCTW+ VTCD   HV SLD+SG N
Sbjct  19   AGKHPRIPEYQALLALKTAIIDDPQLALASWNNSTSHCTWKGVTCDRYRHVTSLDISGFN  78

Query  310  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            ++G L P+VG   FL NLS+A NQ SGP+P EIS I  L +LNLSNNIF   FP Q
Sbjct  79   VTGTLPPEVGNFRFLQNLSVALNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFPPQ  134



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            ++E  ALLS+++A T  +   LTSWN ST +C+W  VTCD+  HV SLDL+GL+LSG LS
Sbjct  25   ISEYRALLSLRSAITDATPPLLTSWNSSTPYCSWLGVTCDNRRHVTSLDLTGLDLSGPLS  84

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             DV  LPFL NLS+A+N+ SGP+PP +SA+S LRFLNLSNN+F  TFP +
Sbjct  85   ADVAHLPFLSNLSLASNKFSGPIPPSLSALSGLRFLNLSNNVFNETFPSE  134



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVL  324
            +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS   +V SLDLSGL+L+G L
Sbjct  21   MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTL  80

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP Q
Sbjct  81   SPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPPQ  131



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = +1

Query  142  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSG  318
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS   +V SLDLSGL+L+G
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  319  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP +
Sbjct  80   TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFPXK  132



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 85/112 (76%), Gaps = 2/112 (2%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSL-TSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGV  321
            +TE  ALLS+K++FT D  S L TSWN+ST+ C+W  VTCD  L HV SLDLSGLNLSG 
Sbjct  25   ITELHALLSLKSSFTIDEHSPLLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGT  84

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            LS DV  LP L NLS+AANQ+SGP+PP+IS +  LR LNLSNN+F  +FP +
Sbjct  85   LSSDVAHLPLLQNLSLAANQISGPIPPQISNLYELRHLNLSNNVFNGSFPDE  136



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 86/120 (72%), Gaps = 6/120 (5%)
 Frame = +1

Query  130  AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldl  297
            AG+P  ++E  ALLS+K++ T    D  S LTSW +STS C W  VTCD    HV SLDL
Sbjct  31   AGRP--ISEYHALLSLKSSLTGGENDQHSPLTSWKLSTSFCLWTGVTCDVSRRHVTSLDL  88

Query  298  sglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SGLNLSG LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNNIF  ++P +
Sbjct  89   SGLNLSGTLSSDVAHLPLLQNLSVAANQISGPIPPEISNLSELRHLNLSNNIFNGSYPDE  148



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP Q
Sbjct  80   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQ  129



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP Q
Sbjct  80   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQ  129



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  22   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  81

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP Q
Sbjct  82   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQ  131



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            ++E  ALLS+++  T  +   L+SWN S  +C+W  VTCD+  HV +L+L+GL+LSG LS
Sbjct  25   ISEYRALLSLRSVITDATPPVLSSWNASIPYCSWLGVTCDNRRHVTALNLTGLDLSGTLS  84

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             DV  LPFL NLS+AAN+ SGP+PP +SA+S LR+LNLSNN+F  TFP +
Sbjct  85   ADVAHLPFLSNLSLAANKFSGPIPPSLSALSGLRYLNLSNNVFNETFPSE  134



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            +++  ALLS K++ ++D  S L+SW  +TSHCTW  VTCDS  HV SLDLS  +L G LS
Sbjct  22   MSDYRALLSFKSSISSDPNSVLSSWTPTTSHCTWTGVTCDSRRHVTSLDLSSSDLVGTLS  81

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             D+  L FL NL++A NQ SGP+P EISA+S LR LNLSNNIF +TFP Q
Sbjct  82   SDIAHLRFLSNLTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQ  131



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +1

Query  142  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSG  318
            + ++   ALLS+K++ T+   S+L++W  +TSHCTW  VTCDS   +V SLDLSGL+L+G
Sbjct  20   IAMSNYRALLSLKSSITSXPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  319  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP
Sbjct  80   TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFP  130



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 85/120 (71%), Gaps = 6/120 (5%)
 Frame = +1

Query  130  AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldl  297
            AG+P  ++E  AL+S+K++ T    D  S L SW  STS CTW  VTCD    HV SLDL
Sbjct  19   AGRP--ISELHALISLKSSLTGAGEDPNSPLASWKSSTSFCTWTGVTCDISRRHVTSLDL  76

Query  298  sglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SGLNLSG LSPDV +LP L NLS+A NQ+SGP+PPEIS +  LR LNLSNN+F  +FP +
Sbjct  77   SGLNLSGTLSPDVSRLPLLQNLSVADNQISGPIPPEISNLYGLRHLNLSNNVFNGSFPDE  136



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            ++E  ALLS++ A T  +   L+SWN ST+HC W  VTCD+  HV +L+L+GLNLSG L+
Sbjct  23   ISEYRALLSLREAITDTNPPILSSWNPSTTHCIWLGVTCDTRRHVTALNLTGLNLSGTLA  82

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             D+  LPFL NLS+A N+ SG +PP +SA+S LR LNLSNN+F  TFP +
Sbjct  83   ADIAHLPFLSNLSLADNKFSGEIPPSLSAVSGLRLLNLSNNVFNGTFPSE  132



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLS  315
            ++E  ALLS+K++ T    D  S L+SW +STS CTW  VTCD    HV SLDLSGLNLS
Sbjct  23   ISEFRALLSLKSSLTGAGDDINSPLSSWKVSTSFCTWTGVTCDVSRRHVTSLDLSGLNLS  82

Query  316  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            G LSPDV  L  L NLS+A NQ+SGP+PPEIS++S LR LNLSNN+F  +FP +
Sbjct  83   GTLSPDVSHLRLLQNLSLADNQISGPIPPEISSLSGLRHLNLSNNVFNGSFPDE  136



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = +1

Query  163  ALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  342
            ALLS+K++   D  S L+SW  +TSHCTW  VTCDS  HV SLDLSGLNLSG LSPD+  
Sbjct  38   ALLSLKSSLD-DPDSRLSSWTPNTSHCTWAGVTCDSHNHVTSLDLSGLNLSGYLSPDIAF  96

Query  343  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            L +L NL++A N LSGP+PPEISA+  LR LNLSNN+F  TFP
Sbjct  97   LVYLSNLTLAENNLSGPIPPEISALPALRLLNLSNNVFNRTFP  139



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 83/113 (73%), Gaps = 3/113 (3%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSL-TSWNIS-TSHCTWRRVTCdsll-hvvsldlsglNLSG  318
            +TE  ALLS+K++ T D  S L TSWN+S T+ C+W  V CD    HV SLDLSGLNLSG
Sbjct  23   ITELNALLSLKSSLTGDDHSPLLTSWNLSSTTFCSWTGVKCDVSRRHVTSLDLSGLNLSG  82

Query  319  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +
Sbjct  83   TLSSDVSHLPLLQNLSLAANQISGPIPPEISKLSELRLLNLSNNVFNGSYPDE  135



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNL  312
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD    HV SLDLSGLNL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDE  137



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNL  312
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD    HV SLDLSGLNL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDE  137



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 84/113 (74%), Gaps = 3/113 (3%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsll-hvvsldlsglNLSG  318
            +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD    HV SLDLSGLNLSG
Sbjct  23   ITEFNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  82

Query  319  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +
Sbjct  83   TLSSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRLLNLSNNVFNGSYPDE  135



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNL  312
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD    HV SLDLSGLNL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISNLSGLRHLNLSNNVFNGSFPDE  137



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVL  324
            V+E  ALLSIK++ T D QS L++WN +T  C+W  +TCD     V SLDLSGLNLSG L
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTTPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            S DV  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP Q
Sbjct  88   SSDVAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQ  138



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVL  324
            TE  ALLS+K + T+  QSS LTSWN+S S C W  VTCD  L HV SLDLS LNLSG L
Sbjct  22   TELHALLSLKTSLTSGEQSSSLTSWNLSKSFCLWAGVTCDVSLRHVTSLDLSSLNLSGTL  81

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            S DV  LP L NLS+AANQ+SGP+PPEI+ +S LR LNLSNN+F  ++P+Q
Sbjct  82   SSDVAHLPLLQNLSVAANQISGPIPPEIANLSELRHLNLSNNVFNGSYPNQ  132



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   105 bits (262),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 59/112 (53%), Positives = 70/112 (63%), Gaps = 6/112 (5%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl------NLS  315
            EQ ALL IK+A T D QSSL+SWN ST HCTW  + C S   +              NL+
Sbjct  24   EQKALLGIKSAITDDPQSSLSSWNTSTHHCTWDFIKCSSSSSLNHHQSVVSLNISGLNLT  83

Query  316  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            G+LSPD+G L  L NLS+A N  SGP+P  +S +S L  LNLSNNIF STFP
Sbjct  84   GILSPDIGFLTNLQNLSVAGNSFSGPIPSSLSLLSNLYHLNLSNNIFNSTFP  135



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 88/121 (73%), Gaps = 1/121 (1%)
 Frame = +1

Query  112  HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvs  288
            H     A +P  ++E  AL+SIKAA + +++ +L SWN   SHC+WR VTCDSL  HV  
Sbjct  15   HLQRCAAVRPPRMSEYHALVSIKAAISEEARPALASWNSGASHCSWRGVTCDSLGRHVTG  74

Query  289  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  468
            LD+S L+LSG LSPDVGQL FLVNLS AAN LSGPVP EI+ I  LR+LNLSNN+F  +F
Sbjct  75   LDISNLSLSGSLSPDVGQLLFLVNLSAAANLLSGPVPAEIADIPNLRYLNLSNNVFNLSF  134

Query  469  P  471
            P
Sbjct  135  P  135



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 81/114 (71%), Gaps = 4/114 (4%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLS  315
            ++E  ALLS+K + T    D  S L+SW +STS CTW  VTCD    HV SLDLSGLNLS
Sbjct  23   ISEFRALLSLKTSLTGAGDDKNSPLSSWKVSTSFCTWIGVTCDVSRRHVTSLDLSGLNLS  82

Query  316  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            G LSPDV  L  L NLS+A N +SGP+PPEIS++S LR LNLSNN+F  +FP +
Sbjct  83   GTLSPDVSHLRLLQNLSLAENLISGPIPPEISSLSGLRHLNLSNNVFNGSFPDE  136



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVL  324
            V+E  ALLSIK++ T D QS L++WN +   C+W  +TCD     V SLDLSGLNLSG L
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTAPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            S D+  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP Q
Sbjct  88   SSDIAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQ  138



>ref|XP_010028033.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
 gb|KCW54695.1| hypothetical protein EUGRSUZ_I00635 [Eucalyptus grandis]
Length=1023

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 9/129 (7%)
 Frame = +1

Query  109  RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTS-------HCTWRRVTCd  267
            R  A A A  P  +TE  ALLSI+AA T D QS+L+SW  + +       HC+W+ VTCD
Sbjct  17   RRGAAASAA-PTRLTEPLALLSIRAAVTGDPQSALSSWTSAAAAAANGSSHCSWQGVTCD  75

Query  268  -sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS  444
                HV +LDLS L L+G LSPDV  L FL++LS+AANQLSGP+PP+ISA++ LR+LNLS
Sbjct  76   PRRRHVTALDLSSLELAGALSPDVAHLRFLISLSVAANQLSGPIPPQISALAALRYLNLS  135

Query  445  NNIFGSTFP  471
            NN+F  TFP
Sbjct  136  NNVFNGTFP  144



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsll-hvvsldlsglNLSG  318
            +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD    HV SLDLSGLNLSG
Sbjct  22   ITELNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  81

Query  319  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             LS DV  LP L NLS+AANQ+SGP+PPE S +  LR LNLSNN+F  ++P +
Sbjct  82   TLSSDVSHLPLLQNLSLAANQISGPIPPEFSNLYELRLLNLSNNVFNGSYPDE  134



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 81/115 (70%), Gaps = 5/115 (4%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNL  312
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD    HV SLDLSGLNL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SG LSPDV  L  L NLS+A NQ+SGP+P EIS +S LR LNLSNN+F  +FP +
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPTEISNLSGLRHLNLSNNVFNGSFPDE  137



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVL  324
            V+E  ALL++K++ T D QS L++WN +T  C++  VTCD    HV SL+LS  NLSG L
Sbjct  24   VSEFQALLAVKSSITDDPQSYLSNWNATTPLCSFTGVTCDYTGRHVTSLNLSYFNLSGTL  83

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +FP Q
Sbjct  84   SPSFSHLQFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSFPTQ  134



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 88/120 (73%), Gaps = 7/120 (6%)
 Frame = +1

Query  133  GKPLGVTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldl  297
            G+P  ++E  ALLSIK++ +      + S L +WN ST+ C W  VTCD+   HV+SLDL
Sbjct  22   GRP--ISEFRALLSIKSSLSGAGDGPNSSPLATWNDSTTFCAWTGVTCDASGRHVISLDL  79

Query  298  sglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SGLNLSG LSPD+  L  L NLS+A+NQ+SGP+PPE+S++S LR+LNLSNN+F  +FP +
Sbjct  80   SGLNLSGTLSPDIAHLFLLQNLSVASNQISGPIPPEVSSLSGLRYLNLSNNVFNGSFPDE  139



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 84/120 (70%), Gaps = 7/120 (6%)
 Frame = +1

Query  133  GKPLGVTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldl  297
            GKP  ++E  ALLS+K++ T     D  S L+SW ++TS CTW  VTCD    HV SLDL
Sbjct  20   GKP--ISEPRALLSLKSSLTVTGDDDKNSPLSSWKLTTSFCTWTGVTCDVSRRHVTSLDL  77

Query  298  sglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SGLNL G LSP++  L  L NLS+A NQ+SG +PP+IS +S LR+LNLSNN+F  TFP +
Sbjct  78   SGLNLPGTLSPEISHLRLLQNLSLAENQISGQIPPQISNLSGLRYLNLSNNVFNGTFPDE  137



>ref|XP_009150662.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brassica rapa]
Length=997

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 82/112 (73%), Gaps = 2/112 (2%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGV  321
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTCD    HV SLDLS LNLSG 
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTCDVSRRHVTSLDLSSLNLSGT  82

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            LSPDV  LP L NLS+A NQ+SGP+PPEIS +S LR LNLSNNIF  +FP +
Sbjct  83   LSPDVSHLPLLQNLSLADNQISGPIPPEISNLSGLRHLNLSNNIFNGSFPGE  134



>gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVL  324
            ++E  ALLS+KAA   D QS+L SWN S S C+W  VTCD S  HV SLDLS LNLSG+L
Sbjct  23   MSEYQALLSVKAAID-DPQSALVSWNSSNSLCSWSGVTCDPSGRHVTSLDLSSLNLSGIL  81

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            S D+  L +L NL++AANQLSGP+PP++SAI  LR LNLSNN+F  TFP Q
Sbjct  82   SSDIAHLRYLQNLTLAANQLSGPIPPQLSAIPGLRSLNLSNNVFNGTFPSQ  132



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 84/117 (72%), Gaps = 3/117 (3%)
 Frame = +1

Query  130  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsgl  306
            A +P  V+E  ALL++K++FT D +S L++WN +T  C++  V CD    HV S+DLS  
Sbjct  19   AARP--VSEFRALLAVKSSFTDDPESYLSNWNATTRFCSFTGVACDYTGRHVTSIDLSNF  76

Query  307  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            NLSG LSP    L FL +LS+AANQ+SGP+P E++A+S+LR+ NLSNN+F  +FP Q
Sbjct  77   NLSGTLSPSFSHLRFLQSLSLAANQISGPIPTELAALSSLRYFNLSNNVFNGSFPSQ  133



>ref|XP_010675918.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=940

 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  324
            ++E+ ALLSIK+A T D Q+ L+SWN +T HC+W  +TC SL   V       L L+G+L
Sbjct  51   LSEEKALLSIKSAITDDPQNYLSSWNTTTHHCSWPFITCSSLSSSVISLDISGLELTGIL  110

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SPD+G L  L NL+IA N  S P+PP +S ++ LR+LNLS N F +TFP
Sbjct  111  SPDIGSLTHLQNLNIAENSFSDPIPPSLSLLTQLRYLNLSYNDF-TTFP  158



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVL  324
            V E  ALL++K++ T D QS L++WN +   C++  VTCD    HV SLDLS  NLSG L
Sbjct  24   VLEFQALLAVKSSITGDPQSYLSNWNATIPLCSFTGVTCDYTGRHVTSLDLSYFNLSGTL  83

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +FP Q
Sbjct  84   SPSFSHLRFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSFPTQ  134



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVL  324
            VTE +AL+++K++ T D QS L++WN +T  C++  V CD    HV S+DL+   LSG L
Sbjct  27   VTELSALIAVKSSITDDPQSYLSNWNANTPLCSFAGVACDLTGRHVTSIDLTNFTLSGTL  86

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SP +  L FL NLS+AAN LSGP+P E++ +S LR+LNLSNN+F  +FP Q
Sbjct  87   SPSLAHLRFLQNLSVAANDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQ  137



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVL  324
            VTE  AL+++K++ T D QS L++WN ST  C++  VTCD    HV S+DL+ + L+G L
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNASTPLCSFAGVTCDLTGRHVTSIDLTNVTLAGTL  86

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SP +  L FL NLS+A N LSGP+P E++ +S LR+LNLSNN+F  +FP Q
Sbjct  87   SPSLAHLRFLQNLSVAGNDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQ  137



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 75/112 (67%), Gaps = 2/112 (2%)
 Frame = +1

Query  148  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCds-llhvvsldlsglNLSGV  321
            ++E   LLS K++  T D   SL SWN ST+HC+W  +TC     HV S+DLS L L+  
Sbjct  22   ISEHKTLLSFKSSSITDDPTHSLISWNSSTTHCSWHGITCTGPHRHVTSIDLSSLTLTAT  81

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            LS  +  LPFL NLS+A N+ SGP+PP  S++ +LRFLNLSNN+F  TFP Q
Sbjct  82   LSDHLSNLPFLSNLSLADNKFSGPIPPSFSSLYSLRFLNLSNNVFNGTFPSQ  133



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  324
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  +TCDS  HV SL+L+ L+LSG L
Sbjct  19   ISEYRALLSFKASSLTDDPTHALSSWNSSTPFCSWFGLTCDSRRHVTSLNLTSLSLSGTL  78

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            S D+  LPFL +LS+A N+ SGP+P   SA+S LRFLNLSNN+F +TFP Q
Sbjct  79   SDDLSHLPFLSHLSLADNKFSGPIPASFSALSALRFLNLSNNVFNATFPSQ  129



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  324
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  VTCDS  HV  L+L+ L+LS  L
Sbjct  19   ISEYRALLSFKASSITNDPTHALSSWNSSTPFCSWFGVTCDSRRHVTGLNLTSLSLSATL  78

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
               +  LPFL +LS+A NQ SGP+P   SA+S LRFLNLSNN+F  TFP Q
Sbjct  79   YDHLSHLPFLSHLSLADNQFSGPIPVSFSALSALRFLNLSNNVFNQTFPSQ  129



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 ref|XP_004163335.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            V+E  ALLS+K + T D +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LS
Sbjct  26   VSEYRALLSLKTSITGDPKSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLS  85

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            PDV  L FL NLS+AAN+ SGP+PPE+S+IS+LR LNLSNN+F  +FP
Sbjct  86   PDVAFLRFLTNLSLAANEFSGPIPPELSSISSLRLLNLSNNVFDGSFP  133



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVL  324
            VTE  AL+++K++ T D QS L++WN +T  C++  VTCD    HV S+DL+   LSG L
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNATTPLCSFAGVTCDLTGRHVTSIDLTNFTLSGTL  86

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SP +  L FL NLS+A N L+GP+P E++ +S LR+LNLSNN+F  +FP Q
Sbjct  87   SPSLAHLRFLQNLSVADNNLTGPIPTELAVLSNLRYLNLSNNVFNGSFPTQ  137



>ref|XP_010685023.1| PREDICTED: receptor-like protein 12 [Beta vulgaris subsp. vulgaris]
Length=762

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 80/122 (66%), Gaps = 11/122 (9%)
 Frame = +1

Query  136  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd---------sllhvvs  288
            KPL   EQ  LLSIK++ T D Q++L+SWN +T+HCTW  VTC          +   V+S
Sbjct  21   KPLQ-DEQKVLLSIKSSITDDPQNTLSSWNTTTNHCTWPFVTCSHHHHSPTNTTTSTVIS  79

Query  289  ldlsglNLSGVLS-PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  465
            LD+S LNL+G+LS  ++  L  L  LS+A N  SG +PP +S +S LR+LNLS+NIF  T
Sbjct  80   LDISSLNLTGILSLSNISLLTNLQKLSVADNYFSGQIPPSLSLLSNLRYLNLSDNIFNGT  139

Query  466  FP  471
            FP
Sbjct  140  FP  141



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  324
            ++E  ALLS KA+  T D  ++L+SWN ST++C+W  +TCDS LHV +L+L+  +LSG L
Sbjct  26   ISEYRALLSFKASSITDDPTNALSSWNSSTTYCSWLGITCDSRLHVTTLNLTSSSLSGTL  85

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
               +  LPFL  LS+A NQ SGP+P   S++S LR LNLSNN F +TFP
Sbjct  86   YDHLSHLPFLSYLSLADNQFSGPIPASFSSLSALRHLNLSNNAFNATFP  134



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 78/119 (66%), Gaps = 4/119 (3%)
 Frame = +1

Query  115  SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld  294
            +A  GAG      E  ALLS+KA  + D  ++L  W+ +T HC+W  VTCD    VVSLD
Sbjct  20   AADDGAGY---AEEHRALLSLKAQLS-DPGAALGPWDATTDHCSWPGVTCDDAGAVVSLD  75

Query  295  lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            LSG NLSG+L P VG+L  L+ LS AAN  SGP+P E++ +  LR LNLSNNIF  +FP
Sbjct  76   LSGRNLSGLLPPAVGRLRSLLRLSAAANSFSGPIPSELALLPALRHLNLSNNIFNGSFP  134



>ref|XP_002531999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30398.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=1021

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsll-hvvsldlsglNLSG  318
            ++E  ALLS+K+A   D Q +L SWN +  +  CTW  VTCD    H+ SLDLS LNLSG
Sbjct  25   ISEYQALLSLKSAID-DPQGALASWNSTNKNNLCTWSFVTCDYNNRHITSLDLSSLNLSG  83

Query  319  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             LSPD+  L +L NL++AANQ+SGP+P ++SAIS LR LNLSNN+F  +FP Q
Sbjct  84   TLSPDIAHLRYLQNLTLAANQISGPIPIQLSAISGLRCLNLSNNVFNGSFPTQ  136



>ref|XP_009394785.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGV  321
            ++  ALLS+KA F+  + + L++WN S    HC+W  V+CD     VVSLDL+GLNLSG 
Sbjct  30   SDVEALLSLKADFSDATSAVLSAWNSSADDDHCSWPGVSCDPLQGFVVSLDLTGLNLSGT  89

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            LSP VG+L  L+NLS A+N LSGP+P E+S +S LR LNLSNN+F  +FP
Sbjct  90   LSPAVGRLRHLLNLSAASNSLSGPIPAELSRLSDLRHLNLSNNLFNGSFP  139



>ref|XP_006852730.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 2/107 (2%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLSP  330
            E   LLS+KAA   D  +SL SWN ST +C+W  V CD+  + VVSLDLS  NL+G L+P
Sbjct  28   EYRYLLSLKAAII-DPDNSLQSWNSSTDYCSWSGVACDASSNHVVSLDLSARNLNGTLAP  86

Query  331  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            ++G+L  LVN+++A NQ +G +P EIS I+ L+ LNLSNN F + FP
Sbjct  87   EIGRLRSLVNITVAENQFAGGIPLEISQINGLKLLNLSNNYFSANFP  133



>ref|XP_008787359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1, partial [Phoenix 
dactylifera]
Length=1004

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 77/120 (64%), Gaps = 5/120 (4%)
 Frame = +1

Query  115  SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvvsl  291
            +A +G G+   V E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VVSL
Sbjct  19   AAASGRGR---VVEHRALLDLKAAL-GDPSGALAGWDATADHCQAWSGVACDAAGRVVSL  74

Query  292  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            ++S LNLSG L   V +L  L++LS AAN+LSGP+PPE+S +S LRFLNLSNN F  T P
Sbjct  75   NISXLNLSGPLPRAVSRLRSLLHLSAAANELSGPIPPELSLLSGLRFLNLSNNAFNRTLP  134



>ref|XP_010518800.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1011

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +1

Query  193  ADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVLSPDVGQLPFLVNLSI  369
            A   S+L +W  STS C W  VTCD+   HV+SLDLSGLNLSG LS D+  L  L N S+
Sbjct  40   AGDDSALATWTDSTSFCGWAGVTCDASRRHVISLDLSGLNLSGTLSSDIAHLRLLQNFSV  99

Query  370  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            +ANQ+SGP+PPEIS++  LR+LNLSNN+F  +FP +
Sbjct  100  SANQISGPIPPEISSLFGLRYLNLSNNVFNGSFPDE  135



>ref|XP_009408581.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1016

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  333
            E  ALLSIK+  + D  ++LT+W+ +T HC W  VTCD    V        NLSG LSP 
Sbjct  30   EHHALLSIKSQLS-DPGAALTAWDPATDHCAWPGVTCDRAAVVELDLSGR-NLSGPLSPA  87

Query  334  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             G L  L+ LS A N LSGP+PP ++ ++ LR LNLSNN+F  +FP
Sbjct  88   FGSLRSLLRLSAAENSLSGPIPPALALLTVLRHLNLSNNLFDGSFP  133



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +
Sbjct  85   DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSE  134



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +
Sbjct  85   DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSE  134



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 81/122 (66%), Gaps = 7/122 (6%)
 Frame = +1

Query  124  AGAGKPLG---VTEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsllh-vv  285
            AGA  P G     +QA LLS+K+A + D  ++L  WN + +  HC W  V CD+ L  VV
Sbjct  25   AGAPPPDGEASADDQATLLSLKSALS-DPGAALAGWNATAAPDHCAWHGVACDATLRRVV  83

Query  286  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  465
            SLDLSGLNLSG L   VG L  L+NLS A N LSGP+PPE+S +S LR LNLSNN+F  +
Sbjct  84   SLDLSGLNLSGSLPTAVGHLRHLLNLSAATNFLSGPIPPELSFLSDLRHLNLSNNLFNGS  143

Query  466  FP  471
            FP
Sbjct  144  FP  145



>ref|XP_010941985.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1024

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 78/120 (65%), Gaps = 5/120 (4%)
 Frame = +1

Query  115  SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvvsl  291
            +A +G G+   V E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VVSL
Sbjct  19   AAASGGGR---VGEHRALLDLKAAL-GDPSGALAGWDAAADHCQAWVGVACDAAGRVVSL  74

Query  292  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            ++S LNLSG L P V +L  L+ LS AANQLSGP+PPE+S +S LRFLNLSNN F  TFP
Sbjct  75   NISNLNLSGPLPPAVSRLRSLLRLSTAANQLSGPIPPELSLLSGLRFLNLSNNAFNETFP  134



>ref|XP_009136515.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=993

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +1

Query  202  QSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVLSPDVGQLPFLVNLSIAAN  378
             S L SW++STS C W  VTCD+ L HV+SLDLSGLNLSG L   V  LP L NLS+AAN
Sbjct  45   HSPLASWDLSTSFCLWTGVTCDASLRHVISLDLSGLNLSGTLPSSVAHLPLLRNLSLAAN  104

Query  379  QLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            Q+SG +PPE++++S LR LNLSNN+F  +FP +
Sbjct  105  QISGHIPPEMASLSELRRLNLSNNVFNGSFPDE  137



>ref|XP_010676066.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1 [Beta vulgaris subsp. vulgaris]
Length=853

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldl-sglNLSGVL  324
            ++E+ ALLSIK+A T D  +SL+SW  +T HC+W  +TC S    V     + L L G+L
Sbjct  24   LSERQALLSIKSAITYDPFNSLSSWKNTTHHCSWPYITCSSSSSSVISLNFTELLLEGIL  83

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SPD+G L  L NLSI +N  SGP+P  +S ++ LR+L++S+N F    P
Sbjct  84   SPDIGFLTNLQNLSIRSNLFSGPLPHSLSLLTQLRYLHVSSNSFTGPIP  132



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 4/110 (4%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCd-sllhvvsldlsglNLSGV  321
            TE  ALL +KAA  +D  ++L++WN S    HC+W  V CD     VVSLDLSGLNLSG 
Sbjct  29   TEVEALLELKAA-VSDPSAALSAWNSSDGVDHCSWPGVACDPLRGSVVSLDLSGLNLSGT  87

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            LSP VG+L  L+NLS+A+N LSGP+P ++S ++ LR LNLS+N+   +FP
Sbjct  88   LSPAVGRLRHLLNLSVASNSLSGPIPADLSRLADLRHLNLSDNLLNGSFP  137



>ref|XP_009395647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1004

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 1/93 (1%)
 Frame = +1

Query  196  DSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  372
            D   +L +WN +  HC+W  V CD   + V+SLDL+GLNLSG LSP VG+L  LVNLS A
Sbjct  46   DPSGALYAWNSADGHCSWPGVACDPIRVFVLSLDLTGLNLSGTLSPAVGRLHHLVNLSTA  105

Query  373  ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            +N LSGP+P E+S +S LR LNLSNN+F  +FP
Sbjct  106  SNSLSGPLPAELSHLSNLRHLNLSNNLFNGSFP  138



>emb|CDP18494.1| unnamed protein product [Coffea canephora]
Length=1062

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T+Q ALL  K     D    L+SWN S  HC W+ +TCD+    V +L L+G +LSG LS
Sbjct  63   TDQLALLEFKQQILDDPHGVLSSWNHSEHHCQWQGITCDTQHQRVTALTLAGKSLSGTLS  122

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L F+ ++ +  N   G +PPEI  +  LRFLNLS N F    P
Sbjct  123  PHIGNLSFMKSIQLGGNLFHGEIPPEIGRLFRLRFLNLSRNTFSGEIP  170



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +1

Query  142  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGV  321
            L  +E  ALLS+++A T  +   L+SWN STS+C+W  VTCDS  HV++L+L+GL+LSG 
Sbjct  18   LPFSEYTALLSLRSAITDATPPVLSSWNASTSYCSWLGVTCDSHRHVIALNLTGLDLSGT  77

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            LS D+  LPFL NLS+A N+ SGP+PP +S++S+LR LNLSNN F  TFP
Sbjct  78   LSADIAHLPFLSNLSLATNKFSGPIPPALSSLSSLRLLNLSNNGFNQTFP  127



>ref|XP_004955796.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Setaria italica]
Length=1053

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 71/108 (66%), Gaps = 3/108 (3%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVLS  327
            ++AAL++ KA  + DS   L+SWN STS+C+W  +TC       VV+LDLS   L+G +S
Sbjct  38   DEAALVAFKAKISGDS-GKLSSWNESTSYCSWEGITCSKRYPWRVVALDLSSQGLTGTIS  96

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P VG L FL++L++++N L G +PP I ++S LR L+LS N+     P
Sbjct  97   PAVGNLTFLLSLNLSSNALQGEIPPSIGSLSRLRILDLSENMLNGVIP  144



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +1

Query  202  QSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQ  381
            +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LSPDV  L FL NLS+AAN+
Sbjct  2    KSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLSPDVAFLRFLTNLSLAANE  61

Query  382  LSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             SGP+PPE+S+IS+LR LNLSNN+F  +FP
Sbjct  62   FSGPIPPELSSISSLRLLNLSNNVFDGSFP  91



>ref|XP_008790445.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=1019

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 70/104 (67%), Gaps = 5/104 (5%)
 Frame = +1

Query  172  SIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllh--vvsldlsglNLSGVLSPDVG  339
            S+K+A + D  ++L  WN S    HC+W  V CD+     V+SLDL+GLNLSG L P V 
Sbjct  42   SLKSALS-DPGAALAGWNASAYPDHCSWPGVACDNAPLRRVISLDLTGLNLSGSLPPAVA  100

Query  340  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             L  L+NLS AAN LSGP+PPE+S +  LR LNLSNN+F  +FP
Sbjct  101  HLRHLLNLSAAANLLSGPIPPELSLLFDLRHLNLSNNVFNGSFP  144



>ref|XP_010686227.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Beta vulgaris subsp. vulgaris]
Length=614

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K     D    L  W+I S   CTW  V C +   V+SLD++ + L
Sbjct  24   PKGVNYEVAALMSLKNKMRDDKYHVLDGWDINSVDPCTWYMVACSAEASVISLDMASMGL  83

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L ++S+  NQLSGP+P EI  +  L+ L+LS N F    P
Sbjct  84   SGTLSPSIGNLTHLRSISMQNNQLSGPIPDEIGKLQELQTLDLSGNQFSGEIP  136



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            ++E  +LLS K++ T D Q+ LTSWN  T +C+W  + C    HV+SL+L+ L+L+G LS
Sbjct  25   ISEYHSLLSFKSSITNDPQNILTSWNPKTPYCSWYGIKCSQHRHVISLNLTSLSLTGTLS  84

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
              +  LPFL NLS+A N+ SGP+P  +S++S+LRFLNLSNNIF  T P +
Sbjct  85   --LSNLPFLTNLSLADNKFSGPIPSSLSSLSSLRFLNLSNNIFNGTLPQE  132



>ref|XP_010936307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1007

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 76/110 (69%), Gaps = 5/110 (5%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsl--lhvvsldlsglNLSGV  321
            E+ ALLS+K+A + D  ++L  WN S +  HC+W  V CD      V++LDLSGLNLSG 
Sbjct  33   ERVALLSLKSALS-DPGAALAGWNASANPDHCSWPGVACDDAPLRRVIALDLSGLNLSGS  91

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            L P V  L  L+NLS AAN LSGP+P ++S +S LR+LNLSNN+F  +FP
Sbjct  92   LPPAVAHLRHLLNLSTAANLLSGPIPLDLSLLSDLRYLNLSNNVFNGSFP  141



>gb|EYU26654.1| hypothetical protein MIMGU_mgv1a001213mg [Erythranthe guttata]
Length=864

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T++ ALL+IKA  T D     TSWN S+  C W  VTC      V +L+LS L L G LS
Sbjct  32   TDKLALLAIKAQITHDPNGIFTSWNDSSHFCAWPGVTCGRRHQRVTALNLSSLGLVGTLS  91

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P V  L FL  L++  N   G +PPEI A+  LR LNL+NN F    P
Sbjct  92   PYVSNLTFLTGLNVELNTFHGVIPPEIGALFRLRHLNLTNNSFSGEIP  139



>ref|XP_008370076.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=1053

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            +++ ALL  K   T D Q  ++SWN ST  C WR VTC++    V++L L+  NL G L+
Sbjct  43   SDRLALLDFKKRITEDPQHIMSSWNDSTHFCGWRGVTCNNSNKRVLTLKLNSQNLVGSLT  102

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L +L  +++ +N   G +P EI  + +L +LNLS N FG   P
Sbjct  103  PSIGNLTYLTGINLTSNGFHGEIPQEIGRLRSLEYLNLSYNSFGGKIP  150



>ref|XP_011019593.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Populus euphratica]
 ref|XP_011019594.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Populus euphratica]
Length=971

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 1/107 (1%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  333
            E   LLS K++   D    L++WN+S + C W+ +TC +   +  ++LSG N+SG +S  
Sbjct  36   ELELLLSFKSSLN-DPLKYLSNWNLSATFCKWQGITCTTSSRITVIELSGKNISGKISSS  94

Query  334  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  474
            + QLP++  + +++NQLSG +P ++ + S+LRFLNLSNN F    P+
Sbjct  95   IFQLPYIQTIDLSSNQLSGKLPDDVFSSSSLRFLNLSNNNFTGPIPN  141



>ref|XP_009407942.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=623

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 65/121 (54%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  288
            +AG     P GV  E  AL+ IKA+   D  S L +W+  S   C+W  VTC     VV 
Sbjct  20   AAGTALLSPKGVNFEVQALMGIKASLM-DPHSVLENWDQDSVDPCSWTMVTCSPENLVVG  78

Query  289  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  468
            L     NLSG LSP +G L  L  L +  N +SGP+PPEI  +S L+ ++LSNN F    
Sbjct  79   LATPSQNLSGTLSPSIGNLTNLKILFLQNNNMSGPIPPEIGKLSKLQTIDLSNNYFSGEI  138

Query  469  P  471
            P
Sbjct  139  P  139



>ref|XP_009418700.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Musa acuminata subsp. malaccensis]
Length=993

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 72/111 (65%), Gaps = 1/111 (1%)
 Frame = +1

Query  145  GVTEQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNLSGV  321
            G  +  AL+ +KAA  A   S+L +W+  S  +C++  V CD    VV+L+ +G+ L+G 
Sbjct  24   GDADLEALIKLKAALVAPGSSALGNWDPASADYCSFTGVACDENSRVVALNFTGVQLNGT  83

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  474
            L P++G L  LVNL+++ + + GP+P E++A+ +LR LN+SNN F   FPH
Sbjct  84   LPPEIGILSGLVNLTVSCSGVVGPLPMELAALPSLRLLNVSNNNFSGAFPH  134


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  310  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            ++G + P +G LP L NL++ +NQ+SG +PPEI  +  L  LNLS N      P
Sbjct  465  ITGSIPPAIGSLPALQNLALDSNQISGAIPPEIGQLKQLSKLNLSGNSLSGDIP  518



>emb|CDY63395.1| BnaCnng41990D, partial [Brassica napus]
Length=525

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 63/107 (59%), Gaps = 1/107 (1%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVLSP  330
            ++ ALL IK+  + ++Q  L+SWN S+  C W+ VTC      V+    G   LSG++ P
Sbjct  25   DRKALLDIKSQVSEENQDVLSSWNNSSPLCNWKGVTCGLKHKRVTRLDLGGWQLSGMIPP  84

Query  331  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             +G L FL++L ++ N + G +P E+  +  L++LN+S+N  G   P
Sbjct  85   SIGNLSFLISLDLSENSIGGTIPYEVGNLFRLKYLNMSSNFLGGEIP  131



>ref|NP_001042048.1| Os01g0152800 [Oryza sativa Japonica Group]
 dbj|BAD61117.1| putative protein kinase Xa21 [Oryza sativa Japonica Group]
 dbj|BAD61339.1| putative protein kinase Xa21 [Oryza sativa Japonica Group]
 dbj|BAF03962.1| Os01g0152800 [Oryza sativa Japonica Group]
 dbj|BAG95699.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1051

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 62/108 (57%), Gaps = 2/108 (2%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls--glNLSGVLS  327
            ++A LL+ KAAF   S S+L SWN STS C+W  VTCD         L+    NL+G L 
Sbjct  34   DEATLLAFKAAFRGSSSSALASWNSSTSFCSWEGVTCDRRTPARVAALTLPSGNLAGGLP  93

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL +L++++N+L G +PP +  +  L  L++  N F    P
Sbjct  94   PVIGNLSFLQSLNLSSNELYGEIPPSLGRLRRLEILDIGGNSFSGELP  141



>ref|XP_008812886.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Phoenix dactylifera]
Length=1123

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 60/109 (55%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS--GVL  324
            T++ ALL+ KAA T D   SL SWN S S C W  V+C        + L   +LS  G +
Sbjct  38   TDRFALLAFKAAITHDPTGSLKSWNASASICRWAGVSCSPRDQERVVALVLESLSLGGSI  97

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L FL  L +  N+L G VPP++  +  L+ LNLS+N  G   P
Sbjct  98   SPSIGNLTFLTRLHLPGNRLGGVVPPDVGHLRHLKDLNLSSNSLGGPIP  146



>gb|EAY72573.1| hypothetical protein OsI_00439 [Oryza sativa Indica Group]
Length=1051

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 62/108 (57%), Gaps = 2/108 (2%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls--glNLSGVLS  327
            ++A LL+ KAAF   S S+L SWN STS C+W  VTCD         L+    NL+G L 
Sbjct  34   DEATLLAFKAAFRGSSSSALASWNSSTSFCSWEGVTCDRRTPARVAALTLPSGNLAGGLP  93

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL +L++++N+L G +PP +  +  L  L++  N F    P
Sbjct  94   PVIGNLSFLQSLNLSSNELYGEIPPSLGRLRRLEILDIGGNSFSGELP  141



>ref|XP_010690942.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Beta vulgaris subsp. vulgaris]
Length=1030

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T+Q ALL +K+  T D    ++SWN +   CTW  VTCD + H V++LDL   NL+G++S
Sbjct  29   TDQKALLEMKSKITHDPLGVMSSWNDNLPFCTWHGVTCDRVHHRVIALDLQSSNLTGIIS  88

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL  L I  N L G +PPEI  +  LR + L NN  G   P
Sbjct  89   PYLGNLSFLRELHIENNNLQGTIPPEIGRLHRLRVMWLVNNSIGGKIP  136



>ref|XP_002308597.2| hypothetical protein POPTR_0006s25380g [Populus trichocarpa]
 ref|XP_006382045.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE92120.2| hypothetical protein POPTR_0006s25380g [Populus trichocarpa]
 gb|ERP59842.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=971

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  333
            E   LLS K++   D    L++WN S + C W+ +TC +   +  ++LSG N+SG +S  
Sbjct  36   ELELLLSFKSSLN-DPLKYLSNWNPSATFCKWQGITCTNSSRITVIELSGKNISGKISSS  94

Query  334  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  474
            + QLP++  + +++NQLSG +P +I + S+LRFLNLSNN F    P+
Sbjct  95   IFQLPYIQTIDLSSNQLSGKLPDDIFSSSSLRFLNLSNNNFTGPIPN  141



>gb|AAX93041.1| hypothetical protein LOC_Os11g07260 [Oryza sativa Japonica Group]
 gb|AAX95776.1| Leucine Rich Repeat, putative [Oryza sativa Japonica Group]
 gb|ABA91657.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ17603.1| hypothetical protein OsJ_33142 [Oryza sativa Japonica Group]
Length=1013

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 60/109 (55%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN--LSGVL  324
            T+Q +LL  K A + D Q SL SWN ST++C+W  V+C          L+  N  L G +
Sbjct  30   TDQLSLLEFKKAISLDPQQSLISWNDSTNYCSWEGVSCSLKNPGRVTSLNLTNRALVGHI  89

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L FL  L++  N LSG +PP +  +  L++L LS N    + P
Sbjct  90   SPSLGNLTFLKYLALLKNALSGEIPPSLGHLRRLQYLYLSGNTLQGSIP  138



>emb|CDP10862.1| unnamed protein product [Coffea canephora]
Length=677

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 45/108 (42%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVLS  327
            T++ ALL  K     D    L SWN S  HC W+ VTC +L   V +L L   +LSG +S
Sbjct  43   TDRLALLEFKRQIYDDPFGVLNSWNHSQHHCQWQGVTCSTLHQRVTALTLRDKHLSGTIS  102

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P VG L F+  + +A NQ  G +P E   +  LR LNLS+N  G   P
Sbjct  103  PHVGNLSFMRFIHLAENQFQGEIPKEFGRLFRLRVLNLSSNALGGKIP  150



>ref|NP_001065874.2| Os11g0173800 [Oryza sativa Japonica Group]
 dbj|BAF27719.2| Os11g0173800 [Oryza sativa Japonica Group]
Length=901

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 60/109 (55%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN--LSGVL  324
            T+Q +LL  K A + D Q SL SWN ST++C+W  V+C          L+  N  L G +
Sbjct  30   TDQLSLLEFKKAISLDPQQSLISWNDSTNYCSWEGVSCSLKNPGRVTSLNLTNRALVGHI  89

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L FL  L++  N LSG +PP +  +  L++L LS N    + P
Sbjct  90   SPSLGNLTFLKYLALLKNALSGEIPPSLGHLRRLQYLYLSGNTLQGSIP  138



>ref|XP_009396215.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396224.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 51/121 (42%), Positives = 65/121 (54%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  288
            +A      P GV  E  AL+ IKA+   D  S L +W+  S   C+W  +TC S   VV 
Sbjct  20   AAATAVLSPKGVNYEVQALMGIKASLV-DPHSVLENWDKDSVDPCSWTMITCSSENLVVG  78

Query  289  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  468
            L   G +LSG LSP +G L  L  + +  N +SGPVPPEI  +S L  L+LSNN F    
Sbjct  79   LGTPGQDLSGTLSPSIGNLTNLEIVLLQNNNISGPVPPEIGKLSKLHTLDLSNNKFSGRI  138

Query  469  P  471
            P
Sbjct  139  P  139



>ref|XP_009800500.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Nicotiana 
sylvestris]
Length=1067

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T+  ALL+IKA  T D    LT+WN S   C+W  +TC  L   V  L+L+ L+L G LS
Sbjct  39   TDFQALLAIKAEITNDPYGILTTWNDSVHFCSWTGITCGHLHKRVTKLNLTSLDLVGTLS  98

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL  L++  N   G +PP++  +  L+ LNL+NN F    P
Sbjct  99   PYIGNLTFLTGLNLELNNFHGKIPPQVGGLFRLQHLNLTNNSFSGEIP  146



>ref|XP_008357152.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=837

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 66/102 (65%), Gaps = 0/102 (0%)
 Frame = +1

Query  166  LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  345
            LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33   LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  346  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
              LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP
Sbjct  93   DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFP  134



>gb|AAT64017.1| putative leucine-rich repeat transmembrane protein [Gossypium 
hirsutum]
Length=618

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 69/124 (56%), Gaps = 5/124 (4%)
 Frame = +1

Query  112  HSAGAGAG--KPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllh  279
            HSA  G     P GV  E AAL+S+K     D Q  +  W+I S   CTW  V C +   
Sbjct  20   HSASDGDSLLSPKGVNYEVAALMSVKRELRDDKQV-MDGWDINSVDPCTWNMVACSAEGF  78

Query  280  vvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFG  459
            V+SL+++   LSG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F 
Sbjct  79   VISLEMASTGLSGMLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFV  138

Query  460  STFP  471
               P
Sbjct  139  GAIP  142



>ref|XP_007025341.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY27963.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=614

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 69/121 (57%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  288
            SAG     P GV  E AAL+S+K     D+++ +  W+I S   CTW  V C +   V+S
Sbjct  18   SAGDSLLSPKGVNYEVAALMSVKREMI-DARNVMDGWDINSVDPCTWNMVACSAEGFVIS  76

Query  289  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  468
            L+++   LSG+LSP +G L  L  + +  NQLSGP+P EI   S L+ L+LS N F    
Sbjct  77   LEMASTGLSGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKFSELQTLDLSGNQFVGVI  136

Query  469  P  471
            P
Sbjct  137  P  137



>ref|XP_008364929.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=973

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 66/102 (65%), Gaps = 0/102 (0%)
 Frame = +1

Query  166  LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  345
            LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33   LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  346  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
              LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP
Sbjct  93   DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFP  134



>ref|XP_007025340.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY27962.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=616

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 69/121 (57%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  288
            SAG     P GV  E AAL+S+K     D+++ +  W+I S   CTW  V C +   V+S
Sbjct  18   SAGDSLLSPKGVNYEVAALMSVKREMI-DARNVMDGWDINSVDPCTWNMVACSAEGFVIS  76

Query  289  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  468
            L+++   LSG+LSP +G L  L  + +  NQLSGP+P EI   S L+ L+LS N F    
Sbjct  77   LEMASTGLSGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKFSELQTLDLSGNQFVGVI  136

Query  469  P  471
            P
Sbjct  137  P  137



>ref|XP_009409349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Musa acuminata subsp. malaccensis]
Length=1229

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 62/111 (56%), Gaps = 4/111 (4%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSH-CTWRRVTCdsllhvvsldlsglN---LSG  318
            T++ ALLS KA  + D   +L SWN ++ H C WR VTC +    + +    L    L+G
Sbjct  40   TDRLALLSFKALISDDPSRALESWNTTSLHFCRWRGVTCGNHSGQLRVTTLELESLALAG  99

Query  319  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             +SP +  L FL  L +  NQL GPVP E+  +S L+ LNLS N F  T P
Sbjct  100  KISPSIANLTFLQRLHLPQNQLQGPVPQELGLLSRLQHLNLSYNSFRGTVP  150



>ref|XP_009396449.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = +1

Query  190  TADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVN  360
             +D   +L++WN S S  HC+W  V CD     VVSLDL+G NLSG LS  V +L  L+N
Sbjct  43   VSDPSDALSAWNNSASGGHCSWPGVACDPLRGFVVSLDLTGFNLSGTLSLAVVRLRHLLN  102

Query  361  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            LS A+N LSGP+P E+S +S LR LNLSNN+F  +FP
Sbjct  103  LSAASNSLSGPIPAELSRLSNLRHLNLSNNLFNGSFP  139



>ref|XP_010026766.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=985

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 58/109 (53%), Gaps = 1/109 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVL  324
            +T++ ALL+ KA  T D   +L SWN +T HC W  V C  L   V+      L LSG +
Sbjct  1    MTDKLALLAFKATITEDPFGALNSWNHTTDHCQWHGVMCGHLHRRVTGLNLPSLKLSGSI  60

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L FL  L +  N     +P E+S + +LRFL LSNN      P
Sbjct  61   SPHIGNLSFLRTLMLKNNSFHHKIPQEVSHLHSLRFLLLSNNTLDGEIP  109



>ref|XP_010065839.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=1017

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  324
            T+Q AL S K A   D    L+SWN ST HC W+ V C       V SL L    L G L
Sbjct  31   TDQLALASFKNAIHEDPFGVLSSWNDSTHHCEWQGVLCSKRYPWRVTSLVLRSQGLKGFL  90

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP VG L FL  + +  N   G +PP+I  +  LR L LSNN FG   P
Sbjct  91   SPQVGNLSFLRVIILQNNSFHGEIPPQIGNLLQLRVLVLSNNSFGGPIP  139



>ref|XP_009337767.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Pyrus x bretschneideri]
Length=1019

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T++ ALL IKA  T D   +LTSWN +   C WR VTC      V  L+L   NLSG LS
Sbjct  35   TDRLALLEIKARITYDPVEALTSWNETNHFCNWRGVTCGRRHKRVTVLNLQSFNLSGSLS  94

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P VG L FL  LS+  N LS  +PPEI  +S L+ +   NN      P
Sbjct  95   PHVGNLSFLRVLSLTNNNLSHKIPPEIGRLSRLQDMVWENNSLTGEIP  142



>gb|KCW74133.1| hypothetical protein EUGRSUZ_E02764 [Eucalyptus grandis]
Length=629

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K+    D    L  W+I S   CTW  V C +   V+ LD+    L
Sbjct  27   PKGVNYEVAALMSVKSKMM-DELHVLEGWDINSVDPCTWNMVACSADGFVLYLDMGSAGL  85

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG+LSP +G L  L  L +  NQLSGP+P EI  +S L+ L+LS N F    P
Sbjct  86   SGMLSPSIGNLSHLRTLLLQNNQLSGPIPAEIGKLSELQTLDLSGNQFSGHIP  138



>gb|EEC67765.1| hypothetical protein OsI_35299 [Oryza sativa Indica Group]
Length=801

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 59/109 (54%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN--LSGVL  324
            T+Q +LL  K A + D Q SL  WN ST++C+W  V+C          L+  N  L G +
Sbjct  108  TDQLSLLEFKKAISLDPQQSLMYWNDSTNYCSWEGVSCSLKNPGRVTSLNLTNRALVGHI  167

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L FL  L++  N LSG +PP +  +  L++L LS N    + P
Sbjct  168  SPSLGNLTFLKYLALPKNALSGEIPPSLGHLRRLQYLYLSGNTLQGSIP  216



>gb|KCW60108.1| hypothetical protein EUGRSUZ_H02842, partial [Eucalyptus grandis]
Length=940

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 58/109 (53%), Gaps = 1/109 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVL  324
            +T++ ALL+ KA  T D   +L SWN +T HC W  V C  L   V+      L LSG +
Sbjct  1    MTDKLALLAFKATITEDPFGALNSWNHTTDHCQWHGVMCGHLHRRVTGLNLPSLKLSGSI  60

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L FL  L +  N     +P E+S + +LRFL LSNN      P
Sbjct  61   SPHIGNLSFLRTLMLKNNSFHHKIPQEVSHLHSLRFLLLSNNTLDGEIP  109



>ref|XP_011083584.1| PREDICTED: receptor protein kinase CLAVATA1 [Sesamum indicum]
Length=974

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 72/114 (63%), Gaps = 5/114 (4%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTS-----HCTWRRVTCdsllhvvsldlsglNLS  315
            ++   LL +K++    S S L  W    S     HC++  VTCD+   V SL+++ + L 
Sbjct  23   SDLETLLKLKSSLVGPSASGLHDWAAPPSPSSSAHCSFSGVTCDADARVTSLNVANVPLF  82

Query  316  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            G L P++G L  LVNL++A N++SGP+P E+S +++L+++NLS+N+F  T P +
Sbjct  83   GTLPPEIGLLDKLVNLTLAGNKISGPLPVEMSNLTSLKYVNLSSNVFNGTLPGE  136



>ref|XP_009618942.1| PREDICTED: putative receptor-like protein kinase At3g47110 isoform 
X2 [Nicotiana tomentosiformis]
Length=1031

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T+  ALL+IKA  T D     T+WN S   C+W  +TC  L   V +L+L+ L+L G LS
Sbjct  39   TDFQALLAIKAEITKDPYGIFTTWNDSVHFCSWTGITCGHLHKRVTNLNLTSLDLVGTLS  98

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL  L++  N   G +PP++  +  L+ LNL+NN F    P
Sbjct  99   PYIGNLTFLTGLNLELNNFHGKIPPQVGGLFRLQHLNLTNNSFSGEIP  146



>ref|XP_010533421.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Tarenaya 
hassleriana]
Length=1017

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSH-CTWRRVTCdsllhvvsld-lsglNLSGVL  324
            +++ ALL  K+  +  S+++L SWN  + H C W  VTC      V+   L  + L+GV+
Sbjct  22   SDKEALLEFKSQLSRGSRAALASWNGGSLHLCNWTGVTCGRKHQRVTQLRLISMKLAGVI  81

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP VG L FL +L +  N   G +P E+  +S LR+LN+S+N+ G   P
Sbjct  82   SPSVGNLSFLRSLDLGGNSFHGNIPQEVGKLSRLRYLNMSSNLLGGGIP  130



>ref|XP_009107554.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Brassica rapa]
Length=638

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 63/110 (57%), Gaps = 1/110 (1%)
 Frame = +1

Query  145  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGV  321
            G T++ ALL +K+  + D Q+ L+SWN S   C W+ VTC      V+    G   L GV
Sbjct  10   GETDRIALLDLKSQVSEDKQNVLSSWNNSFPLCNWKGVTCGLKHKRVTRLDLGGWQLGGV  69

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            +SP +G L FL++L ++ N + G +P ++  +  L +L++S+N  G   P
Sbjct  70   ISPSIGNLSFLISLDLSDNSIGGTIPHQVGNLFRLEYLDMSHNFLGGGIP  119



>ref|XP_009618941.1| PREDICTED: putative receptor-like protein kinase At3g47110 isoform 
X1 [Nicotiana tomentosiformis]
Length=1066

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T+  ALL+IKA  T D     T+WN S   C+W  +TC  L   V +L+L+ L+L G LS
Sbjct  39   TDFQALLAIKAEITKDPYGIFTTWNDSVHFCSWTGITCGHLHKRVTNLNLTSLDLVGTLS  98

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL  L++  N   G +PP++  +  L+ LNL+NN F    P
Sbjct  99   PYIGNLTFLTGLNLELNNFHGKIPPQVGGLFRLQHLNLTNNSFSGEIP  146



>ref|XP_008791706.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Phoenix 
dactylifera]
Length=994

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            +T+Q ALLS K   T+D    L+SWN ST+ C W RV C++   V +LDL GL LSG +S
Sbjct  18   ITDQEALLSFKTLITSDPSDVLSSWNDSTTVCQWSRVLCNNKRRVSTLDLKGLGLSGSIS  77

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L  L  L +  N  +G +P ++  ++ L+ LN S+N+ G   P
Sbjct  78   PHIGNLSALQFLYLQDNHFTGDLPDQLGNLARLQILNASSNLIGGAIP  125



>ref|XP_010269666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Nelumbo nucifera]
Length=976

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T++ ALL  K   T D   +L+SWN ST  C WR VTC      V++L+L   +L G++S
Sbjct  36   TDRLALLEFKEMITEDPLGALSSWNYSTHFCQWRGVTCSRRHQRVIALNLESQSLVGIVS  95

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL  +++  N   G +P EI  +  LR L LSNN F    P
Sbjct  96   PHIGNLSFLRTITLQNNSFHGKIPQEIGRLFRLRSLTLSNNSFQGNIP  143



>ref|XP_007151443.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
 gb|ESW23437.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
Length=626

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 64/113 (57%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E  AL+ IKA F  D    L +W+  +   C+W  VTC     V+SL +   NL
Sbjct  29   PKGVNFEVQALMGIKA-FLVDPHGILDNWDGDAVDPCSWNMVTCSPENLVISLGIPSQNL  87

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG+LSP +G L +L  + +  N ++GP+P EI  +S L+ L+LS+N F    P
Sbjct  88   SGILSPSIGNLTYLQTVVLQNNNITGPIPSEIGKLSKLQTLDLSDNFFNGEIP  140



>ref|XP_008797566.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 61/113 (54%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E  AL+ IKA F  D  + L +W+  S   C+W  VTC S   V +L     NL
Sbjct  28   PKGVNFEVQALMGIKA-FLKDPHNVLENWDKDSVDPCSWTMVTCSSQKLVTTLGTPSQNL  86

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  + +  N +SGP+P EI  +S LR L LSNN F    P
Sbjct  87   SGTLSPSIGNLTNLETVLLQNNNISGPLPAEIGRLSKLRTLELSNNYFSGEIP  139



>gb|AHJ14779.1| CLAVATA1 [Rhododendron ovatum]
Length=992

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 59/107 (55%), Gaps = 3/107 (3%)
 Frame = +1

Query  166  LLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsgl-NLSGVLSPDV  336
            LLS+K AF     S LTSWN+S   S CTW  + CD+    +        N+SG L P +
Sbjct  41   LLSLKQAFEPPEDSCLTSWNVSNYNSLCTWTGIKCDAKNTSILSLDISNYNISGYLLPAI  100

Query  337  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
              +  LVNLS++ N LSG  P +I  +  L+FLN+SNN F  +   Q
Sbjct  101  SDIHTLVNLSVSGNSLSGTFPVDIHKLVRLQFLNISNNQFNGSLNWQ  147


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  310  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            L G + P++G L  L  L +  NQLSG +PPE++ ++TL+  +LSNN+     P
Sbjct  261  LKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANLTTLKSFDLSNNVLTGEIP  314



>emb|CDY26403.1| BnaA02g23670D [Brassica napus]
Length=781

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 65/108 (60%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVLS  327
            T++ ALLS ++  + + QS   SW+ +TS C W  VTCD+ +  V+      + LSG +S
Sbjct  31   TDREALLSFESQMSQNPQSLSFSWDPNTSPCNWTGVTCDTRIRRVASINLSGHGLSGSIS  90

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL +L +  NQL GP+P EI+ +  LR LNLS+N    + P
Sbjct  91   PSIGNLSFLTSLQLQNNQLRGPIPKEITNLFRLRVLNLSSNSLDGSLP  138



>ref|XP_007026751.1| LRR receptor-like serine/threonine-protein kinase, putative [Theobroma 
cacao]
 gb|EOY07253.1| LRR receptor-like serine/threonine-protein kinase, putative [Theobroma 
cacao]
Length=1054

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T++ ALL+IKA  T D     +SWN S   C W  V C      V++L+LS  +L G LS
Sbjct  51   TDRLALLAIKAQLTQDPLGLTSSWNDSLHFCNWSGVICGHGHQRVITLNLSYHDLVGSLS  110

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P VG L FL  +S+  N   G +PPE+  +S LR+LN SNN      P
Sbjct  111  PYVGNLTFLRGISLEQNYFHGEIPPEVGRLSGLRYLNFSNNSLSGEIP  158



>gb|ACD56664.1| putative leucine-rich repeat transmembrane protein [Gossypium 
arboreum]
 gb|KHG23954.1| hypothetical protein F383_02006 [Gossypium arboreum]
Length=618

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K     D Q  +  W+I S   CTW  V C +   V+SL+++   L
Sbjct  31   PKGVNYEVAALMSVKRELRDDKQV-MDGWDINSVDPCTWNMVACSAEGFVISLEMASTGL  89

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F    P
Sbjct  90   SGMLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFVGAIP  142



>ref|XP_010266811.1| PREDICTED: receptor protein kinase CLAVATA1 [Nelumbo nucifera]
 ref|XP_010266812.1| PREDICTED: receptor protein kinase CLAVATA1 [Nelumbo nucifera]
Length=979

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 69/111 (62%), Gaps = 3/111 (3%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  321
            T+  ALL +K A      S L  WN+S+S   HC +  V+CD    VV+L++S + L G 
Sbjct  25   TDLDALLKLKTAMIGRRGSGLDDWNVSSSRNSHCLFSGVSCDENSRVVALNVSYVPLFGT  84

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  474
            +SP++G L  LVNL+++ N L+G +P EI+ +++L+ LN+SNN F    P 
Sbjct  85   VSPEIGLLNKLVNLTLSCNNLTGKLPEEIANLTSLKLLNISNNAFVGGVPE  135



>ref|XP_007017845.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY15070.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=982

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 68/114 (60%), Gaps = 3/114 (3%)
 Frame = +1

Query  145  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  315
            G ++   LL +K++      S L  W  S+S   HC +  V CD   HVVSL+ S   LS
Sbjct  25   GYSDLEVLLKLKSSMIGPKGSGLEDWEFSSSPSAHCHFSGVQCDEEFHVVSLNASFAPLS  84

Query  316  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            G + P++G L  LVNL+IAA  L+G +P E+  +++L+  N+SNN+F  +FP +
Sbjct  85   GTIPPEIGLLNKLVNLTIAAANLTGKIPVEMGNLTSLKLFNISNNVFKGSFPGE  138



>ref|XP_010654174.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Vitis 
vinifera]
Length=1048

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T++ ALL+IKA  T D     TSWN S   C W  VTC      V +L+L+ L+L G LS
Sbjct  47   TDRLALLAIKAQITQDPLGITTSWNDSVHFCNWTGVTCGHRHQRVNTLNLNSLHLVGSLS  106

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL  L++  N   G +P E+  +S LR LNL+NN F    P
Sbjct  107  PSIGNLTFLTGLNLELNNFHGQIPQELGRLSRLRALNLTNNSFSGEIP  154



>emb|CDY02555.1| BnaA08g01620D [Brassica napus]
Length=160

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = +1

Query  145  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC-dsllhvvsldlsglNLSGV  321
            G T++ ALL +K+  + D Q+ L+SWN S   C W+ VTC      V  LDL GL L GV
Sbjct  22   GETDRMALLDLKSQVSEDKQNVLSSWNNSFPLCNWKGVTCGLKHKRVTRLDLGGLQLGGV  81

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            +SP +G L FL++L ++ N + G +P ++  +  L +L++S+N  G   P
Sbjct  82   ISPSIGNLSFLISLDLSDNSIGGTIPHQVGNLFRLEYLDMSHNFLGGGIP  131



>emb|CAN83822.1| hypothetical protein VITISV_030954 [Vitis vinifera]
Length=1904

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T++ ALL+IKA  T D     TSWN S   C W  VTC      V +L+LS L+L G LS
Sbjct  70   TDRLALLAIKAQITQDPLGITTSWNDSVHFCNWTGVTCGHRHQRVNTLNLSSLHLVGSLS  129

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL  L++  N   G +P E+  +S LR LNL+NN F    P
Sbjct  130  PSIGNLTFLTGLNLELNNFHGQIPQELGRLSRLRALNLTNNSFSGEIP  177



>ref|XP_010910648.1| PREDICTED: putative receptor-like protein kinase At3g47110, partial 
[Elaeis guineensis]
Length=383

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 68/107 (64%), Gaps = 4/107 (4%)
 Frame = +1

Query  163  ALLSIKA-AFTADSQSSLTSWNISTSHCTWRRVTCdsllh---vvsldlsglNLSGVLSP  330
            ALLSIKA  + ++S SS  S N +  +C W  V C SL +   V +LDL  LNL+G +SP
Sbjct  9    ALLSIKAHLYPSESLSSWGSKNQTVHYCKWLGVKCGSLQYPKRVTALDLDSLNLTGKISP  68

Query  331  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            D+G L FL  L+++ NQL G +P E+  +S L+FLNL +N  G T P
Sbjct  69   DIGNLTFLQKLNLSGNQLQGYIPQELGRLSNLQFLNLMDNALGGTIP  115



>ref|XP_008811184.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=635

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 67/121 (55%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvs  288
            ++ AG   P GV  E  AL+ IKA+   D  S L +W+  S   C+W  VTC     V+S
Sbjct  31   ASAAGLLSPKGVNFEVQALMGIKASLK-DPHSVLENWDRDSVDPCSWAMVTCSPENLVIS  89

Query  289  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  468
            L +   NLSG LS  +G L  L  + +  N +SGP+PPEI  +S L+ L+LSNN F    
Sbjct  90   LGIPSQNLSGTLSSSIGNLTNLETVLLQNNNISGPIPPEIGKLSKLKTLDLSNNYFTGGI  149

Query  469  P  471
            P
Sbjct  150  P  150



>ref|XP_006645505.1| PREDICTED: putative receptor-like protein kinase At3g47110-like 
[Oryza brachyantha]
Length=1039

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 65/118 (55%), Gaps = 5/118 (4%)
 Frame = +1

Query  124  AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-  300
            AG G     +++A LL+ KA F+  S  +L SWN ST  C W  VTCD  +      LS 
Sbjct  16   AGGGSS---SDEATLLAFKAGFSEGSSGALASWNSSTGFCRWEGVTCDRRMPTRVAALSL  72

Query  301  -glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
               NL+G LSP VG L FL  L++++N L G +P  +  +  L+ L+L +N F   FP
Sbjct  73   PSSNLAGTLSPAVGNLTFLRWLNLSSNALHGEIPSSLGRLRRLQVLDLGSNSFSGAFP  130



>ref|XP_010257839.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Nelumbo nucifera]
Length=624

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 60/113 (53%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E  AL+ IKA+   D    L +W+  S   C+W  VTC     V  L     NL
Sbjct  28   PKGVNFEVQALMGIKASL-VDPHGVLDNWDGDSVDPCSWTMVTCSPQSLVTGLGTPSQNL  86

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  + +  N +SGP+PPE+  +S LR L+LSNN F    P
Sbjct  87   SGTLSPSIGNLTNLQIVLLQNNNISGPLPPELGRLSKLRTLDLSNNFFSGEIP  139



>gb|EAY80122.1| hypothetical protein OsI_35294 [Oryza sativa Indica Group]
Length=1007

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  324
            T++ ALL  K A T D Q SL SWN S   C+W  V+C S     V S+DLS  NL+G +
Sbjct  31   TDRLALLEFKNAITHDPQKSLMSWNDSNHLCSWEGVSCSSKNPPRVTSIDLSNQNLAGNI  90

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L FL +LS+A N+ +G +P  +  +  LR L LSNN      P
Sbjct  91   SPSLGNLTFLKHLSLATNEFTGRIPESLGHLRRLRSLYLSNNTLQGIIP  139



>ref|XP_010905760.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=635

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 64/113 (57%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E  AL+ IK +   D  S L +W+  S   C+W  VTC S   V+SL +   NL
Sbjct  39   PKGVNFEVQALMYIKDSLK-DPHSVLENWDRDSVDPCSWAMVTCSSENLVISLGIPSQNL  97

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  + +  N +SGP+PPEI  +S L+ L+LSNN F    P
Sbjct  98   SGTLSPSIGNLTNLETVLLQNNNISGPIPPEIGKLSKLKTLDLSNNYFTGGIP  150



>ref|XP_006358680.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Solanum tuberosum]
Length=1023

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVL  324
            +T+  AL +IK     D   SL+SWN S   C WR V C +    V       + L+GVL
Sbjct  1    MTDIEALFAIKNEII-DPFESLSSWNESVPLCQWRGVVCGTRNQRVIELNLLDHKLAGVL  59

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP VG L FL+ L +  N +SG +PPE+  ++ LR L L NN F    P
Sbjct  60   SPFVGNLSFLIRLDVGNNTISGNIPPELGRLTRLRHLYLQNNSFYGEIP  108



>ref|XP_010925613.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X2 [Elaeis guineensis]
Length=504

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K+    D   ++  W+I S   CTW  V C     V+SL+++   L
Sbjct  30   PKGVNYEVAALMSVKSKMW-DEAGAMDGWDINSVDPCTWSMVGCSPDGFVISLEMARNGL  88

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  + +  N++SGP+PPEI  +S LR L+LS N F    P
Sbjct  89   SGTLSPSIGNLSHLQTMLLQNNKISGPIPPEIGKLSQLRTLDLSGNQFIGEIP  141



>gb|EEE51731.1| hypothetical protein OsJ_33139 [Oryza sativa Japonica Group]
Length=2393

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  324
            T++ ALL  K A T D Q SL SWN S   C+W  V+C S     V S+DLS  NL+G +
Sbjct  31   TDRLALLEFKNAITHDPQKSLMSWNDSNHLCSWEGVSCSSKNPPRVTSIDLSNQNLAGNI  90

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L FL +LS+A N+ +G +P  +  +  LR L LSNN      P
Sbjct  91   SPSLGNLTFLKHLSLATNEFTGRIPESLGHLRRLRSLYLSNNTLQGIIP  139


 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +1

Query  151   TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN--LSGVL  324
             T++ +LL  K A + D Q +L SWN ST  C+W  V+C          L   N  L G++
Sbjct  1411  TDRLSLLQFKQAISLDPQHALLSWNDSTHFCSWEGVSCSLRYPRRVTSLDLSNRGLVGLI  1470

Query  325   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             SP +G L  L +L +  NQLSG +PP +  +  LR L L+NN      P
Sbjct  1471  SPSLGNLTSLEHLFLNTNQLSGQIPPSLGHLHHLRSLYLANNTLQGNIP  1519



>ref|XP_009400102.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 58/112 (52%), Gaps = 1/112 (1%)
 Frame = +1

Query  139  PLGVTEQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNLS  315
            P GV  +  +L    A+  D    L +W+  S   C+W  VTC     V+ L     NLS
Sbjct  31   PKGVNFEVQVLMGIKAYLVDPHGVLENWDQDSVDPCSWTMVTCSPENSVIGLATPSQNLS  90

Query  316  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            G L+P +G L  L  L +  N LSGPVPPEI  +S L+ ++LSNN F    P
Sbjct  91   GTLNPSIGNLTNLQILFLQNNNLSGPVPPEIGKLSKLQTVDLSNNYFSGKIP  142



>ref|XP_009400110.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=624

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 58/112 (52%), Gaps = 1/112 (1%)
 Frame = +1

Query  139  PLGVTEQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNLS  315
            P GV  +  +L    A+  D    L +W+  S   C+W  VTC     V+ L     NLS
Sbjct  31   PKGVNFEVQVLMGIKAYLVDPHGVLENWDQDSVDPCSWTMVTCSPENSVIGLATPSQNLS  90

Query  316  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            G L+P +G L  L  L +  N LSGPVPPEI  +S L+ ++LSNN F    P
Sbjct  91   GTLNPSIGNLTNLQILFLQNNNLSGPVPPEIGKLSKLQTVDLSNNYFSGKIP  142



>gb|ADB85326.1| putative receptor protein kinase [Phyllostachys edulis]
Length=265

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 59/94 (63%), Gaps = 1/94 (1%)
 Frame = +1

Query  193  ADSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSI  369
            +D   +L SW N + SHC W  VTC +   VV LD++GLNLSG L P + +L  L  LS+
Sbjct  36   SDPTGALASWANGTASHCAWAGVTCSTRGTVVGLDVAGLNLSGALPPALSRLRGLFRLSV  95

Query  370  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            AAN  SGP+P  ++ +  L  LNLSNN F  +FP
Sbjct  96   AANAFSGPIPASLARLQFLVHLNLSNNAFDGSFP  129



>ref|XP_010925612.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Elaeis guineensis]
Length=616

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K+    D   ++  W+I S   CTW  V C     V+SL+++   L
Sbjct  30   PKGVNYEVAALMSVKSKMW-DEAGAMDGWDINSVDPCTWSMVGCSPDGFVISLEMARNGL  88

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  + +  N++SGP+PPEI  +S LR L+LS N F    P
Sbjct  89   SGTLSPSIGNLSHLQTMLLQNNKISGPIPPEIGKLSQLRTLDLSGNQFIGEIP  141



>gb|AAX93038.1| hypothetical protein LOC_Os11g07230 [Oryza sativa Japonica Group]
Length=2207

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  324
            T++ ALL  K A T D Q SL SWN S   C+W  V+C S     V S+DLS  NL+G +
Sbjct  31   TDRLALLEFKNAITHDPQKSLMSWNDSNHLCSWEGVSCSSKNPPRVTSIDLSNQNLAGNI  90

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L FL +LS+A N+ +G +P  +  +  LR L LSNN      P
Sbjct  91   SPSLGNLTFLKHLSLATNEFTGRIPESLGHLRRLRSLYLSNNTLQGIIP  139


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +1

Query  151   TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN--LSGVL  324
             T++ +LL  K A + D Q +L SWN ST  C+W  V+C          L   N  L G++
Sbjct  1314  TDRLSLLQFKQAISLDPQHALLSWNDSTHFCSWEGVSCSLRYPRRVTSLDLSNRGLVGLI  1373

Query  325   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             SP +G L  L +L +  NQLSG +PP +  +  LR L L+NN      P
Sbjct  1374  SPSLGNLTSLEHLFLNTNQLSGQIPPSLGHLHHLRSLYLANNTLQGNIP  1422



>ref|XP_010068376.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=1011

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  324
            T+  AL S K A   D    L+SWN ST HC W+ V C       V SL L    L G L
Sbjct  31   TDWLALASFKNAIHEDPFGVLSSWNDSTHHCEWQGVLCSKRHPGRVTSLFLRSQGLGGFL  90

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L FL  + +  N   G +PP+I  +  LR+L+L+NN FG   P
Sbjct  91   SPHIGNLSFLRVMRLQNNSFYGEIPPQIGNLLRLRYLDLTNNSFGGPIP  139



>ref|XP_007016127.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY33746.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
Length=1055

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 60/107 (56%), Gaps = 2/107 (2%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC-dsllhvvsldlsglNLSGVLSP  330
            ++ ALL+IK+    D     +SWN S S C WR VTC      V  LDL   NL G LSP
Sbjct  55   DRQALLAIKSQI-HDPLGVTSSWNNSVSLCRWRGVTCGRKNQRVTQLDLKNQNLRGSLSP  113

Query  331  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             +G L FL  + +  N LSG +PPEI  +S L+ L L NN FG T P
Sbjct  114  YIGNLSFLRFIDLRHNLLSGGIPPEIGRLSRLKILMLRNNSFGGTLP  160



>ref|XP_009377741.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Pyrus x bretschneideri]
 ref|XP_009377742.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Pyrus x bretschneideri]
Length=1043

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 63/108 (58%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC-dsllhvvsldlsglNLSGVLS  327
            +++ ALL +K   T D  + ++SWN S   C W  V+C  S   V+ L+L    L G +S
Sbjct  44   SDRLALLDLKKRITVDPFNVMSSWNHSIHFCNWVGVSCHRSTKRVLMLNLKSKKLVGSIS  103

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P VG L +L  +++  N+  G +PPE+  + +L++LNLS+N FG   P
Sbjct  104  PSVGNLTYLTGINLRDNKFHGEIPPEMGRLQSLQYLNLSHNSFGGKIP  151



>gb|EMT21473.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=1048

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 70/127 (55%), Gaps = 6/127 (5%)
 Frame = +1

Query  112  HSAGAGAGKPLG---VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCds---l  273
            H AG G    LG    T+  +LL  K A T D   +L+SWN ST+ C W+ VTC +    
Sbjct  13   HIAGKGDCVVLGWNDNTDLHSLLEFKQAITKDPTRALSSWNRSTNFCRWKGVTCSADRPK  72

Query  274  lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI  453
             HV+ L+L+  +L G +SP +G L +LV ++ + N  SG +PP    +  L+ L+LSNN+
Sbjct  73   RHVMKLELAAQSLVGHISPSLGNLTYLVTINFSTNSFSGNLPPLFHRLQNLQILDLSNNL  132

Query  454  FGSTFPH  474
                 P 
Sbjct  133  LHGVIPQ  139



>ref|XP_008371495.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Malus domestica]
 ref|XP_008345920.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Malus domestica]
Length=625

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K     D    +  W+I S   CTW  V C +   V+SL +   NL
Sbjct  32   PKGVNFEVAALMSVKRDM-KDELPVMAGWDINSVDPCTWNMVGCSTEGFVISLAMVSTNL  90

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG+LSP +G L  L  L +  NQLSGP+P EI  +S L+ L+LS N F    P
Sbjct  91   SGMLSPSIGNLSHLQTLLLQNNQLSGPIPAEIGWLSELQTLDLSGNQFSGDIP  143



>ref|XP_008371496.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X2 [Malus domestica]
 ref|XP_008345921.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X2 [Malus domestica]
Length=623

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K     D    +  W+I S   CTW  V C +   V+SL +   NL
Sbjct  32   PKGVNFEVAALMSVKRDM-KDELPVMAGWDINSVDPCTWNMVGCSTEGFVISLAMVSTNL  90

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG+LSP +G L  L  L +  NQLSGP+P EI  +S L+ L+LS N F    P
Sbjct  91   SGMLSPSIGNLSHLQTLLLQNNQLSGPIPAEIGWLSELQTLDLSGNQFSGDIP  143



>ref|XP_010929457.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 60/113 (53%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E  AL+ IKA F  D  + L +W+  S   C+W  VTC     V  L     NL
Sbjct  28   PKGVNFEVQALMGIKA-FLKDPHNVLENWDKDSVDPCSWTMVTCSPQNLVTGLGTPSQNL  86

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  + +  N +SGP+P EI  +S LR L+LSNN F    P
Sbjct  87   SGTLSPSIGNLTNLEIVLLQNNNISGPLPAEIGKLSRLRTLDLSNNYFSGEIP  139



>ref|XP_011470626.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Fragaria vesca subsp. vesca]
Length=371

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 53/108 (49%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVLS  327
            T+  ALL  K +  AD Q  L SWN S   C W+ VTC      V+       NL G +S
Sbjct  32   TDHLALLKFKESIVADPQGFLNSWNDSVHFCKWQGVTCGIRHQRVTALNLPHSNLHGTIS  91

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL    I  N LSG +P ++  +  LR LNLS NI     P
Sbjct  92   PYIGNLSFLRTFYIPNNSLSGKIPQQVDRLFRLRHLNLSLNILEGGIP  139



>ref|XP_007012155.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Theobroma cacao]
 gb|EOY29774.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Theobroma cacao]
Length=970

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 69/107 (64%), Gaps = 2/107 (2%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-SP  330
            E   LLS K++   D    L+ W+ S + C W  +TC++L HV ++DLS  NLSG L SP
Sbjct  31   ELELLLSFKSSI-HDPSGFLSKWDSSATFCQWLGITCNNLSHVDTVDLSAKNLSGKLVSP  89

Query  331  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             + QLP++  L++++NQL G +P +I + S+LRFLNLSNN F    P
Sbjct  90   SIFQLPYIQTLNLSSNQLDGEIPLDIFSSSSLRFLNLSNNNFTGQIP  136



>dbj|BAH20868.1| putative LRR-kinase protein [Oryza sativa Japonica Group]
 dbj|BAH20869.1| putative LRR-kinase protein [Oryza sativa Japonica Group]
Length=1052

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVL  324
            +++ ALL++KA  +    S+L SWN S S C W  VTC       V +LDL   NL+G L
Sbjct  25   SDEPALLALKAGLSGSISSALASWNTSASFCGWEGVTCSRRWPTRVAALDLPSSNLTGTL  84

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             P VG L FL  L++++NQL G +PP +  +  L  L++ +N F    P
Sbjct  85   PPAVGNLTFLRRLNLSSNQLHGEIPPAVGRLRRLLVLDMDHNSFSGAIP  133



>ref|XP_004979517.1| PREDICTED: putative receptor-like protein kinase At3g47110-like 
[Setaria italica]
Length=1040

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 66/108 (61%), Gaps = 3/108 (3%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVLS  327
            ++ ALLS K+  +  S + L SWN ST++CTW  V C     + VVSL ++  NLSG +S
Sbjct  34   DELALLSFKSMLSGPS-ALLASWNTSTNYCTWPGVACSRRPPVRVVSLLMNSFNLSGKIS  92

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P VG L FL  L++  NQL G +PPE+  ++ L+ LNLS N    + P
Sbjct  93   PFVGNLSFLEKLNLGNNQLIGEIPPELGRLAKLQLLNLSANSLEGSIP  140



>ref|XP_006382044.1| hypothetical protein POPTR_0006s25380g [Populus trichocarpa]
 gb|ERP59841.1| hypothetical protein POPTR_0006s25380g [Populus trichocarpa]
Length=945

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  196  DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAA  375
            D    L++WN S + C W+ +TC +   +  ++LSG N+SG +S  + QLP++  + +++
Sbjct  37   DPLKYLSNWNPSATFCKWQGITCTNSSRITVIELSGKNISGKISSSIFQLPYIQTIDLSS  96

Query  376  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  474
            NQLSG +P +I + S+LRFLNLSNN F    P+
Sbjct  97   NQLSGKLPDDIFSSSSLRFLNLSNNNFTGPIPN  129



>emb|CDP19927.1| unnamed protein product [Coffea canephora]
Length=895

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 52/108 (48%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVLS  327
            T++ ALL  K     D    L SWN S  HC W  VTC +    V        +LSG +S
Sbjct  38   TDRLALLEFKNQIYDDPSGVLNSWNHSQHHCRWEGVTCGTRHQRVMALTLRDKHLSGTIS  97

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P VG L F+  + +  NQ  G VP E   +  LR LNLS+N  G   P
Sbjct  98   PHVGNLSFMRFIQLGKNQFHGEVPQEFGRLFRLRVLNLSSNAIGGKIP  145



>ref|XP_009131797.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Brassica rapa]
Length=1032

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 64/109 (59%), Gaps = 1/109 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T+  ALL  K+  T + +  L SWN S+  CTW  VTC+     V SL+L G  L+GV+S
Sbjct  31   TDMKALLEFKSQATVNRREVLASWNNSSPLCTWIGVTCNRRRERVTSLNLGGFKLAGVIS  90

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  474
            P +G L FL++L++  N   G +P E+  +  L++LN+S N+     PH
Sbjct  91   PSIGNLSFLISLNLGDNSFVGTIPQEVGMLFRLQYLNMSFNLLEGKIPH  139



>ref|XP_009391273.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 65/120 (54%), Gaps = 3/120 (3%)
 Frame = +1

Query  118  AGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsl  291
            + AG   P GV  E  AL+ +KA+   D  S L +W+  S   C+W  VTC     V+ L
Sbjct  42   SAAGVLSPKGVNYEVQALMGVKASL-KDPHSVLENWDQDSVDPCSWTMVTCSPENLVIGL  100

Query  292  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
                 NLSG LSP +G L  L  + +  N +SGP+P EI+ +S L+ L+LSNN F    P
Sbjct  101  GTPSQNLSGTLSPSIGNLTNLQIILLQNNNISGPIPQEIARLSNLKTLDLSNNNFNGEIP  160



>ref|XP_009351465.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Pyrus x bretschneideri]
Length=625

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K     D    +  W+I S   CTW  V C +   V+SL +   NL
Sbjct  32   PKGVNFEVAALMSVKRDM-KDELLVMAGWDINSVDPCTWNMVGCSTEGFVISLAMVSTNL  90

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG+LSP +G L  L  L +  NQLSGP+P EI  +S L+ L+LS N F    P
Sbjct  91   SGMLSPSIGNLSHLQTLLLQNNQLSGPIPAEIGWLSELQTLDLSGNQFSGDIP  143



>ref|XP_009390158.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=659

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 67/113 (59%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P G+  E  AL++IK     D  + L +W+I S   C+WR VTC S  +V +L L   +L
Sbjct  61   PSGINYEVVALVAIKMELN-DPYNVLENWDINSVDPCSWRMVTCTSDGYVSALGLPSQSL  119

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L ++ +  N +SGP+P EI  +  L+ L+LSNN FG T P
Sbjct  120  SGKLSPGMGNLTNLQSVLLQNNAISGPIPAEIGKLEKLQTLDLSNNQFGGTIP  172



>ref|XP_009391272.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=646

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 65/120 (54%), Gaps = 3/120 (3%)
 Frame = +1

Query  118  AGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsl  291
            + AG   P GV  E  AL+ +KA+   D  S L +W+  S   C+W  VTC     V+ L
Sbjct  42   SAAGVLSPKGVNYEVQALMGVKASL-KDPHSVLENWDQDSVDPCSWTMVTCSPENLVIGL  100

Query  292  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
                 NLSG LSP +G L  L  + +  N +SGP+P EI+ +S L+ L+LSNN F    P
Sbjct  101  GTPSQNLSGTLSPSIGNLTNLQIILLQNNNISGPIPQEIARLSNLKTLDLSNNNFNGEIP  160



>ref|XP_010260843.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
 ref|XP_010260847.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
Length=1006

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 70/108 (65%), Gaps = 4/108 (4%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsl-lhvvsldlsglNLSGVL  324
            + +  LS+K AF   + + L +WN S   S C+W  + CD +   VVSLD+S  N+SGV+
Sbjct  53   QASIFLSLKQAFYVPT-TCLDTWNESNFMSLCSWTGIQCDDMGSSVVSLDISNFNISGVI  111

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  468
            SP +G+L  L+NLSIA N  SG  PPE+  +++LRFLN+SNN F  + 
Sbjct  112  SPAIGELQSLLNLSIAGNSFSGLFPPELHKLTSLRFLNISNNQFNGSL  159


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +1

Query  307  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            NL+G + PD+G    L  L ++ NQLSGP+P +IS I  L +LN+S N    + P +
Sbjct  540  NLTGRIPPDIGNCLLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWNHLNQSLPKE  596



>ref|XP_010412611.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Camelina 
sativa]
Length=972

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 1/107 (1%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSP  330
            ++ ALL  ++  + +S+  L SWN S + C W  V C      V+      + L+GV+SP
Sbjct  30   DKQALLEFQSNLSENSRVVLASWNDSLAVCKWTGVVCGHKHKRVTASDLSGMKLTGVISP  89

Query  331  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             +G L FL +LS+A N L G +P E+  + +L+ LNLS NI G   P
Sbjct  90   SIGNLSFLKSLSLADNSLHGSIPLEVGKLFSLQHLNLSKNILGGVIP  136



>ref|XP_009390157.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390159.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390160.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=665

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 67/113 (59%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P G+  E  AL++IK     D  + L +W+I S   C+WR VTC S  +V +L L   +L
Sbjct  61   PSGINYEVVALVAIKMELN-DPYNVLENWDINSVDPCSWRMVTCTSDGYVSALGLPSQSL  119

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L ++ +  N +SGP+P EI  +  L+ L+LSNN FG T P
Sbjct  120  SGKLSPGMGNLTNLQSVLLQNNAISGPIPAEIGKLEKLQTLDLSNNQFGGTIP  172



>ref|XP_006382632.1| hypothetical protein POPTR_0005s03970g [Populus trichocarpa]
 gb|ERP60429.1| hypothetical protein POPTR_0005s03970g [Populus trichocarpa]
Length=1060

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T++ ALLS+K+  T D  ++L+SWN S+S C W RV+C+ +   V+ LDLSGL L+G +S
Sbjct  68   TDKEALLSLKSQVTTDPSNTLSSWNNSSSPCNWTRVSCNQVNQRVIGLDLSGLRLTGSIS  127

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P++G L  L +L +  NQ +G +P +I A+S L  LN+S N      P
Sbjct  128  PNIGNLSLLRSLHLQGNQFTGLIPDQIGALSRLSVLNISFNSINGPIP  175



>ref|XP_010054700.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=1018

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  324
            T++  L S+K A   D   +L+SWN ST HC W+ V C       V SL L    L G L
Sbjct  31   TDRLVLTSLKNAIHKDPFGALSSWNDSTHHCEWQGVLCSKRHPGRVTSLVLRSQGLEGFL  90

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP VG L FL  + +  N   G +PP+I  +  LR L LSNN FG   P
Sbjct  91   SPHVGNLSFLRVIFLQNNSFHGEIPPQIGNLLRLRVLILSNNSFGGPIP  139



>ref|XP_007020361.1| Serine-threonine protein kinase, putative [Theobroma cacao]
 gb|EOY11886.1| Serine-threonine protein kinase, putative [Theobroma cacao]
Length=615

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 47/116 (41%), Positives = 67/116 (58%), Gaps = 2/116 (2%)
 Frame = +1

Query  130  AGKPLGVTEQAALLSIKAAFTADSQSSL-TSWNISTSHCTWRRVTC-dsllhvvsldlsg  303
            A  P   T+Q ALL++KA  T D Q+ L T+W  +TS C W  VTC      V +LDLS 
Sbjct  26   AESPNIATDQLALLALKAQVTYDPQNLLATNWTSATSVCNWTGVTCGSDHQRVTTLDLSN  85

Query  304  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            ++L G + P +G L FL  L I  N   GP+P E++ +S+L+++N  +N F    P
Sbjct  86   MSLIGTIPPHLGNLSFLSQLIIRFNHFHGPLPMELANLSSLKYINFGHNNFHGEIP  141



>ref|XP_011036960.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Populus euphratica]
Length=1022

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLS  327
            T++ ALLS+K+  T D  ++L SWN ++S C W RV+C+ +   V       L L+G +S
Sbjct  37   TDKEALLSLKSQVTTDPSNTLFSWNNNSSPCNWTRVSCNQVNQRVVGLDLSGLRLTGSIS  96

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P++G L FL +L +  NQ +G +P +I A+S L  LN+S N      P
Sbjct  97   PNIGNLSFLRSLHLQGNQFTGLIPDQIGALSRLSVLNISFNSITGRIP  144



>ref|XP_008223897.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=1010

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 58/110 (53%), Gaps = 2/110 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg--lNLSGVL  324
            T++ ALL+IKA    D    ++SWN S   C W+ VTC    H     L     NL G L
Sbjct  30   TDRLALLAIKAQIKEDPYGVMSSWNESMHFCMWQGVTCSQRHHQRVTSLMLRGQNLVGSL  89

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  474
            SP++G L FL +L +  N  S  +PPEI  +  L+ L+L  N+F    P+
Sbjct  90   SPNIGNLSFLRSLQLQNNSFSHEIPPEIGRLRRLQVLSLEYNLFTGLIPY  139



>gb|EEC68381.1| hypothetical protein OsI_36527 [Oryza sativa Indica Group]
Length=713

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 64/111 (58%), Gaps = 4/111 (4%)
 Frame = +1

Query  145  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSG  318
            G+ ++ ALLS ++   +D    L SWN S+ +C+W  V C       VV+L +S  NLSG
Sbjct  34   GMADEPALLSFESMLLSDG--FLASWNASSHYCSWPGVVCGGRHPERVVALQMSSFNLSG  91

Query  319  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             +SP +G L  L  L +  NQ +G +PPEI  ++ LR LNLS+N    + P
Sbjct  92   RISPSLGNLSLLRELELGDNQFTGDIPPEIGQLTRLRMLNLSSNYLQGSIP  142



>gb|KJB69703.1| hypothetical protein B456_011G038400 [Gossypium raimondii]
Length=620

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 67/121 (55%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  288
            S G     P GV  E AAL+S+K     D +  +  W+I S   CTW  V C +   V+S
Sbjct  23   SDGDSLLSPKGVNYEVAALMSVKRELR-DYKQVMDGWDINSVDPCTWNMVACSAEGFVIS  81

Query  289  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  468
            L+++   LSG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F    
Sbjct  82   LEMASTGLSGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFVGAI  141

Query  469  P  471
            P
Sbjct  142  P  142



>gb|KJB69702.1| hypothetical protein B456_011G038400 [Gossypium raimondii]
Length=618

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 67/121 (55%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  288
            S G     P GV  E AAL+S+K     D +  +  W+I S   CTW  V C +   V+S
Sbjct  23   SDGDSLLSPKGVNYEVAALMSVKRELR-DYKQVMDGWDINSVDPCTWNMVACSAEGFVIS  81

Query  289  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  468
            L+++   LSG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F    
Sbjct  82   LEMASTGLSGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFVGAI  141

Query  469  P  471
            P
Sbjct  142  P  142



>gb|EEC69970.1| hypothetical protein OsI_00442 [Oryza sativa Indica Group]
Length=987

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 61/111 (55%), Gaps = 5/111 (5%)
 Frame = +1

Query  145  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSG  318
            G T +A LL+ KA     S  +LTSWN STS C W  V C       VV L L   NL+G
Sbjct  18   GSTNEATLLAFKAGL---SSRTLTSWNSSTSFCNWEGVKCSRHRPTRVVGLSLPSSNLAG  74

Query  319  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             L P +G L FL  L++++N L G +PP +  +  LR L+L +N F   FP
Sbjct  75   TLPPAIGNLTFLRWLNLSSNGLHGEIPPSLGRLQHLRILDLGSNSFSGAFP  125



>gb|AAT64032.1| putative leucine-rich repeat transmembrane protein [Gossypium 
hirsutum]
Length=618

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K     D +  +  W+I S   CTW  V C +   V+SL+++   L
Sbjct  31   PKGVNYEVAALMSVKRELR-DYKQVMDGWDINSVDPCTWNMVACSAEGFVISLEMASTGL  89

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F    P
Sbjct  90   SGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFVGAIP  142



>ref|XP_007213585.1| hypothetical protein PRUPE_ppa003046mg [Prunus persica]
 gb|EMJ14784.1| hypothetical protein PRUPE_ppa003046mg [Prunus persica]
Length=608

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K     D    +  W+I S   CTW  V C     V+SL+++   L
Sbjct  15   PKGVNYEVAALMSVKREMK-DELRVMEGWDINSVDPCTWNMVGCSVEGFVISLEMASTGL  73

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG+LSP +G L  L  L +  NQLSGP+P EI  +S L+ L+LS N F    P
Sbjct  74   SGMLSPSIGNLSHLRTLLLQNNQLSGPIPMEIGKLSELQTLDLSGNQFSGNIP  126



>ref|XP_007214129.1| hypothetical protein PRUPE_ppa018020mg, partial [Prunus persica]
 gb|EMJ15328.1| hypothetical protein PRUPE_ppa018020mg, partial [Prunus persica]
Length=1216

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 1/116 (1%)
 Frame = +1

Query  127  GAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCds-llhvvsldlsg  303
            GA K    T+Q+ALL++++  T+D Q+ L +W+ STS C W  VTC +  L VVSL+LS 
Sbjct  251  GAAKTNITTDQSALLAMRSHITSDPQNILVNWSTSTSVCNWVGVTCGARHLRVVSLNLSY  310

Query  304  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            +  +G + P VG L FLV LS   N   G +P E+S +  L+F++L  N F  + P
Sbjct  311  MGFTGTIPPHVGNLSFLVALSFNNNSFYGTLPHELSYLRRLKFISLGFNNFMGSIP  366



>ref|XP_001752668.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ82539.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=992

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 69/108 (64%), Gaps = 3/108 (3%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  327
            E  ALL++K++F AD Q+ L +W  N + + C W  +TC +   VV L+LS +NL+G L 
Sbjct  12   EGLALLAMKSSF-ADPQNHLENWKLNGTATPCLWTGITCSNASSVVGLNLSNMNLTGTLP  70

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             D+G+L  LVN+S+  N  +G +P EI  +  L+++N+SNN F   FP
Sbjct  71   ADLGRLKNLVNISLDLNNFTGVLPAEIVTLLMLQYVNISNNRFNGAFP  118



>ref|XP_011019134.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Populus euphratica]
Length=1038

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC-dsllhvvsldlsglNLSGVLS  327
            T+  ALL+IKA  T D    ++SWN S   C WR + C +    V++L+LS   L G LS
Sbjct  41   TDHLALLAIKAQITLDPLGLMSSWNDSLHFCNWRGIICGNLHQRVINLNLSHYGLVGSLS  100

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G + FL  +S+  N   G +P EI  +  L+++N SNN F    P
Sbjct  101  PQIGNMSFLRGISLEQNYFYGEIPQEIGRLDRLKYINFSNNSFSGEIP  148



>ref|XP_003612525.1| Kinase-like protein [Medicago truncatula]
 gb|AES95483.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1013

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 42/108 (39%), Positives = 56/108 (52%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVLS  327
            T+  ALL  K + + D    L SWN S  +C W  +TC+ +   V+       NL GV+S
Sbjct  30   TDYLALLKFKESISNDPYGILASWNTSNHYCNWHGITCNPMHQRVTELDLDGFNLHGVIS  89

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P VG L FL NL +A N   G +P E+  +S L+ L LSNN      P
Sbjct  90   PHVGNLSFLTNLILAKNSFFGNIPHELGQLSRLQQLVLSNNSMTGEIP  137



>ref|XP_009123620.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Brassica 
rapa]
Length=1001

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 65/108 (60%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVLS  327
            T++ ALLS ++  + + QS   SW+ +TS C W  VTCD+ +  V+      + L+G +S
Sbjct  31   TDREALLSFESQMSQNPQSLSFSWDPNTSPCNWTGVTCDTRIRRVTSINLSGHGLTGSIS  90

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL +L +  NQL GP+P EI+ +  LR LNLS+N    + P
Sbjct  91   PSIGNLSFLTSLQLQNNQLRGPIPKEITNLFRLRVLNLSSNSLDGSLP  138



>ref|XP_004305136.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Fragaria vesca subsp. vesca]
Length=1044

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T++  LL+IKA    D    L+SWN S   C W  VTC      V++L+LS   L G LS
Sbjct  49   TDRLTLLAIKAQIIKDPNGILSSWNDSLHFCNWTGVTCGLRHQRVMTLNLSSYQLIGSLS  108

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL  L++  N     +PPEI  +  L++LNLSNN F    P
Sbjct  109  PHIGNLTFLSGLNLELNNFHSSLPPEIGHLFRLKYLNLSNNSFSGEIP  156



>ref|XP_008387933.1| PREDICTED: receptor protein kinase CLAVATA1 [Malus domestica]
Length=973

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 43/103 (42%), Positives = 63/103 (61%), Gaps = 0/103 (0%)
 Frame = +1

Query  163  ALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  342
            ALL +KAA      S L  WN S+SHC +  V CD    VV+L++S + L G +   +G 
Sbjct  32   ALLKLKAAMVGPKGSGLEDWNSSSSHCFFSGVLCDRDSRVVALNVSNIPLFGTIPAAIGL  91

Query  343  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            L  LVNL I  + L+G +P E++ +++L+ LN+SNN F  +FP
Sbjct  92   LDKLVNLEITDDNLTGRLPAEMANLTSLKHLNISNNAFSGSFP  134



>emb|CDP20234.1| unnamed protein product [Coffea canephora]
Length=1407

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVLS  327
            T++ ALL  K     D    L SWN S  HC W  VTC +    V         LSG +S
Sbjct  37   TDRLALLEFKKQIYDDPFGVLNSWNHSQHHCQWEGVTCSTRHQRVMALTLRDKQLSGTIS  96

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P VG L F+  + + ANQ  G  P E S +  LRFLNLS N      P
Sbjct  97   PHVGNLSFMRFIKLGANQFHGENPQEFSRLFRLRFLNLSRNALSGKIP  144


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 46/93 (49%), Gaps = 1/93 (1%)
 Frame = +1

Query  196   DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVLSPDVGQLPFLVNLSIA  372
             D    L SWN S  HC W  VTC +    V         LSG +SP VG L F+  + +A
Sbjct  1029  DPFGVLNSWNHSQHHCQWEGVTCSTRHQRVMALTLRDKQLSGTISPHVGNLSFMRFIQLA  1088

Query  373   ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
              NQL G +P E   +  LR LNLS+N  G   P
Sbjct  1089  ENQLHGGIPQEFGRLFRLRVLNLSSNALGGKIP  1121



>gb|KJB73885.1| hypothetical protein B456_011G258600 [Gossypium raimondii]
Length=988

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 54/109 (50%), Gaps = 1/109 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  324
            VT+Q ALL  KA  T D    + SWN S+  C WR VTCD     V+      L LSG L
Sbjct  15   VTDQLALLQFKAKITGDQLKIMESWNSSSHFCQWRGVTCDRKHQRVTKLELQFLKLSGSL  74

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L FL  L++A N     +P E   +  L  L LSNN      P
Sbjct  75   SPYIGNLSFLKGLNLANNNFYNQIPQEFGRLRRLETLELSNNSLSGEIP  123



>ref|XP_009334873.1| PREDICTED: receptor protein kinase CLAVATA1 [Pyrus x bretschneideri]
Length=973

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 44/103 (43%), Positives = 62/103 (60%), Gaps = 0/103 (0%)
 Frame = +1

Query  163  ALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  342
            ALL +KAA      S L  WN S+SHC +  V CD    VVSL++S + L G +   +G 
Sbjct  32   ALLKLKAAMVGPKGSGLEDWNSSSSHCFFSGVLCDRDSRVVSLNVSNIPLFGTIPAAIGL  91

Query  343  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            L  LVNL I  + L+G +P E++ ++ L+ LN+SNN F  +FP
Sbjct  92   LDKLVNLKITDDNLTGRLPAEMANLTALKHLNISNNAFSGSFP  134



>ref|XP_010269665.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Nelumbo nucifera]
Length=1024

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T++ ALL  K   T D   +L+SWN ST  C WR VTC      V++L+L   +L G++S
Sbjct  36   TDRLALLEFKEMITEDPLGALSSWNYSTHFCQWRGVTCSRRHQRVIALNLESQSLVGIVS  95

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIF  456
            P +G L FL  +++  N   G +P EI  +  LR L LSNN F
Sbjct  96   PHIGNLSFLRTITLQNNSFHGKIPQEIGRLFRLRSLTLSNNSF  138



>ref|NP_190295.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9SD62.1|Y3471_ARATH RecName: Full=Putative receptor-like protein kinase At3g47110; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB61957.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE78244.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=1025

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T++ ALL  K+  +  S+  L SWN S   C+W  V C      V  +DL GL L+GV+S
Sbjct  39   TDKQALLEFKSQVSETSRVVLGSWNDSLPLCSWTGVKCGLKHRRVTGVDLGGLKLTGVVS  98

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P VG L FL +L++A N   G +P E+  +  L++LN+SNN+FG   P
Sbjct  99   PFVGNLSFLRSLNLADNFFHGAIPSEVGNLFRLQYLNMSNNLFGGVIP  146



>gb|KCW58273.1| hypothetical protein EUGRSUZ_H00964 [Eucalyptus grandis]
Length=968

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 65/113 (58%), Gaps = 8/113 (7%)
 Frame = +1

Query  163  ALLSIKAAFTADSQSSLTSW--------NISTSHCTWRRVTCdsllhvvsldlsglNLSG  318
             LL +K A    S ++L  W             HC++  V CD    VVSL ++ + LSG
Sbjct  31   VLLKLKTAMVGPSSAALGDWIDSSSSSSPPPLPHCSFTGVACDDGSRVVSLYITSVGLSG  90

Query  319  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             + P++G L  LVNL++AA+ L+G +PPE+  +++LRFLNLS N+    FP +
Sbjct  91   YIPPEIGLLRDLVNLTLAADNLTGTLPPEVGNLTSLRFLNLSVNLLSGVFPGE  143



>emb|CDX91804.1| BnaC03g31060D [Brassica napus]
Length=991

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLS  327
            T++ ALL  K+  + D Q  L+SWN S+  C+W  VTC      V+    G   L G++S
Sbjct  24   TDRKALLDFKSQVSEDRQDVLSSWNNSSPLCSWEGVTCGLNNKRVTRLELGGRQLRGMIS  83

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FLV+L+++ N + G +P ++  +  L++LN+S N  G   P
Sbjct  84   PSIGNLSFLVSLNLSDNSIGGTIPHQVGNLFRLKYLNMSINNLGGELP  131



>ref|XP_008225339.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Prunus mume]
Length=625

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K     D    +  W+I S   CTW  V C     V+SL+++   L
Sbjct  32   PKGVNYEVAALMSVKREM-KDELRVMEGWDINSVDPCTWNMVGCSVEGFVISLEMASTGL  90

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG+LSP +G L  L  L +  NQLSGP+P EI  +S L+ L+LS N F    P
Sbjct  91   SGMLSPTIGNLSHLRTLLLQNNQLSGPIPMEIGKLSELQTLDLSGNQFSGNIP  143



>ref|XP_006365791.1| PREDICTED: putative receptor-like protein kinase At3g47110-like 
[Solanum tuberosum]
Length=1024

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T+  ALL+IK   T D     TSWN S   C+W  VTC  L   V  L L+ L+L G LS
Sbjct  16   TDIQALLAIKEKVTQDPHGIFTSWNNSVHFCSWEGVTCGHLHQRVTKLHLTSLDLVGTLS  75

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL +L +  N   G +PP++  +  L+ L+L+NN F    P
Sbjct  76   PFIGNLTFLTSLKLELNNFHGKIPPQVGGLFRLQHLSLTNNSFSGEIP  123



>gb|KFK42020.1| hypothetical protein AALP_AA2G201900 [Arabis alpina]
Length=974

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 45/111 (41%), Positives = 70/111 (63%), Gaps = 4/111 (4%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  321
            T+   LL++K++ T  + + L  W  STS   HC++  VTC+S   V+SL++S   L G 
Sbjct  30   TDMETLLNLKSSMTGPNGAGLHDWLHSTSPTSHCSFSGVTCNSQSRVISLNISFTPLFGT  89

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNN-IFGSTFP  471
            +SP++G L  LVNL++AAN  SG +P  +  +++L+ LN+SNN     TFP
Sbjct  90   ISPEIGNLNHLVNLTLAANNFSGNLPTSLKNLTSLKILNISNNGNLNGTFP  140



>ref|XP_010026074.1| PREDICTED: receptor protein kinase CLAVATA1 [Eucalyptus grandis]
Length=989

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 65/113 (58%), Gaps = 8/113 (7%)
 Frame = +1

Query  163  ALLSIKAAFTADSQSSLTSW--------NISTSHCTWRRVTCdsllhvvsldlsglNLSG  318
             LL +K A    S ++L  W             HC++  V CD    VVSL ++ + LSG
Sbjct  31   VLLKLKTAMVGPSSAALGDWIDSSSSSSPPPLPHCSFTGVACDDGSRVVSLYITSVGLSG  90

Query  319  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
             + P++G L  LVNL++AA+ L+G +PPE+  +++LRFLNLS N+    FP +
Sbjct  91   YIPPEIGLLRDLVNLTLAADNLTGTLPPEVGNLTSLRFLNLSVNLLSGVFPGE  143



>ref|NP_001176614.1| Os11g0568800 [Oryza sativa Japonica Group]
 gb|ABA94319.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAH95342.1| Os11g0568800 [Oryza sativa Japonica Group]
Length=1133

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 63/110 (57%), Gaps = 4/110 (4%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGV  321
            + ++ ALLS K+   +D    L SWN S+ +C+W  V C       VV+L +S  NLSG 
Sbjct  35   MADEPALLSFKSMLLSDG--FLASWNASSHYCSWPGVVCGGRHPERVVALQMSSFNLSGR  92

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            +SP +G L  L  L +  NQ +G +PPEI  ++ LR LNLS+N    + P
Sbjct  93   ISPSLGNLSLLRELELGDNQFTGDIPPEIGQLTRLRMLNLSSNYLQGSIP  142



>ref|XP_010691757.1| PREDICTED: uncharacterized protein LOC104905013 [Beta vulgaris 
subsp. vulgaris]
Length=2112

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 57/107 (53%), Gaps = 1/107 (1%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLSP  330
            ++ ALL IKA  + D   S++SWN +   C W  VTC      V  LDL    L+G LSP
Sbjct  33   DKLALLEIKAKISDDPFGSMSSWNDTLHFCEWYGVTCGRRHQRVTVLDLHSSKLTGTLSP  92

Query  331  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             +G L FL  L +  N  SG +PPEI  +  LR L LSNN  G   P
Sbjct  93   YLGNLSFLTTLHLENNSFSGIIPPEIGRLHRLRILWLSNNSIGGEIP  139


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = +1

Query  151   TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
             T++ ALL IKA  T+D    L +WN +   C W  VTC      V +LDL    L+G+LS
Sbjct  1190  TDRLALLDIKAKITSDPLGVLNTWNDNLQFCEWYGVTCGRRHQRVTNLDLHSSKLTGILS  1249

Query  328   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             P +G + FL  L +  N   G +PPEI  +  L++L ++NN      P
Sbjct  1250  PHIGNISFLRVLYLDENNFGGTIPPEIGRLHRLQYLMMANNSIEGEIP  1297



>gb|KEH19631.1| LRR receptor-like kinase [Medicago truncatula]
Length=1082

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTS-WNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVL  324
            T+Q+ALL+ K   T+D  + L + W+ ++S C+W  VTCD     V SL+L+ + L G +
Sbjct  31   TDQSALLAFKFLITSDPNNPLVNNWSTTSSVCSWVGVTCDDRHGRVHSLNLTNMGLRGTV  90

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP++G L FLV L ++ N   GP P EI  +  L+FL +SNN F    P
Sbjct  91   SPNLGNLSFLVKLDLSYNTFVGPFPKEICRLRRLKFLAISNNEFNGGVP  139



>ref|XP_006663536.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Oryza brachyantha]
Length=1062

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 61/108 (56%), Gaps = 2/108 (2%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVLS  327
            ++ ALLS K+  ++ + S L SWN ST +C+W  V C       V +L +   NLSG +S
Sbjct  38   DELALLSFKSMLSSPATSPLASWNASTPYCSWPGVACSRRHPERVTALRVGSFNLSGQIS  97

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +  L FL  L ++ NQL+G VPPE+  +  L  LNL+ N    T P
Sbjct  98   PVLANLSFLRELDLSENQLTGEVPPELGRLGRLESLNLAANTLQGTLP  145



>ref|XP_008370155.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=946

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            +++ ALL  K   T D    ++SWN S   C W  V+C      V+ L+L    L G +S
Sbjct  43   SDRLALLDFKKRITTDPFDVMSSWNHSIHFCNWVGVSCHRSTKRVLMLNLQSKKLVGSIS  102

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P VG L +L  +++  N   G +PPE+  + +L++LNLS+N FG   P
Sbjct  103  PSVGNLTYLTGINLRYNNFHGEIPPEMGRLQSLQYLNLSHNFFGGKIP  150



>emb|CDP18498.1| unnamed protein product [Coffea canephora]
Length=713

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 52/108 (48%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVLS  327
            T++ ALL  K     D    L SWN S  HC W  VTC +    V        +LSG +S
Sbjct  38   TDRLALLEFKNQIYDDPFGVLNSWNHSQHHCHWEGVTCSARHQRVMALTLRNKHLSGTIS  97

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P VG L F+  + +  NQ  G +P E   +S LR LNLS+N      P
Sbjct  98   PHVGNLSFMRFMELRGNQFQGEIPQEFGRLSRLRALNLSHNAISGKIP  145



>gb|KJB73883.1| hypothetical protein B456_011G2584002, partial [Gossypium raimondii]
Length=244

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 54/108 (50%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC-dsllhvvsldlsglNLSGVLS  327
            T+Q ALL  KA  T D  + + SWN S   C W  VTC      V  L L  L LSG LS
Sbjct  45   TDQQALLQYKAKITGDQLNIMESWNSSIHFCQWIGVTCGRKHQRVTKLKLRFLKLSGSLS  104

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL  L +AAN     +P EI  +  L  L+LSNN      P
Sbjct  105  PYIGNLSFLRELDLAANSFHNQIPQEIGGLRRLETLDLSNNSISGEIP  152



>gb|EAZ18778.1| hypothetical protein OsJ_34305 [Oryza sativa Japonica Group]
Length=1047

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 63/110 (57%), Gaps = 4/110 (4%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGV  321
            + ++ ALLS K+   +D    L SWN S+ +C+W  V C       VV+L +S  NLSG 
Sbjct  35   MADEPALLSFKSMLLSDG--FLASWNASSHYCSWPGVVCGGRHPERVVALQMSSFNLSGR  92

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            +SP +G L  L  L +  NQ +G +PPEI  ++ LR LNLS+N    + P
Sbjct  93   ISPSLGNLSLLRELELGDNQFTGDIPPEIGQLTRLRMLNLSSNYLQGSIP  142



>ref|XP_010690943.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690944.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690945.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690946.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1043

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvs-ldlsglNLSGVLS  327
            +++ ALL IKA  + D    L SWN +   C W  VTCD     V+ LDL    L+G+LS
Sbjct  38   SDRLALLDIKAKISHDPLDVLNSWNDTLQFCKWYGVTCDRRHQRVTGLDLQSSKLTGMLS  97

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL +L +  N + G +PPEI+ + +LR L L+NN F    P
Sbjct  98   PHIGNLSFLRDLHLENNNIGGIIPPEITRLHSLRNLWLTNNSFEGEIP  145



>ref|XP_002459591.1| hypothetical protein SORBIDRAFT_02g007200 [Sorghum bicolor]
 gb|EER96112.1| hypothetical protein SORBIDRAFT_02g007200 [Sorghum bicolor]
Length=769

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = +1

Query  154  EQAALLSIKAAFTAD-SQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVL  324
            ++AALL+ KA    D S  +L SWN STS C+W  VTC       V +L L G  L G L
Sbjct  27   DEAALLTFKAQVVIDCSSGTLASWNSSTSFCSWEGVTCSRRRPTQVSALSLQGSGLKGAL  86

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             P +G L  L  L+++ N+L G +P  +  +  L+ L+LSNN+F   FP
Sbjct  87   PPAIGNLKSLQTLNLSTNELYGEIPASLGHLRRLKTLDLSNNLFSGEFP  135



>gb|ACD56650.1| putative leucine-rich repeat transmembrane protein [Gossypioides 
kirkii]
Length=618

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 66/121 (55%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  288
            S G     P GV  E AAL+S+K     D Q  +  W+I S   CTW  V C +   V+S
Sbjct  23   SDGDSLLSPKGVNYEVAALMSVKRELRDDKQV-MDGWDINSVDPCTWNMVACSAEGFVLS  81

Query  289  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  468
            L+++   LSG+LSP +G L  L  + +  NQL GP+P EI  +S L+ L+LS N F    
Sbjct  82   LEMASTGLSGMLSPSIGNLSHLRTMLLQNNQLIGPIPDEIGKLSELQTLDLSGNHFVGAI  141

Query  469  P  471
            P
Sbjct  142  P  142



>ref|XP_008792970.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X2 [Phoenix dactylifera]
Length=504

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K+    D   ++  W+I S   CTW  V C     V+SL+++  +L
Sbjct  31   PKGVNYEVAALMSVKSKMW-DEAGAMDGWDINSVDPCTWSMVGCSPDGFVISLEMARNDL  89

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  + +  N++SGP+PPEI  +S L  L+LS N F    P
Sbjct  90   SGTLSPSIGNLSHLQTMLLQNNEISGPIPPEIGKLSQLTTLDLSGNQFIGEIP  142



>ref|XP_010520745.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Tarenaya 
hassleriana]
Length=999

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 63/109 (58%), Gaps = 1/109 (1%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  324
            VT++ AL+S ++  + DS +  +SW+ +TS C W  V+C +    V       L  +G +
Sbjct  32   VTDREALISFRSKLSVDSPNPFSSWDKNTSPCDWTGVSCGTRNLRVISLNLSGLGFTGFI  91

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L FL +L +  N+L GP+P EI+ +  LR LNLS+N    + P
Sbjct  92   SPSIGNLSFLTSLQLQRNRLYGPIPEEIANLFRLRNLNLSSNSLEGSLP  140



>ref|XP_008439728.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Cucumis melo]
Length=616

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 67/113 (59%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K+    D +  +  W+I S   CTW  V C +   V+SL++  + L
Sbjct  26   PKGVNYEVAALMSMKSRIK-DERRVMQGWDINSVDPCTWNMVACSAEGFVISLEMPNMGL  84

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  + +  N+LSGP+P +I A+S L+ L+LSNN F    P
Sbjct  85   SGTLSPSIGNLSHLRIMLLQNNELSGPIPDDIGALSELQTLDLSNNQFVGGIP  137



>ref|XP_010690947.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1034

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvs-ldlsglNLSGVLS  327
            +++ ALL IKA  + D    L SWN +   C W  VTCD     V+ LDL    L+G+LS
Sbjct  38   SDRLALLDIKAKISHDPLDVLNSWNDTLQFCKWYGVTCDRRHQRVTGLDLQSSKLTGMLS  97

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL +L +  N + G +PPEI+ + +LR L L+NN F    P
Sbjct  98   PHIGNLSFLRDLHLENNNIGGIIPPEITRLHSLRNLWLTNNSFEGEIP  145



>ref|XP_006841062.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
 gb|ERN02737.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
Length=629

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P G+  E  AL++IK     D  + L +W++ S   C+WR VTC +  +V SL +   NL
Sbjct  29   PSGINYEVVALMAIKNDLV-DPHNVLENWDMNSVDPCSWRMVTCSADGYVSSLGMPSQNL  87

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L N+ + +N + GP+P EI  +  L+ L+LSNN F    P
Sbjct  88   SGTLSPGIGNLSNLQNVLLQSNAIMGPIPSEIVRLQKLQALDLSNNRFSGAIP  140



>ref|XP_009781121.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X2 [Nicotiana sylvestris]
Length=610

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K     D    L  W+I S   CTW  V C S   V+SL+++ + L
Sbjct  28   PKGVNYEVAALMSMKNKMR-DEHQVLDGWDINSVDPCTWYMVGCSSEGFVISLEMASMGL  86

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  L +  NQLSGPVP EI  +S L  L+LS N F    P
Sbjct  87   SGSLSPSIGNLTHLRTLLLQNNQLSGPVPAEIGKLSELLTLDLSGNQFDGEIP  139



>gb|EEC68382.1| hypothetical protein OsI_36528 [Oryza sativa Indica Group]
Length=955

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 63/110 (57%), Gaps = 4/110 (4%)
 Frame = +1

Query  148  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGV  321
            + ++ ALLS K+   +D    L SWN S+ +C+W  V C       VV+L +S  NLSG 
Sbjct  1    MADEPALLSFKSMLLSDG--FLASWNASSHYCSWPGVVCGGRHPERVVALQMSSFNLSGR  58

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            +SP +G L  L  L +  NQ +G +PPEI  ++ LR LNLS+N    + P
Sbjct  59   ISPSLGNLSLLRELELGDNQFTGDIPPEIGQLTRLRMLNLSSNYLQGSIP  108



>ref|XP_011039407.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X2 [Populus euphratica]
Length=587

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+++K     D   ++  W++ S   CTW  ++C     V+SL+++ + L
Sbjct  27   PKGVNYEVAALMAVKREMR-DETGAMNGWDLNSVDPCTWNMISCSIEGFVISLEMASVGL  85

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  + +  N LSGP+P EI  +S L+ L+LS N FG   P
Sbjct  86   SGTLSPGIGNLIHLRTMLLQNNHLSGPIPEEIGKLSELQTLDLSGNQFGGGIP  138



>ref|XP_009403877.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=626

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/113 (40%), Positives = 66/113 (58%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P G+  E  AL++IK     D  + L +W+I S   C+WR VTC +  +V +L L   +L
Sbjct  28   PSGINYEVVALMAIKMEL-HDPYNVLENWDINSVDPCSWRMVTCSADGYVSALGLPSQSL  86

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG+LSP +G L  L ++ +  N +SG +P EI  +  L+ L+LSNN F  T P
Sbjct  87   SGMLSPGIGNLTNLQSMLLQNNAISGSIPAEIGKLEKLQMLDLSNNQFRGTIP  139



>ref|XP_009403878.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=607

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/113 (40%), Positives = 66/113 (58%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P G+  E  AL++IK     D  + L +W+I S   C+WR VTC +  +V +L L   +L
Sbjct  28   PSGINYEVVALMAIKMEL-HDPYNVLENWDINSVDPCSWRMVTCSADGYVSALGLPSQSL  86

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG+LSP +G L  L ++ +  N +SG +P EI  +  L+ L+LSNN F  T P
Sbjct  87   SGMLSPGIGNLTNLQSMLLQNNAISGSIPAEIGKLEKLQMLDLSNNQFRGTIP  139



>ref|XP_008792202.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Phoenix dactylifera]
Length=616

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K+    D   ++  W+I S   CTW  V C     V+SL+++  +L
Sbjct  31   PKGVNYEVAALMSVKSKMW-DEAGAMDGWDINSVDPCTWSMVGCSPDGFVISLEMARNDL  89

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  + +  N++SGP+PPEI  +S L  L+LS N F    P
Sbjct  90   SGTLSPSIGNLSHLQTMLLQNNEISGPIPPEIGKLSQLTTLDLSGNQFIGEIP  142



>emb|CAN71566.1| hypothetical protein VITISV_016304 [Vitis vinifera]
Length=362

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 68/109 (62%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLT-SWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVL  324
            T+Q++LL++KA  T D    L  +W+  TS C W  V+C++    V++LDLS L LSG +
Sbjct  7    TDQSSLLALKAHITLDPHHVLAGNWSTKTSFCEWMGVSCNAQQQRVIALDLSNLGLSGTI  66

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             PD+G L FLV+L +++N   GPVP E+  +++L  +NL  N+     P
Sbjct  67   PPDLGNLSFLVSLDLSSNNFHGPVPVEVGQLTSLLSMNLQYNLLSGQIP  115



>ref|XP_009781120.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Nicotiana sylvestris]
Length=617

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K     D    L  W+I S   CTW  V C S   V+SL+++ + L
Sbjct  28   PKGVNYEVAALMSMKNKMR-DEHQVLDGWDINSVDPCTWYMVGCSSEGFVISLEMASMGL  86

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  L +  NQLSGPVP EI  +S L  L+LS N F    P
Sbjct  87   SGSLSPSIGNLTHLRTLLLQNNQLSGPVPAEIGKLSELLTLDLSGNQFDGEIP  139



>ref|XP_010675938.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Beta vulgaris subsp. vulgaris]
Length=838

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 49/112 (44%), Positives = 66/112 (59%), Gaps = 4/112 (4%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTW----RRVTCdsllhvvsldlsglNLSGV  321
            E+ ALLSIK+A T D  +SL+SW  +T HC+W       +  S   V+SLD+S L L+G+
Sbjct  53   EEKALLSIKSAITYDPSNSLSSWKNTTHHCSWPYIICSSSSSSSSSVISLDISDLELTGI  112

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            LSPD+G L  L NLSI  N  SG +PPE+  ++ L  L   N  F    P +
Sbjct  113  LSPDIGFLTNLQNLSIEGNYFSGGIPPELGNLTKLTKLYGDNCNFSGEIPME  164



>ref|XP_004295585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Fragaria vesca subsp. vesca]
Length=623

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 62/113 (55%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+S+K     D    +  W+I S   CTW  V C +  +V+SL +    L
Sbjct  30   PKGVNFEVAALMSVKKEM-KDELLVMGGWDINSVDPCTWNMVGCSAEGYVISLAMGSSGL  88

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG+LSP +G L  L  L +  NQLSGP+P EI  +S L  L+LS N F    P
Sbjct  89   SGMLSPSIGNLSHLRTLLLQNNQLSGPIPSEIGRLSQLETLDLSGNQFSGNIP  141



>ref|XP_009376453.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Pyrus x bretschneideri]
Length=1042

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 1/107 (1%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC-dsllhvvsldlsglNLSGVLSP  330
            ++ ALL  K   TAD    ++SWN S   C+W  V+C  S   V++L+L    L G + P
Sbjct  44   DRLALLDFKKRITADPLDVMSSWNHSVHFCSWVGVSCHRSTKRVLTLNLESQKLVGSIPP  103

Query  331  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             VG L +L  +++ AN   G +PPE+  + +L++LNLS N F    P
Sbjct  104  SVGNLTYLTGINLGANNFHGEIPPEMGRLQSLQYLNLSYNSFRGVIP  150



>ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
 emb|CBI27432.3| unnamed protein product [Vitis vinifera]
Length=625

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 62/113 (55%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E  AL+SIK +   D +S L +W+  +   C+W  +TC     V+SL     NL
Sbjct  28   PKGVNFEVQALMSIKNSLI-DPRSVLENWDKDAVDPCSWNMITCSDDKLVISLGTPSQNL  86

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  + +  N +SGP+P E+  +S L  L+LSNN F    P
Sbjct  87   SGTLSPSIGNLTNLQTVLLQDNSISGPIPSELGKLSKLHLLDLSNNFFNGEIP  139



>ref|XP_006437547.1| hypothetical protein CICLE_v10033496mg, partial [Citrus clementina]
 gb|ESR50787.1| hypothetical protein CICLE_v10033496mg, partial [Citrus clementina]
Length=676

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 53/108 (49%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVLS  327
            T+Q ALL  KA  T D    L SWN S   C W+ VTC      V+      L L G LS
Sbjct  15   TDQLALLQFKAKVTHDPLEVLRSWNYSRHFCQWKGVTCSPRHQRVTGLRLPSLLLQGSLS  74

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            PD+G L FL  L +  N L   +P EI  +  LR L L+ N FG   P
Sbjct  75   PDIGNLSFLRVLDLKNNSLRNEIPQEIGYLFRLRILELNINTFGGQIP  122



>ref|XP_007213538.1| hypothetical protein PRUPE_ppa019671mg, partial [Prunus persica]
 gb|EMJ14737.1| hypothetical protein PRUPE_ppa019671mg, partial [Prunus persica]
Length=249

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 69/117 (59%), Gaps = 1/117 (1%)
 Frame = +1

Query  124  AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC-dsllhvvsldls  300
             GA K    T+Q+ALL++++  T+D  + L +W+ STS C W  VTC    L VVSL+LS
Sbjct  22   TGAAKTNITTDQSALLAMRSHITSDPHNILVNWSTSTSVCNWVGVTCGARHLRVVSLNLS  81

Query  301  glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             +  +G + P +G L FLV LS   N   G +P E+S +  L+F++L  N F  + P
Sbjct  82   YMVFTGTIPPHLGNLSFLVALSFNNNSFYGTLPHELSYLRRLKFISLGFNNFMGSIP  138



>ref|XP_011039404.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Populus euphratica]
 ref|XP_011039405.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Populus euphratica]
 ref|XP_011039406.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Populus euphratica]
Length=616

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E AAL+++K     D   ++  W++ S   CTW  ++C     V+SL+++ + L
Sbjct  27   PKGVNYEVAALMAVKREMR-DETGAMNGWDLNSVDPCTWNMISCSIEGFVISLEMASVGL  85

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  + +  N LSGP+P EI  +S L+ L+LS N FG   P
Sbjct  86   SGTLSPGIGNLIHLRTMLLQNNHLSGPIPEEIGKLSELQTLDLSGNQFGGGIP  138



>ref|XP_009341868.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Pyrus x bretschneideri]
Length=1029

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T++ ALL+ K + T D    + SWN S   C W  VTC+     V  L+L G  L+G L 
Sbjct  43   TDRMALLNFKKSITQDPLHVMNSWNESVHFCGWIGVTCNHYTKRVFMLNLQGQKLTGFLP  102

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L +L  +++ +N   G +P EI  + +L FLNLS+N F    P
Sbjct  103  PSIGNLSYLTRINLGSNNFRGEIPEEIGRLQSLHFLNLSHNSFSGKIP  150



>gb|KCW54708.1| hypothetical protein EUGRSUZ_I00657 [Eucalyptus grandis]
Length=346

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN--LSGVL  324
            T++AALL  K+    D Q  ++SWN S SHC W  V+C          L+  N  L G +
Sbjct  33   TDRAALLVFKSKMIDDPQGIVSSWNESLSHCNWLGVSCSRRHAGRVTALNLNNQKLIGTI  92

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             PD+G L FL  + + AN+L G +P E   +  L+ L L  N  G   P
Sbjct  93   PPDIGNLTFLRRVHLEANRLRGNIPEEFGRLFRLKTLGLLKNELGGEIP  141



>ref|XP_002305057.2| hypothetical protein POPTR_0004s05880g [Populus trichocarpa]
 gb|EEE85568.2| hypothetical protein POPTR_0004s05880g [Populus trichocarpa]
Length=1005

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 62/115 (54%), Gaps = 1/115 (1%)
 Frame = +1

Query  130  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-l  306
            A  P   T++ ALLS K+    D  ++L+SWN ++S C W RV C  +   V       L
Sbjct  28   AAVPGLFTDKEALLSFKSQVVVDPSNTLSSWNDNSSPCNWTRVDCSQVHQRVIGLDLSGL  87

Query  307  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             L+G +SP +G L FL +L +  NQ +G +P +I A+  L+ LN+S N      P
Sbjct  88   RLTGSISPHIGNLSFLRSLHLQENQFTGVIPDQIGALFRLKVLNMSFNTINGPIP  142



>gb|KHN30771.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=619

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 62/113 (55%), Gaps = 3/113 (3%)
 Frame = +1

Query  139  PLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNL  312
            P GV  E  AL+ IKA+   D    L +W+  +   C+W  VTC     V+SL +   NL
Sbjct  28   PKGVNFEVLALMGIKASLV-DPHGILDNWDEDAVDPCSWNMVTCSPENLVISLGIPSQNL  86

Query  313  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SG LSP +G L  L  + +  N ++GP+P EI  +S L+ L+LS+N F    P
Sbjct  87   SGTLSPSIGNLTNLQTVVLQNNNITGPIPSEIGKLSKLQTLDLSDNFFSGEIP  139



>ref|XP_004972877.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like isoform X2 [Setaria italica]
Length=462

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  324
            T++ ALLS K   ++   S L SWN+S+ +C+W  V C S     VV+L+L   NLSG +
Sbjct  28   TDEHALLSFKFMLSSGQSSLLASWNMSSHYCSWPGVVCSSRHPDRVVALNLGSFNLSGHI  87

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L FL  L +  NQL G +P E+  +  L+ LN+S N    + P
Sbjct  88   SPFLGNLSFLRKLVLCENQLIGQIPLELGHLGRLQVLNMSQNHLEGSIP  136



>emb|CDY36706.1| BnaC02g31270D [Brassica napus]
Length=956

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 63/108 (58%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVLS  327
            T+  ALLS ++  +   QS   SW+ +TS C W  VTCD+ +  V+      + L+G +S
Sbjct  31   TDSEALLSFESQMSQSPQSLSFSWDPNTSPCNWTGVTCDTRIRRVASINLSGHGLTGSIS  90

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL +L +  NQL GP+P EI+ +  LR LNLS+N    + P
Sbjct  91   PSIGNLSFLTSLQLQNNQLRGPIPKEITNLFRLRVLNLSSNSLDGSLP  138



>ref|XP_004134925.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780-like [Cucumis sativus]
 ref|XP_004163360.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780-like [Cucumis sativus]
 gb|KGN49314.1| hypothetical protein Csa_6G519660 [Cucumis sativus]
Length=616

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 48/121 (40%), Positives = 68/121 (56%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  288
            SA      P GV  E AAL+S+K+    D +  +  W+I S   CTW  V C +   V+S
Sbjct  18   SASDSHLSPKGVNYEVAALMSMKSRIK-DERRVMQGWDINSVDPCTWNMVACSTEGFVIS  76

Query  289  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  468
            L++  + LSG LSP +G L  L  + +  N+LSGP+P +I  +S L+ L+LSNN F    
Sbjct  77   LEMPNMGLSGTLSPSIGNLSHLRIMLLQNNELSGPIPDDIGELSELQTLDLSNNQFVGGI  136

Query  469  P  471
            P
Sbjct  137  P  137



>ref|XP_008224399.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=989

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 59/110 (54%), Gaps = 2/110 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd--sllhvvsldlsglNLSGVL  324
            T++ ALL+IKA  T D  +  +SWN S   C+W  V+C       V  LDL    L+G L
Sbjct  10   TDRLALLAIKAQITQDPHNVTSSWNESIHFCSWHGVSCGRRHRKRVTRLDLQSQKLAGSL  69

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  474
            SP +G L FL  L +  N  S  +PPEI  +  L+ L+L NN F    P+
Sbjct  70   SPHIGNLSFLRELELLNNSFSNKIPPEIGNLRRLQVLSLHNNSFSGPIPY  119



>ref|XP_006402101.1| hypothetical protein EUTSA_v10012566mg [Eutrema salsugineum]
 gb|ESQ43554.1| hypothetical protein EUTSA_v10012566mg [Eutrema salsugineum]
Length=990

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLS  327
            T++ ALL  K+  + D +  L+SWN S   C W+ VTC      V  L L  L+L GV+S
Sbjct  24   TDRQALLEFKSQVSEDKRVVLSSWNHSLPLCNWKGVTCGGKHKRVTHLHLGKLSLGGVIS  83

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL++L +  N   G +P E+  +  L +L++  NI G   P
Sbjct  84   PSIGNLSFLISLDLYDNSFGGTIPQEVGNLFRLEYLDMGLNILGGQIP  131



>ref|XP_008223875.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=989

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 59/111 (53%), Gaps = 2/111 (2%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd--sllhvvsldlsglNLSGVL  324
            T++ ALL+IKA  T D  +  +SWN S   C+W  V+C       V  LDL    L+G L
Sbjct  10   TDRLALLAIKAQITQDPHNVTSSWNESIHFCSWHGVSCGRRHRKRVTRLDLQSQKLAGSL  69

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  477
            SP +G L FL  L +  N  S  +PPEI  +  L+ L+L NN F    P+ 
Sbjct  70   SPHIGNLSFLRELELLNNSFSNKIPPEIGNLRRLQVLSLHNNSFSGPIPYN  120



>emb|CDP16554.1| unnamed protein product [Coffea canephora]
Length=621

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 52/107 (49%), Gaps = 1/107 (1%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVLSP  330
            ++ ALL  K          L SWN S  HC W  VTC +    V   +     LSG LSP
Sbjct  38   DRLALLEFKKQIYDHPFGVLNSWNHSQHHCQWEGVTCSTRHQRVIALILRYKQLSGTLSP  97

Query  331  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
             VG L F+  + +A NQ  G +P E S +  LR LNLS+N  G   P
Sbjct  98   HVGNLSFMRFIQLAENQFHGEIPQEFSRLKRLRVLNLSSNALGGKIP  144



>ref|XP_006484594.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Citrus sinensis]
Length=1029

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 52/108 (48%), Gaps = 1/108 (1%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVLS  327
            T+Q ALL  KA  T D    L SWN S   C W+ VTC      V+      L L G LS
Sbjct  33   TDQLALLEFKAKVTHDPLEVLRSWNYSRHFCQWKGVTCSRRHQRVTGLRLPSLLLQGSLS  92

Query  328  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            P +G L FL  L +  N     +P EI  +  LR L L+NN FG   P
Sbjct  93   PHIGNLSFLRVLDLKNNSFRNEIPQEIGYLFRLRILELNNNTFGGQIP  140



>ref|XP_009407625.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Musa acuminata subsp. malaccensis]
Length=1548

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 61/109 (56%), Gaps = 3/109 (3%)
 Frame = +1

Query  154  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCds---llhvvsldlsglNLSGVL  324
            ++ ALL+ +AA T D    L SWN S   C W  VTCD       V +L L  ++L GV+
Sbjct  39   DRVALLAFRAAITKDPSGILHSWNNSRHFCRWSGVTCDDPDHRERVTTLALEFMSLRGVI  98

Query  325  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            SP +G L +L  L ++ N   G +PPEIS ++ L+ LNLS N    T P
Sbjct  99   SPSIGNLTYLGYLLLSNNSFYGEIPPEISRLAQLKDLNLSYNALNGTVP  147



>ref|XP_008353615.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Malus domestica]
Length=197

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 4/111 (4%)
 Frame = +1

Query  151  TEQAALLSIKAAFTADSQSSLTS-WNISTSH--CTWRRVTCdsllh-vvsldlsglNLSG  318
            T+Q+ALLS+KA  T+D Q+ LT+ W+ +++   C W  V+C +  H V  L+LS + L+G
Sbjct  14   TDQSALLSLKAHITSDPQNILTANWSSASNSNICNWVGVSCGAGHHRVTXLNLSHMGLAG  73

Query  319  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  471
            V+ P +G L FLV L +  N   GP+P E+S +  L+ +N  NN F  T P
Sbjct  74   VIPPHLGNLSFLVELGLENNSFHGPLPQELSRLRRLKEINFGNNSFMGTIP  124



>ref|XP_009393965.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Musa acuminata subsp. malaccensis]
Length=632

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 68/111 (61%), Gaps = 1/111 (1%)
 Frame = +1

Query  145  GVTEQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNLSGV  321
            G  +  AL+ +KAA      S L  W   S  HC++  VTCD   HVV+L++S ++L+G 
Sbjct  20   GDGDHGALVKLKAALVGPGGSGLGDWAAASPDHCSFSGVTCDEDSHVVALNVSFVHLNGS  79

Query  322  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  474
            L P++G L  LVNL+++   L G +P E++A+ +LR LN+SN+ F   FP 
Sbjct  80   LPPEIGLLRHLVNLTVSCAGLGGSLPVELAALPSLRLLNISNSHFSGEFPK  130



Lambda      K        H        a         alpha
   0.317    0.129    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567171140730