BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF012G12

Length=436
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAV88066.1|  NBS-LRR protein                                       60.1    1e-07   Ipomoea batatas [batate]
ref|XP_009615718.1|  PREDICTED: putative late blight resistance p...  50.8    9e-05   Nicotiana tomentosiformis



>gb|AAV88066.1| NBS-LRR protein [Ipomoea batatas]
Length=846

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 58/103 (56%), Gaps = 14/103 (14%)
 Frame = +1

Query  88   MACVAVASLLRTIELEFLQYKPRPLALHYHLISPNKDLIQSFHQNLGFLITQFDQKRINM  267
            MACVA+ SL+ TI+LEFLQ  PR        +  + + ++SF++ L  L   F Q++   
Sbjct  1    MACVALTSLMATIKLEFLQPNPR--------VVLDDEAMESFYEKLSSL-QGFVQEKSGA  51

Query  268  DGVEAVKHLETKLRDLAFRVEDEIE-----FLVAHLYDEEEDK  381
             G  A++HLE ++RD A   ED IE     FL+A    E++ K
Sbjct  52   RGGTAIRHLEIQIRDFALEAEDRIETQLSNFLLAIKNPEDQQK  94



>ref|XP_009615718.1| PREDICTED: putative late blight resistance protein homolog R1B-12, 
partial [Nicotiana tomentosiformis]
Length=469

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 58/109 (53%), Gaps = 11/109 (10%)
 Frame = +1

Query  82   RRMACVAVASLLRTIELEF-------LQYKPRPLALHYHLISPNKDLIQSFHQNLGFLIT  240
            R MA  AV SL+ T+ L         L ++ +  +LH  +    K+ IQSFHQN+  L  
Sbjct  160  RAMAYAAVTSLMSTLGLLLQSSCRLNLPHEEQTESLHKKV----KEQIQSFHQNVSSLQA  215

Query  241  QFDQKRINMDGVEAVKHLETKLRDLAFRVEDEIEFLVAHLYDEEEDKVK  387
              +    N++ ++ ++H E K++D A+  E  IE ++ + Y  + +KV+
Sbjct  216  FLESLETNINDLKTIEHCEVKIKDAAYDAEYRIESVLENFYKAQNEKVR  264



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564667271820