BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF012E04

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO97380.1|  unnamed protein product                                105   5e-27   Coffea canephora [robusta coffee]
ref|XP_008454461.1|  PREDICTED: costars family protein                  105   6e-27   Cucumis melo [Oriental melon]
ref|XP_011087958.1|  PREDICTED: costars family protein                  104   9e-27   Sesamum indicum [beniseed]
ref|XP_010254575.1|  PREDICTED: costars family protein-like             103   3e-26   Nelumbo nucifera [Indian lotus]
gb|ABD28547.2|  Protein C6orf115, putative                              103   2e-25   Medicago truncatula
ref|XP_010691385.1|  PREDICTED: costars family protein                  101   2e-25   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI38229.3|  unnamed protein product                                100   2e-25   Vitis vinifera
ref|XP_003593273.1|  hypothetical protein MTR_2g009660                  102   3e-25   
ref|XP_010645168.1|  PREDICTED: LOW QUALITY PROTEIN: costars fami...    100   3e-25   Vitis vinifera
gb|KDP29995.1|  hypothetical protein JCGZ_18762                         100   3e-25   Jatropha curcas
ref|XP_004485613.1|  PREDICTED: costars family protein-like             100   5e-25   Cicer arietinum [garbanzo]
ref|NP_001050950.1|  Os03g0690000                                       100   5e-25   
ref|XP_010277586.1|  PREDICTED: costars family protein                99.8    6e-25   Nelumbo nucifera [Indian lotus]
ref|XP_009620459.1|  PREDICTED: costars family protein                  100   6e-25   Nicotiana tomentosiformis
ref|XP_007042821.1|  C6orf115, putative                                 100   7e-25   Theobroma cacao [chocolate]
ref|XP_010030000.1|  PREDICTED: costars family protein                99.8    8e-25   Eucalyptus grandis [rose gum]
ref|XP_009792409.1|  PREDICTED: costars family protein                99.8    9e-25   Nicotiana sylvestris
ref|XP_007159157.1|  hypothetical protein PHAVU_002G213700g           99.4    9e-25   Phaseolus vulgaris [French bean]
ref|XP_006359368.1|  PREDICTED: costars family protein-like           99.4    1e-24   Solanum tuberosum [potatoes]
ref|XP_010098215.1|  hypothetical protein L484_001044                   103   1e-24   
ref|XP_008382197.1|  PREDICTED: costars family protein                  100   1e-24   
ref|XP_010547923.1|  PREDICTED: costars family protein ST45-2         99.8    1e-24   Tarenaya hassleriana [spider flower]
ref|XP_008796657.1|  PREDICTED: costars family protein                99.0    1e-24   Phoenix dactylifera
ref|XP_006284841.1|  hypothetical protein CARUB_v10006123mg           99.4    1e-24   Capsella rubella
ref|XP_002522688.1|  Protein C6orf115, putative                       99.4    1e-24   Ricinus communis
ref|XP_004504856.1|  PREDICTED: costars family protein-like           99.0    2e-24   Cicer arietinum [garbanzo]
gb|AFK48356.1|  unknown                                               99.0    2e-24   Medicago truncatula
ref|XP_003529267.1|  PREDICTED: costars family protein-like           99.0    2e-24   Glycine max [soybeans]
ref|XP_003531014.1|  PREDICTED: costars family protein At4g33640-...  99.0    2e-24   Glycine max [soybeans]
ref|XP_002466642.1|  hypothetical protein SORBIDRAFT_01g011530        98.6    2e-24   Sorghum bicolor [broomcorn]
ref|XP_007201455.1|  hypothetical protein PRUPE_ppa013924mg           98.6    3e-24   Prunus persica
ref|XP_011023072.1|  PREDICTED: costars family protein                98.6    3e-24   Populus euphratica
ref|XP_009368310.1|  PREDICTED: costars family protein                98.6    3e-24   Pyrus x bretschneideri [bai li]
ref|XP_004982127.1|  PREDICTED: costars family protein-like           98.2    3e-24   Setaria italica
ref|XP_002309860.1|  hypothetical protein POPTR_0007s03140g           98.2    3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_008358397.1|  PREDICTED: costars family protein-like           98.2    3e-24   
ref|XP_009343817.1|  PREDICTED: costars family protein-like           98.2    4e-24   Pyrus x bretschneideri [bai li]
ref|NP_567930.1|  uncharacterized protein                             98.2    4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|EMS63642.1|  hypothetical protein TRIUR3_05750                     97.8    4e-24   Triticum urartu
emb|CDX68993.1|  BnaC01g04600D                                        97.8    5e-24   
gb|EYU18406.1|  hypothetical protein MIMGU_mgv1a017197mg              97.4    5e-24   Erythranthe guttata [common monkey flower]
ref|XP_010231394.1|  PREDICTED: costars family protein                97.4    6e-24   Brachypodium distachyon [annual false brome]
ref|XP_008237249.1|  PREDICTED: costars family protein                97.8    6e-24   Prunus mume [ume]
ref|XP_010432532.1|  PREDICTED: costars family protein At4g33640      97.4    6e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010437738.1|  PREDICTED: costars family protein At4g33640-...  97.4    6e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010447216.1|  PREDICTED: costars family protein At4g33640-...  97.4    6e-24   Camelina sativa [gold-of-pleasure]
emb|CAA20577.1|  putative protein                                     99.4    7e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006650425.1|  PREDICTED: costars family protein-like           97.4    7e-24   Oryza brachyantha
ref|XP_004290405.1|  PREDICTED: costars family protein                97.1    9e-24   Fragaria vesca subsp. vesca
ref|XP_006412331.1|  hypothetical protein EUTSA_v10026671mg           97.1    1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_006423704.1|  hypothetical protein CICLE_v10029672mg           97.1    1e-23   Citrus clementina [clementine]
ref|XP_009366325.1|  PREDICTED: costars family protein-like           97.1    1e-23   Pyrus x bretschneideri [bai li]
ref|XP_009120730.1|  PREDICTED: costars family protein ST45-2         96.7    1e-23   Brassica rapa
gb|KFK29986.1|  hypothetical protein AALP_AA7G203000                  96.7    2e-23   Arabis alpina [alpine rockcress]
ref|XP_002867166.1|  hypothetical protein ARALYDRAFT_491316           96.3    2e-23   Arabidopsis lyrata subsp. lyrata
gb|ACG31036.1|  hypothetical protein                                  95.9    2e-23   Zea mays [maize]
ref|XP_010923309.1|  PREDICTED: costars family protein                95.5    3e-23   Elaeis guineensis
ref|XP_006852895.1|  hypothetical protein AMTR_s00033p00221650        95.9    3e-23   Amborella trichopoda
gb|ACG47970.1|  hypothetical protein                                  95.9    4e-23   Zea mays [maize]
ref|XP_009412481.1|  PREDICTED: costars family protein                94.7    7e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003608396.1|  hypothetical protein MTR_4g093660                94.4    1e-22   Medicago truncatula
sp|A9NK39.1|COSA_PICSI  RecName: Full=Costars family protein WS02...  93.2    3e-22   Picea sitchensis
ref|XP_004147507.1|  PREDICTED: costars family protein-like           91.7    2e-21   
ref|XP_009062533.1|  hypothetical protein LOTGIDRAFT_207050           90.5    3e-21   Lottia gigantea
ref|XP_005102609.1|  PREDICTED: costars family protein ABRACL-lik...  88.6    1e-20   Aplysia californica
ref|XP_002131888.1|  PREDICTED: costars family protein ABRACL-like    87.8    3e-20   Ciona intestinalis [sea vase]
ref|XP_002963364.1|  hypothetical protein SELMODRAFT_8583             86.3    1e-19   
ref|XP_008311631.1|  PREDICTED: costars family protein ABRACL         85.9    2e-19   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_011423954.1|  PREDICTED: costars family protein ABRACL-like    85.5    2e-19   Crassostrea gigas
dbj|GAM18052.1|  hypothetical protein SAMD00019534_012270             85.5    3e-19   Acytostelium subglobosum LB1
ref|XP_003971945.1|  PREDICTED: costars family protein ABRACL-like    84.3    7e-19   
ref|NP_998807.1|  costars family protein ABRACL                       84.0    9e-19   Danio rerio [leopard danio]
ref|XP_008112706.1|  PREDICTED: costars family protein ABRACL iso...  84.0    1e-18   Anolis carolinensis [Carolina anole]
ref|XP_002974652.1|  hypothetical protein SELMODRAFT_8582             83.6    1e-18   
gb|ETO27738.1|  hypothetical protein RFI_09392                        84.0    1e-18   Reticulomyxa filosa
ref|NP_001165090.1|  costars family protein ABRACL                    82.8    3e-18   Xenopus laevis [clawed frog]
ref|NP_001154032.1|  CF115 protein                                    82.4    3e-18   Oncorhynchus mykiss
ref|XP_002505679.1|  predicted protein                                82.4    3e-18   Micromonas commoda
ref|XP_003446311.1|  PREDICTED: costars family protein ABRACL-lik...  82.4    4e-18   
gb|KFQ69396.1|  Costars family protein ABRACL                         82.4    4e-18   Phaethon lepturus
ref|XP_002158724.1|  PREDICTED: costars family protein ABRACL-like    82.4    4e-18   Hydra vulgaris
ref|NP_001165089.1|  costars family protein ABRACL                    82.0    5e-18   Xenopus tropicalis [western clawed frog]
gb|KFR07389.1|  Costars family protein ABRACL                         82.0    5e-18   Opisthocomus hoazin [hoatzin]
ref|XP_003387508.1|  PREDICTED: costars family protein ABRACL-like    82.0    5e-18   Amphimedon queenslandica
ref|XP_010737667.1|  PREDICTED: costars family protein ABRACL         81.6    6e-18   Larimichthys crocea [croceine croaker]
gb|KFQ35820.1|  Costars family protein ABRACL                         81.6    6e-18   Merops nubicus
gb|KFZ52453.1|  Costars family protein ABRACL                         81.6    6e-18   Antrostomus carolinensis
gb|AAQ55814.1|  hypothetical protein                                  82.4    7e-18   Coturnix coturnix
gb|ACO09013.1|  C6orf115                                              81.6    7e-18   Osmerus mordax
gb|KFQ08843.1|  Costars family protein ABRACL                         81.6    8e-18   Leptosomus discolor
gb|KGL81992.1|  Costars family protein ABRACL                         81.3    8e-18   Tinamus guttatus
ref|XP_009687213.1|  PREDICTED: costars family protein ABRACL iso...  82.0    9e-18   Struthio camelus australis
ref|XP_003223326.1|  PREDICTED: costars family protein ABRACL iso...  81.3    1e-17   Anolis carolinensis [Carolina anole]
gb|EMC83349.1|  UPF0727 protein C6orf115 like protein                 81.3    1e-17   
ref|XP_010880879.1|  PREDICTED: costars family protein ABRACL         81.3    1e-17   Esox lucius
gb|KFV63720.1|  Costars family protein ABRACL                         81.3    1e-17   Picoides pubescens
ref|XP_007423586.1|  PREDICTED: costars family protein ABRACL iso...  80.9    1e-17   Python bivittatus
ref|XP_004636782.1|  PREDICTED: costars family protein ABRACL-like    80.9    1e-17   
gb|KFO73634.1|  Costars family protein ABRACL                         80.9    1e-17   Cuculus canorus
gb|KFM09004.1|  Costars family protein ABRACL                         80.9    1e-17   Aptenodytes forsteri
gb|KFV46510.1|  Costars family protein ABRACL                         80.9    1e-17   Tyto alba [Schleiereule]
gb|KFZ55568.1|  Costars family protein ABRACL                         80.9    1e-17   Podiceps cristatus
ref|XP_783554.1|  PREDICTED: costars family protein ABRACL-like       80.9    1e-17   
ref|XP_004628595.1|  PREDICTED: costars family protein ABRACL         80.9    2e-17   Octodon degus
ref|XP_007649289.1|  PREDICTED: costars family protein ABRACL iso...  80.9    2e-17   
gb|EDL03471.1|  mCG7517, isoform CRA_a                                80.9    2e-17   Mus musculus [mouse]
gb|KFW11356.1|  Costars family protein ABRACL                         80.9    2e-17   Eurypyga helias
gb|KFO13502.1|  Costars family protein ABRACL                         80.9    2e-17   Balearica regulorum gibbericeps
ref|XP_002714893.1|  PREDICTED: costars family protein ABRACL         80.5    2e-17   Oryctolagus cuniculus [domestic rabbit]
gb|KFQ49984.1|  Costars family protein ABRACL                         80.5    2e-17   Nestor notabilis
gb|KFQ52259.1|  Costars family protein ABRACL                         80.5    2e-17   Pelecanus crispus
ref|XP_001640937.1|  predicted protein                                80.5    2e-17   Nematostella vectensis
gb|KFP80599.1|  Costars family protein ABRACL                         80.5    2e-17   Apaloderma vittatum
gb|KFP31952.1|  Costars family protein ABRACL                         80.5    2e-17   Colius striatus
gb|KGN53893.1|  hypothetical protein Csa_4G182240                     80.5    2e-17   Cucumis sativus [cucumbers]
ref|XP_010284041.1|  PREDICTED: costars family protein ABRACL         80.1    2e-17   Phaethon lepturus
ref|NP_001134634.1|  costars family protein ABRACL                    80.1    2e-17   Salmo salar
gb|KFV88505.1|  Costars family protein ABRACL                         80.1    2e-17   Struthio camelus australis
ref|XP_002817467.1|  PREDICTED: costars family protein ABRACL         80.1    2e-17   Pongo abelii [orang utan]
ref|XP_006642989.1|  PREDICTED: costars family protein ABRACL-like    80.1    2e-17   Lepisosteus oculatus
ref|XP_009930257.1|  PREDICTED: costars family protein ABRACL         80.1    3e-17   Opisthocomus hoazin [hoatzin]
ref|XP_004550622.1|  PREDICTED: costars family protein ABRACL-like    80.1    3e-17   Maylandia zebra
gb|KFQ22819.1|  Costars family protein ABRACL                         80.1    3e-17   Mesitornis unicolor
ref|XP_004609058.1|  PREDICTED: costars family protein ABRACL         80.1    3e-17   Sorex araneus [Eurasian shrew]
ref|XP_008820248.1|  PREDICTED: costars family protein ABRACL         80.1    3e-17   Nannospalax galili
ref|XP_006885004.1|  PREDICTED: costars family protein ABRACL         80.1    3e-17   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KFP01035.1|  Costars family protein ABRACL                         80.1    3e-17   Calypte anna
ref|XP_007245508.1|  PREDICTED: costars family protein ABRACL         80.9    3e-17   Astyanax mexicanus [blind cave fish]
gb|EPQ03269.1|  hypothetical protein D623_10035727                    80.1    3e-17   Myotis brandtii
ref|XP_008689265.1|  PREDICTED: costars family protein ABRACL         82.8    3e-17   Ursus maritimus [white bear]
ref|XP_005043771.1|  PREDICTED: costars family protein ABRACL         80.1    3e-17   Ficedula albicollis
ref|XP_005329869.1|  PREDICTED: costars family protein ABRACL         80.1    3e-17   Ictidomys tridecemlineatus
ref|XP_004368930.1|  PREDICTED: costars family protein ABRACL         80.1    3e-17   Trichechus manatus latirostris
gb|KFU90284.1|  Costars family protein ABRACL                         80.1    3e-17   Chaetura pelagica
ref|XP_008304863.1|  PREDICTED: costars family protein ABRACL-like    79.7    3e-17   Stegastes partitus
ref|XP_003986651.1|  PREDICTED: costars family protein ABRACL         79.7    3e-17   Felis catus [cat]
ref|XP_003204212.1|  PREDICTED: costars family protein ABRACL         79.7    3e-17   Meleagris gallopavo [common turkey]
ref|XP_005361042.1|  PREDICTED: costars family protein ABRACL iso...  79.7    3e-17   Microtus ochrogaster [prairie voles]
ref|XP_010176388.1|  PREDICTED: costars family protein ABRACL         79.7    4e-17   Antrostomus carolinensis
ref|XP_005280433.1|  PREDICTED: costars family protein ABRACL iso...  80.9    4e-17   
ref|XP_005859127.1|  PREDICTED: costars family protein ABRACL         79.7    4e-17   Myotis brandtii
ref|XP_008945039.1|  PREDICTED: costars family protein ABRACL         79.7    4e-17   Merops nubicus
ref|XP_005065907.1|  PREDICTED: costars family protein ABRACL         79.7    4e-17   Mesocricetus auratus [Syrian golden hamster]
ref|XP_002912685.1|  PREDICTED: costars family protein ABRACL         79.7    4e-17   Ailuropoda melanoleuca
ref|XP_004702032.1|  PREDICTED: costars family protein ABRACL         79.7    4e-17   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004587333.1|  PREDICTED: costars family protein ABRACL         79.7    4e-17   Ochotona princeps [southern American pika]
ref|XP_006834682.1|  PREDICTED: costars family protein ABRACL         79.3    5e-17   Chrysochloris asiatica
ref|NP_001180288.1|  uncharacterized protein LOC708266                79.3    5e-17   Macaca mulatta [rhesus macaque]
ref|XP_008005040.1|  PREDICTED: costars family protein ABRACL iso...  80.1    5e-17   Chlorocebus sabaeus
ref|XP_010219792.1|  PREDICTED: costars family protein ABRACL         79.3    5e-17   Tinamus guttatus
ref|XP_004442153.1|  PREDICTED: costars family protein ABRACL         79.3    5e-17   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_001513946.1|  PREDICTED: costars family protein ABRACL         79.3    5e-17   
ref|XP_009946947.1|  PREDICTED: costars family protein ABRACL         79.3    5e-17   Leptosomus discolor
gb|AIC62228.1|  ABRACL                                                79.3    5e-17   synthetic construct
ref|XP_008516613.1|  PREDICTED: costars family protein ABRACL         79.7    5e-17   Equus przewalskii [Przewalski horse]
ref|NP_001160033.1|  costars family protein ABRACL                    79.3    5e-17   Bos taurus [bovine]
ref|XP_006915428.1|  PREDICTED: costars family protein ABRACL         79.3    5e-17   Pteropus alecto
gb|AAF28958.1|AF161398_1  HSPC280                                     80.9    5e-17   Homo sapiens [man]
ref|XP_005973408.1|  PREDICTED: costars family protein ABRACL         79.3    5e-17   Pantholops hodgsonii [Tibetan antelope]
ref|XP_010624898.1|  PREDICTED: costars family protein ABRACL         79.3    6e-17   Fukomys damarensis [Damara mole rat]
ref|NP_067066.1|  costars family protein ABRACL                       79.3    6e-17   Homo sapiens [man]
ref|XP_003404025.1|  PREDICTED: costars family protein ABRACL         79.3    6e-17   Loxodonta africana [African bush elephant]
ref|XP_004410330.1|  PREDICTED: costars family protein ABRACL         79.3    6e-17   Odobenus rosmarus divergens
gb|KFO32243.1|  hypothetical protein H920_06346                       79.7    6e-17   Fukomys damarensis [Damara mole rat]
ref|XP_006986145.1|  PREDICTED: costars family protein ABRACL iso...  79.3    6e-17   Peromyscus maniculatus bairdii
ref|XP_005509479.1|  PREDICTED: costars family protein ABRACL         79.0    7e-17   Columba livia [carrier pigeon]
ref|XP_005389319.1|  PREDICTED: costars family protein ABRACL iso...  79.7    7e-17   
ref|XP_009909861.1|  PREDICTED: costars family protein ABRACL         79.0    7e-17   Picoides pubescens
ref|XP_004673954.1|  PREDICTED: costars family protein ABRACL         79.0    7e-17   Condylura cristata
ref|XP_003465701.1|  PREDICTED: costars family protein ABRACL iso...  79.0    7e-17   Cavia porcellus [guinea pig]
ref|XP_004083943.1|  PREDICTED: costars family protein ABRACL         79.0    7e-17   Oryzias latipes [Japanese rice fish]
ref|NP_001093117.1|  costars family protein ABRACL                    79.0    7e-17   Rattus norvegicus [brown rat]
ref|XP_003770544.1|  PREDICTED: costars family protein ABRACL-like    79.0    8e-17   Sarcophilus harrisii
ref|XP_010200782.1|  PREDICTED: costars family protein ABRACL         79.3    8e-17   Colius striatus
gb|KFW92191.1|  Costars family protein ABRACL                         79.0    8e-17   Phalacrocorax carbo [common cormorant]
ref|XP_003121220.1|  PREDICTED: costars family protein ABRACL iso...  79.0    8e-17   
ref|XP_003496586.1|  PREDICTED: costars family protein ABRACL iso...  79.0    8e-17   Cricetulus griseus [Chinese hamsters]
ref|XP_006776246.1|  PREDICTED: uncharacterized protein LOC102758438  82.0    8e-17   
ref|XP_533427.3|  PREDICTED: costars family protein ABRACL            79.0    8e-17   Canis lupus familiaris [dogs]
ref|XP_003353243.1|  PREDICTED: costars family protein ABRACL iso...  79.0    8e-17   
gb|AAH39801.1|  3110003A17Rik protein                                 79.3    8e-17   Mus musculus [mouse]
ref|XP_007944483.1|  PREDICTED: costars family protein ABRACL         79.0    8e-17   Orycteropus afer afer
ref|XP_008005039.1|  PREDICTED: costars family protein ABRACL iso...  80.9    8e-17   Chlorocebus sabaeus
ref|XP_009961435.1|  PREDICTED: costars family protein ABRACL         79.0    8e-17   Tyto alba [Schleiereule]
ref|XP_005230222.1|  PREDICTED: costars family protein ABRACL         79.0    9e-17   Falco peregrinus [peregrine]
ref|XP_002197784.1|  PREDICTED: costars family protein ABRACL         79.0    9e-17   Taeniopygia guttata
ref|NP_001289105.1|  costars family protein ABRACL                    79.0    9e-17   Gallus gallus [bantam]
ref|XP_006188561.1|  PREDICTED: costars family protein ABRACL         79.0    9e-17   Camelus ferus
ref|XP_006151148.1|  PREDICTED: costars family protein ABRACL         79.0    9e-17   Tupaia chinensis
ref|XP_010156542.1|  PREDICTED: costars family protein ABRACL         79.0    9e-17   Eurypyga helias
gb|EDL03473.1|  mCG7517, isoform CRA_c                                80.1    9e-17   Mus musculus [mouse]
ref|XP_003340441.1|  PREDICTED: costars family protein ABRACL         78.6    9e-17   Monodelphis domestica
ref|XP_006112767.1|  PREDICTED: costars family protein ABRACL         78.6    9e-17   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006020731.1|  PREDICTED: costars family protein ABRACL iso...  78.6    9e-17   
gb|KFQ75069.1|  Costars family protein ABRACL                         78.6    9e-17   Phoenicopterus ruber ruber
ref|XP_010306042.1|  PREDICTED: costars family protein ABRACL         78.6    1e-16   Balearica regulorum gibbericeps
ref|XP_007058144.1|  PREDICTED: costars family protein ABRACL         78.6    1e-16   Chelonia mydas [green seaturtle]
ref|XP_005280434.1|  PREDICTED: costars family protein ABRACL iso...  78.6    1e-16   Chrysemys picta bellii
ref|NP_082716.1|  costars family protein ABRACL                       78.6    1e-16   Mus musculus [mouse]
ref|XP_004459985.1|  PREDICTED: costars family protein ABRACL iso...  78.6    1e-16   Dasypus novemcinctus
ref|XP_005518508.1|  PREDICTED: costars family protein ABRACL         78.6    1e-16   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_006197837.1|  PREDICTED: costars family protein ABRACL         78.6    1e-16   Vicugna pacos
ref|XP_005420151.1|  PREDICTED: costars family protein ABRACL         78.6    1e-16   Geospiza fortis
ref|XP_007531554.1|  PREDICTED: costars family protein ABRACL         78.6    1e-16   Erinaceus europaeus [common hedgehog]
ref|XP_010013288.1|  PREDICTED: costars family protein ABRACL         78.6    1e-16   Nestor notabilis
ref|XP_007191007.1|  PREDICTED: costars family protein ABRACL iso...  78.6    1e-16   Balaenoptera acutorostrata scammoni
ref|XP_009876408.1|  PREDICTED: costars family protein ABRACL         78.6    1e-16   Apaloderma vittatum
ref|XP_005017805.1|  PREDICTED: costars family protein ABRACL         78.6    1e-16   
ref|XP_009482515.1|  PREDICTED: costars family protein ABRACL         78.2    1e-16   Pelecanus crispus
ref|XP_009687214.1|  PREDICTED: costars family protein ABRACL iso...  78.2    1e-16   Struthio camelus australis
ref|XP_001764433.1|  predicted protein                                78.2    1e-16   
ref|XP_007191008.1|  PREDICTED: costars family protein ABRACL iso...  78.2    2e-16   Balaenoptera acutorostrata scammoni
ref|XP_008492282.1|  PREDICTED: costars family protein ABRACL         78.2    2e-16   Calypte anna
ref|XP_010182672.1|  PREDICTED: costars family protein ABRACL         78.2    2e-16   Mesitornis unicolor
ref|XP_004459984.1|  PREDICTED: costars family protein ABRACL iso...  78.6    2e-16   
gb|EHB16825.1|  hypothetical protein GW7_19800                        78.2    2e-16   Heterocephalus glaber [naked mole rat]
ref|XP_009996826.1|  PREDICTED: costars family protein ABRACL         77.8    2e-16   Chaetura pelagica
gb|ERE84208.1|  putative costars family protein                       79.7    2e-16   Cricetulus griseus [Chinese hamsters]
ref|XP_007467653.1|  PREDICTED: costars family protein ABRACL         77.8    2e-16   Lipotes vexillifer [baiji]
ref|XP_005489295.1|  PREDICTED: costars family protein ABRACL iso...  77.8    2e-16   Zonotrichia albicollis
ref|XP_007101089.1|  PREDICTED: costars family protein ABRACL         77.8    2e-16   Physeter catodon
ref|XP_004651218.1|  PREDICTED: costars family protein ABRACL         77.8    2e-16   Jaculus jaculus
ref|XP_004263816.1|  PREDICTED: costars family protein ABRACL         77.8    2e-16   Orcinus orca [Orca]
ref|XP_007909195.1|  PREDICTED: costars family protein ABRACL         77.4    3e-16   Callorhinchus milii [Australian ghost shark]
ref|XP_008067195.1|  PREDICTED: costars family protein ABRACL         77.4    3e-16   Carlito syrichta
ref|XP_005154833.1|  PREDICTED: costars family protein ABRACL         77.4    3e-16   Melopsittacus undulatus
ref|XP_005805218.1|  PREDICTED: costars family protein ABRACL-like    77.4    3e-16   Xiphophorus maculatus
ref|XP_003059997.1|  predicted protein                                77.0    4e-16   Micromonas pusilla CCMP1545
ref|XP_009505112.1|  PREDICTED: costars family protein ABRACL         77.0    5e-16   Phalacrocorax carbo [common cormorant]
ref|XP_006013904.1|  PREDICTED: costars family protein ABRACL-like    76.6    7e-16   Latimeria chalumnae
gb|ACO51940.1|  C6orf115                                              76.3    8e-16   Rana catesbeiana [bullfrog]
gb|KDQ20442.1|  hypothetical protein BOTBODRAFT_26447                 76.3    8e-16   Botryobasidium botryosum FD-172 SS1
ref|XP_006898818.1|  PREDICTED: costars family protein ABRACL-like    76.3    8e-16   Elephantulus edwardii [Cape long-eared elephant shrew]
pdb|2L2O|A  Chain A, Solution Structure Of Human Hspc280 Protein      76.3    1e-15   Homo sapiens [man]
gb|EFA82987.1|  hypothetical protein PPL_03765                        75.1    2e-15   Heterostelium album PN500
ref|XP_004350571.1|  hypothetical protein DFA_11624                   75.1    3e-15   Cavenderia fasciculata
ref|XP_644929.1|  hypothetical protein DDB_G0272861                   73.6    9e-15   Dictyostelium discoideum AX4
ref|XP_004347370.1|  hypothetical protein CAOG_04623                  73.2    1e-14   Capsaspora owczarzaki ATCC 30864
gb|KGL85702.1|  Costars family protein ABRACL                         72.4    2e-14   Tinamus guttatus
gb|KII85529.1|  hypothetical protein PLICRDRAFT_166123                72.8    2e-14   Plicaturopsis crispa FD-325 SS-3
gb|EFB26624.1|  hypothetical protein PANDA_000424                     71.6    3e-14   Ailuropoda melanoleuca
ref|XP_010793085.1|  PREDICTED: costars family protein ABRACL         72.0    3e-14   Notothenia coriiceps [yellowbelly rockcod]
gb|EDL03472.1|  mCG7517, isoform CRA_b                                72.0    4e-14   Mus musculus [mouse]
ref|XP_003294793.1|  hypothetical protein DICPUDRAFT_43951            70.5    1e-13   Dictyostelium purpureum
gb|EOB02642.1|  Uncharacterized protein C6orf115                      69.7    2e-13   Anas platyrhynchos [duck]
ref|XP_009985907.1|  PREDICTED: costars family protein ABRACL         69.3    2e-13   Tauraco erythrolophus
gb|KFV18849.1|  Costars family protein ABRACL                         69.3    2e-13   Tauraco erythrolophus
gb|EGV96086.1|  Epithelial cell transforming sequence 2 oncogene-...  74.3    5e-13   Cricetulus griseus [Chinese hamsters]
gb|AAH89921.1|  LOC685045 protein                                     69.3    1e-12   Rattus norvegicus [brown rat]
ref|XP_008869272.1|  hypothetical protein H310_06125                  68.9    1e-12   Aphanomyces invadans
gb|KIM26800.1|  hypothetical protein M408DRAFT_330399                 67.4    2e-12   Serendipita vermifera MAFF 305830
ref|XP_008395555.1|  PREDICTED: costars family protein ABRACL         66.6    3e-12   Poecilia reticulata
ref|XP_004639488.1|  PREDICTED: costars family protein ABRACL-like    66.2    6e-12   
ref|XP_006680866.1|  hypothetical protein BATDEDRAFT_90678            65.9    8e-12   Batrachochytrium dendrobatidis JAM81
ref|XP_009826595.1|  hypothetical protein H257_03965                  65.1    1e-11   Aphanomyces astaci
ref|XP_006373008.1|  hypothetical protein POPTR_0017s06990g           65.1    1e-11   
gb|KDO26616.1|  hypothetical protein SPRG_08020                       65.1    2e-11   Saprolegnia parasitica CBS 223.65
ref|XP_008613602.1|  hypothetical protein SDRG_09447                  64.7    2e-11   Saprolegnia diclina VS20
gb|KIJ27841.1|  hypothetical protein M422DRAFT_37582                  63.5    7e-11   Sphaerobolus stellatus SS14
gb|KIJ35689.1|  hypothetical protein M422DRAFT_34493                  63.2    7e-11   Sphaerobolus stellatus SS14
ref|XP_007380682.1|  hypothetical protein PUNSTDRAFT_50252            62.0    2e-10   Punctularia strigosozonata HHB-11173 SS5
ref|XP_007578289.1|  PREDICTED: costars family protein ABRACL         61.6    4e-10   Poecilia formosa
ref|XP_005711868.1|  unnamed protein product                          62.0    5e-10   Chondrus crispus [carageen]
ref|XP_004335921.1|  hypothetical protein ACA1_364340                 60.1    2e-09   Acanthamoeba castellanii str. Neff
emb|CEF99870.1|  Costars domain                                       59.7    2e-09   Ostreococcus tauri
ref|XP_004992837.1|  hypothetical protein PTSG_05945                  59.7    3e-09   Salpingoeca rosetta
ref|XP_003082307.1|  : chromosome 6 open reading frame 115 (ISS)      59.3    3e-09   
ref|XP_004037464.1|  hypothetical protein IMG5_051560                 57.0    1e-08   Ichthyophthirius multifiliis
ref|XP_007512035.1|  predicted protein                                56.6    2e-08   Bathycoccus prasinos
emb|CCO29730.1|  Costars family protein C6orf115 homolog              56.6    3e-08   Rhizoctonia solani AG-1 IB
ref|XP_005647616.1|  hypothetical protein COCSUDRAFT_15911            55.8    4e-08   Coccomyxa subellipsoidea C-169
gb|KIJ96469.1|  hypothetical protein K443DRAFT_682322                 55.8    4e-08   Laccaria amethystina LaAM-08-1
ref|XP_007851551.1|  costars family protein-like protein              55.5    8e-08   
ref|XP_001420796.1|  predicted protein                                53.5    2e-07   Ostreococcus lucimarinus CCE9901
ref|XP_001742113.1|  hypothetical protein                             53.9    2e-07   Monosiga brevicollis MX1
ref|XP_004992723.1|  hypothetical protein PTSG_05830                  57.4    2e-07   Salpingoeca rosetta
gb|KIK66364.1|  hypothetical protein GYMLUDRAFT_38174                 53.1    4e-07   Gymnopus luxurians FD-317 M1
ref|XP_001749846.1|  hypothetical protein                             55.5    1e-06   Monosiga brevicollis MX1
gb|KDR71025.1|  hypothetical protein GALMADRAFT_254174                51.6    1e-06   Galerina marginata CBS 339.88
ref|XP_002179660.1|  predicted protein                                51.6    2e-06   
ref|XP_008050924.1|  PREDICTED: LOW QUALITY PROTEIN: costars fami...  51.2    2e-06   
ref|XP_005835879.1|  hypothetical protein GUITHDRAFT_105523           50.4    5e-06   
ref|XP_003026251.1|  hypothetical protein SCHCODRAFT_114702           49.7    9e-06   
gb|KIM42687.1|  hypothetical protein M413DRAFT_444360                 48.5    2e-05   
ref|XP_005756890.1|  hypothetical protein EMIHUDRAFT_446656           50.4    2e-05   
gb|KJA16100.1|  hypothetical protein HYPSUDRAFT_148201                46.6    1e-04   
ref|XP_001454917.1|  hypothetical protein                             43.9    8e-04   
ref|XP_001632640.1|  predicted protein                                43.9    9e-04   



>emb|CDO97380.1| unnamed protein product [Coffea canephora]
Length=93

 Score =   105 bits (262),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEVERL+EEIKRLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRKV+ 
Sbjct  1    MNVEEEVERLKEEIKRLGKPQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKVLT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_008454461.1| PREDICTED: costars family protein [Cucumis melo]
Length=95

 Score =   105 bits (262),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV+RL+EEIKRLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+V 
Sbjct  1    MNVEEEVDRLKEEIKRLGKLQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_011087958.1| PREDICTED: costars family protein [Sesamum indicum]
Length=91

 Score =   104 bits (260),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV EEVERL+EEIKRLG+ QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+V 
Sbjct  1    MNVGEEVERLKEEIKRLGQPQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_010254575.1| PREDICTED: costars family protein-like [Nelumbo nucifera]
Length=91

 Score =   103 bits (257),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEE+ERL+EEIKRLG+ Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+VA
Sbjct  1    MNVEEEIERLKEEIKRLGQLQSDGSYKVTFGVLFNDDKCANIFEALVGTLRAAKKRKIVA  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>gb|ABD28547.2| Protein C6orf115, putative [Medicago truncatula]
Length=158

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  30   VRNRHQTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLR  209
            V +R ++ +MNVEEEV RL+EEIKRLGK Q DGSYKVTFG LF+DDQCANIFEALVGTLR
Sbjct  62   VGSRSRSRSMNVEEEVGRLKEEIKRLGKLQSDGSYKVTFGTLFHDDQCANIFEALVGTLR  121

Query  210  AAXKRKVVAYDGELLLQ  260
            AA KRKV+ Y+GELLLQ
Sbjct  122  AAKKRKVLTYEGELLLQ  138



>ref|XP_010691385.1| PREDICTED: costars family protein [Beta vulgaris subsp. vulgaris]
Length=93

 Score =   101 bits (251),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV +L+EEIKRLG+ Q+DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK++ 
Sbjct  1    MNVEEEVGKLQEEIKRLGQIQEDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKILT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>emb|CBI38229.3| unnamed protein product [Vitis vinifera]
Length=86

 Score =   100 bits (250),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV RL+EEI RLGK QDDGSYKVTFGVLF+DD+CANIFEALVGTLRAA KRKVVA
Sbjct  1    MNVEEEVGRLKEEITRLGKIQDDGSYKVTFGVLFHDDRCANIFEALVGTLRAAKKRKVVA  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_003593273.1| hypothetical protein MTR_2g009660 [Medicago truncatula]
 gb|AES63524.1| costars family protein abracl protein [Medicago truncatula]
Length=150

 Score =   102 bits (254),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  30   VRNRHQTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLR  209
            V +R ++ +MNVEEEV RL+EEIKRLGK Q DGSYKVTFG LF+DDQCANIFEALVGTLR
Sbjct  54   VGSRSRSRSMNVEEEVGRLKEEIKRLGKLQSDGSYKVTFGTLFHDDQCANIFEALVGTLR  113

Query  210  AAXKRKVVAYDGELLLQ  260
            AA KRKV+ Y+GELLLQ
Sbjct  114  AAKKRKVLTYEGELLLQ  130



>ref|XP_010645168.1| PREDICTED: LOW QUALITY PROTEIN: costars family protein [Vitis 
vinifera]
Length=93

 Score =   100 bits (250),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV RL+EEI RLGK QDDGSYKVTFGVLF+DD+CANIFEALVGTLRAA KRKVVA
Sbjct  1    MNVEEEVGRLKEEITRLGKIQDDGSYKVTFGVLFHDDRCANIFEALVGTLRAAKKRKVVA  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>gb|KDP29995.1| hypothetical protein JCGZ_18762 [Jatropha curcas]
Length=96

 Score =   100 bits (250),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I+RLGK Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+V YDGELLLQ
Sbjct  14   IERLGKIQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVTYDGELLLQ  68



>ref|XP_004485613.1| PREDICTED: costars family protein-like [Cicer arietinum]
Length=87

 Score =   100 bits (248),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV RL+EEIKRLGK Q DGSYKVTFG LFNDDQCANIFEALVGTLRAA KRKV+ 
Sbjct  1    MNVEEEVGRLKEEIKRLGKLQSDGSYKVTFGTLFNDDQCANIFEALVGTLRAAKKRKVLT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|NP_001050950.1| Os03g0690000 [Oryza sativa Japonica Group]
 sp|Q6AVK1.1|COSA_ORYSJ RecName: Full=Costars family protein [Oryza sativa Japonica Group]
 sp|A2XKU9.1|COSA_ORYSI RecName: Full=Costars family protein [Oryza sativa Indica Group]
 gb|AAT81723.1| striated muscle activator-like protein [Oryza sativa Japonica 
Group]
 gb|ABF98283.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12864.1| Os03g0690000 [Oryza sativa Japonica Group]
 gb|EAY91459.1| hypothetical protein OsI_13088 [Oryza sativa Indica Group]
 gb|EAZ28197.1| hypothetical protein OsJ_12170 [Oryza sativa Japonica Group]
 dbj|BAG88433.1| unnamed protein product [Oryza sativa Japonica Group]
Length=87

 Score =   100 bits (248),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV +L+EEI+RLG++Q DGSYKVTFGV+FNDD+CANIFEALVGTLRAA KRK+V 
Sbjct  1    MNVEEEVGKLKEEIQRLGQKQPDGSYKVTFGVIFNDDRCANIFEALVGTLRAAKKRKIVK  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_010277586.1| PREDICTED: costars family protein [Nelumbo nucifera]
Length=80

 Score = 99.8 bits (247),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            IKRLG+ Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRKVV+Y+GELLLQ
Sbjct  14   IKRLGQLQPDGSYKVTFGVLFNDDKCANIFEALVGTLRAAKKRKVVSYNGELLLQ  68



>ref|XP_009620459.1| PREDICTED: costars family protein [Nicotiana tomentosiformis]
Length=93

 Score =   100 bits (248),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEVERL+EEIKRLG  QDDGSYKVTFGVLF+DD+CANIFEALVGTLRAA KRK++ 
Sbjct  1    MNVEEEVERLKEEIKRLGIAQDDGSYKVTFGVLFHDDRCANIFEALVGTLRAAKKRKILT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_007042821.1| C6orf115, putative [Theobroma cacao]
 gb|EOX98652.1| C6orf115, putative [Theobroma cacao]
Length=92

 Score =   100 bits (248),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV RL+EEI RLGK Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRKV+ 
Sbjct  1    MNVEEEVGRLKEEITRLGKIQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKVLT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_010030000.1| PREDICTED: costars family protein [Eucalyptus grandis]
 gb|KCW56938.1| hypothetical protein EUGRSUZ_I02615 [Eucalyptus grandis]
Length=90

 Score = 99.8 bits (247),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEVERL+EEIKRLGK Q DGSYKVTFGVLF+DD+CANIFEALVGTLRAA KRKV+ 
Sbjct  1    MNVEEEVERLKEEIKRLGKIQADGSYKVTFGVLFHDDKCANIFEALVGTLRAAKKRKVLT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_009792409.1| PREDICTED: costars family protein [Nicotiana sylvestris]
Length=93

 Score = 99.8 bits (247),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEVERL+EEIKRLG  QDDGSYK+TFGVLF+DD+CANIFEALVGTLRAA KRK++ 
Sbjct  1    MNVEEEVERLKEEIKRLGIAQDDGSYKITFGVLFHDDRCANIFEALVGTLRAAKKRKILT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_007159157.1| hypothetical protein PHAVU_002G213700g [Phaseolus vulgaris]
 gb|ESW31151.1| hypothetical protein PHAVU_002G213700g [Phaseolus vulgaris]
Length=87

 Score = 99.4 bits (246),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV+RL++EIKRLG+ Q+DGSYKVTFG LFNDD+CANIFEALVGTLRAA KRKV+ 
Sbjct  1    MNVEEEVQRLKQEIKRLGEVQEDGSYKVTFGTLFNDDECANIFEALVGTLRAAKKRKVLT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_006359368.1| PREDICTED: costars family protein-like [Solanum tuberosum]
 ref|XP_010313068.1| PREDICTED: costars family protein [Solanum lycopersicum]
Length=86

 Score = 99.4 bits (246),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            IKRLG  QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK + YDGELLLQ
Sbjct  14   IKRLGIAQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKFLTYDGELLLQ  68



>ref|XP_010098215.1| hypothetical protein L484_001044 [Morus notabilis]
 gb|EXC43846.1| hypothetical protein L484_001044 [Morus notabilis]
Length=250

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEVERL+EEIKRLGK Q DGSYKVTFGVLF+DD+CANIFEALVGTLRAA KRK VA
Sbjct  1    MNVEEEVERLKEEIKRLGKIQADGSYKVTFGVLFHDDKCANIFEALVGTLRAAKKRKFVA  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_008382197.1| PREDICTED: costars family protein [Malus domestica]
Length=145

 Score =   100 bits (250),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  27   CVRNRHQTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTL  206
            C     ++  MNVEEEVERLREEI+RLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTL
Sbjct  39   CRSEAIKSSAMNVEEEVERLREEIQRLGKLQDDGSYKVTFGVLFNDDRCANIFEALVGTL  98

Query  207  RAAXKRKVVAYDGELLLQ  260
            RAA +RK + YDGELLLQ
Sbjct  99   RAAKRRKFLTYDGELLLQ  116



>ref|XP_010547923.1| PREDICTED: costars family protein ST45-2 [Tarenaya hassleriana]
Length=95

 Score = 99.8 bits (247),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEE+ RL EEI+RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+VA
Sbjct  1    MNVEEEIHRLEEEIQRLGSLQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_008796657.1| PREDICTED: costars family protein [Phoenix dactylifera]
Length=86

 Score = 99.0 bits (245),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV+RL+EEIKRLG+ Q DGSYKV FGVLFNDD+CANIFEALVGTLRAA KR+VV 
Sbjct  1    MNVEEEVDRLKEEIKRLGQHQQDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRRVVT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_006284841.1| hypothetical protein CARUB_v10006123mg [Capsella rubella]
 gb|EOA17739.1| hypothetical protein CARUB_v10006123mg [Capsella rubella]
Length=94

 Score = 99.4 bits (246),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSRQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  237  YDGELLLQ  260
            +DGELLLQ
Sbjct  61   FDGELLLQ  68



>ref|XP_002522688.1| Protein C6orf115, putative [Ricinus communis]
 gb|EEF39775.1| Protein C6orf115, putative [Ricinus communis]
Length=96

 Score = 99.4 bits (246),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEVERLREEI+R+GK Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK++ 
Sbjct  1    MNVEEEVERLREEIQRIGKIQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKILT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_004504856.1| PREDICTED: costars family protein-like [Cicer arietinum]
Length=87

 Score = 99.0 bits (245),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I RLGK Q DGSYKVTFG LF+DD+CANIFEALVGTLRAA KRKVVAYDGELLLQ
Sbjct  15   ITRLGKVQTDGSYKVTFGTLFHDDRCANIFEALVGTLRAAKKRKVVAYDGELLLQ  69



>gb|AFK48356.1| unknown [Medicago truncatula]
Length=88

 Score = 99.0 bits (245),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV RL+EEIKRLGK Q DGSYKVTFG LF+DDQCANIFEALVGTLRAA KRKV+ 
Sbjct  1    MNVEEEVGRLKEEIKRLGKLQSDGSYKVTFGTLFHDDQCANIFEALVGTLRAAKKRKVLT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_003529267.1| PREDICTED: costars family protein-like [Glycine max]
Length=90

 Score = 99.0 bits (245),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV+RL +EIKRLGK Q DGSYKVTFG LFNDD+CANIFEALVGTLRAA KRKV+ 
Sbjct  1    MNVEEEVQRLSQEIKRLGKVQADGSYKVTFGTLFNDDECANIFEALVGTLRAAKKRKVLT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_003531014.1| PREDICTED: costars family protein At4g33640-like [Glycine max]
 gb|KHN46252.1| Costars family protein [Glycine soja]
Length=91

 Score = 99.0 bits (245),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV+RL +EIKRLGK Q DGSYKVTFG LFNDD+CANIFEALVGTLRAA KRKV+ 
Sbjct  1    MNVEEEVQRLSQEIKRLGKVQADGSYKVTFGTLFNDDECANIFEALVGTLRAAKKRKVLT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_002466642.1| hypothetical protein SORBIDRAFT_01g011530 [Sorghum bicolor]
 gb|EER93640.1| hypothetical protein SORBIDRAFT_01g011530 [Sorghum bicolor]
Length=87

 Score = 98.6 bits (244),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV +L+EEI+RLG++Q DGSYKV FGVLFNDD+CANIFEALVGTLRAA KRKV+ 
Sbjct  1    MNVEEEVGKLKEEIQRLGQQQPDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRKVLT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_007201455.1| hypothetical protein PRUPE_ppa013924mg [Prunus persica]
 gb|EMJ02654.1| hypothetical protein PRUPE_ppa013924mg [Prunus persica]
Length=96

 Score = 98.6 bits (244),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEVERL+EEI+RLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK + 
Sbjct  1    MNVEEEVERLKEEIQRLGKVQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKFLT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_011023072.1| PREDICTED: costars family protein [Populus euphratica]
Length=96

 Score = 98.6 bits (244),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEVERL+EEI+RLGK Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK + 
Sbjct  1    MNVEEEVERLKEEIQRLGKVQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKFLT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_009368310.1| PREDICTED: costars family protein [Pyrus x bretschneideri]
Length=97

 Score = 98.6 bits (244),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I+RLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAA +RK + YDGELLLQ
Sbjct  14   IQRLGKLQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKRRKFLTYDGELLLQ  68



>ref|XP_004982127.1| PREDICTED: costars family protein-like [Setaria italica]
Length=87

 Score = 98.2 bits (243),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV +L+EEI+RLG++Q DGSYKV FGVLFNDD+CANIFEALVGTLRAA KRK++ 
Sbjct  1    MNVEEEVGKLKEEIQRLGQQQPDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRKILT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_002309860.1| hypothetical protein POPTR_0007s03140g [Populus trichocarpa]
 gb|EEE90310.1| hypothetical protein POPTR_0007s03140g [Populus trichocarpa]
Length=96

 Score = 98.2 bits (243),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV RL+EEI+RLGK Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK + 
Sbjct  1    MNVEEEVGRLKEEIQRLGKVQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKFLT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_008358397.1| PREDICTED: costars family protein-like [Malus domestica]
Length=97

 Score = 98.2 bits (243),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I+RLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAA +RK + YDGELLLQ
Sbjct  14   IQRLGKLQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKRRKFLTYDGELLLQ  68



>ref|XP_009343817.1| PREDICTED: costars family protein-like [Pyrus x bretschneideri]
Length=95

 Score = 98.2 bits (243),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I+RLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAA +RK + YDGELLLQ
Sbjct  14   IQRLGKLQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKRRKFLTYDGELLLQ  68



>ref|NP_567930.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8LBN7.1|COSA_ARATH RecName: Full=Costars family protein At4g33640 [Arabidopsis thaliana]
 gb|AAM64660.1| unknown [Arabidopsis thaliana]
 gb|ABF58990.1| At4g33640 [Arabidopsis thaliana]
 dbj|BAF01162.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86259.1| uncharacterized protein AT4G33640 [Arabidopsis thaliana]
Length=95

 Score = 98.2 bits (243),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+EE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+VA
Sbjct  1    MNVDEEIQKLEEEIHRLGSRQTDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  237  YDGELLLQ  260
            ++GELLLQ
Sbjct  61   FEGELLLQ  68



>gb|EMS63642.1| hypothetical protein TRIUR3_05750 [Triticum urartu]
 gb|EMT26083.1| hypothetical protein F775_28756 [Aegilops tauschii]
Length=90

 Score = 97.8 bits (242),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I+RLG++Q DGSYKV FGV+FNDD+CANIFEALVGTLRAA KRKVV YDGE+LLQ
Sbjct  17   IQRLGQQQPDGSYKVKFGVIFNDDRCANIFEALVGTLRAAKKRKVVTYDGEMLLQ  71



>emb|CDX68993.1| BnaC01g04600D [Brassica napus]
Length=95

 Score = 97.8 bits (242),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+V+
Sbjct  1    MNVEEEIQKLEEEIHRLGSLQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVS  60

Query  237  YDGELLLQ  260
            + GELLLQ
Sbjct  61   FPGELLLQ  68



>gb|EYU18406.1| hypothetical protein MIMGU_mgv1a017197mg [Erythranthe guttata]
Length=88

 Score = 97.4 bits (241),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV RL+EEI+RLG+ Q DGSYKVTFGVLF+DD+CANIFEALVGTLRAA KRK++ 
Sbjct  1    MNVEEEVGRLKEEIQRLGQSQPDGSYKVTFGVLFHDDRCANIFEALVGTLRAAKKRKILT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_010231394.1| PREDICTED: costars family protein [Brachypodium distachyon]
Length=86

 Score = 97.4 bits (241),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV +L+EEI+RLG++Q DGSYKV FGVLFNDD+CANIFEALVGTLRAA KRK V 
Sbjct  1    MNVEEEVGKLKEEIQRLGQQQPDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRKFVT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_008237249.1| PREDICTED: costars family protein [Prunus mume]
Length=96

 Score = 97.8 bits (242),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I+RLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK + Y+GELLLQ
Sbjct  14   IQRLGKVQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKFLTYEGELLLQ  68



>ref|XP_010432532.1| PREDICTED: costars family protein At4g33640 [Camelina sativa]
Length=91

 Score = 97.4 bits (241),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSRQTDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  237  YDGELLLQ  260
            ++GELLLQ
Sbjct  61   FEGELLLQ  68



>ref|XP_010437738.1| PREDICTED: costars family protein At4g33640-like [Camelina sativa]
Length=92

 Score = 97.4 bits (241),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSRQTDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  237  YDGELLLQ  260
            ++GELLLQ
Sbjct  61   FEGELLLQ  68



>ref|XP_010447216.1| PREDICTED: costars family protein At4g33640-like [Camelina sativa]
Length=93

 Score = 97.4 bits (241),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSRQTDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  237  YDGELLLQ  260
            ++GELLLQ
Sbjct  61   FEGELLLQ  68



>emb|CAA20577.1| putative protein [Arabidopsis thaliana]
 emb|CAB80081.1| putative protein [Arabidopsis thaliana]
Length=161

 Score = 99.4 bits (246),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+EE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+VA
Sbjct  67   MNVDEEIQKLEEEIHRLGSRQTDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  126

Query  237  YDGELLLQ  260
            ++GELLLQ
Sbjct  127  FEGELLLQ  134



>ref|XP_006650425.1| PREDICTED: costars family protein-like [Oryza brachyantha]
Length=87

 Score = 97.4 bits (241),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV +LREEI+RLG++Q DGS KVTFGVLFNDD+CANIFEALVGTLRAA KRK+V 
Sbjct  1    MNVEEEVGKLREEIQRLGQKQPDGSCKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_004290405.1| PREDICTED: costars family protein [Fragaria vesca subsp. vesca]
Length=95

 Score = 97.1 bits (240),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEVERL+EEIKRLGK Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA +RK++ 
Sbjct  1    MNVEEEVERLKEEIKRLGKVQADGSYKVTFGVLFNDDRCANIFEALVGTLRAAKRRKLLT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_006412331.1| hypothetical protein EUTSA_v10026671mg [Eutrema salsugineum]
 sp|B4YYA9.1|COSA_THEHA RecName: Full=Costars family protein ST45-2 [Eutrema halophilum]
 gb|ACF23026.1| ST45-2 [Eutrema halophilum]
 gb|ESQ53784.1| hypothetical protein EUTSA_v10026671mg [Eutrema salsugineum]
Length=92

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSLQSDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  237  YDGELLLQ  260
            + GELLLQ
Sbjct  61   FPGELLLQ  68



>ref|XP_006423704.1| hypothetical protein CICLE_v10029672mg [Citrus clementina]
 ref|XP_006487464.1| PREDICTED: costars family protein ST45-2-like [Citrus sinensis]
 gb|ESR36944.1| hypothetical protein CICLE_v10029672mg [Citrus clementina]
 gb|KDO53981.1| hypothetical protein CISIN_1g034452mg [Citrus sinensis]
Length=94

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEVERL+EEI+RLGK Q DGSYKVTFGVLF+DD+CANIFEALVGTLRAA KRK + 
Sbjct  1    MNVEEEVERLKEEIQRLGKIQPDGSYKVTFGVLFHDDRCANIFEALVGTLRAAKKRKFLT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_009366325.1| PREDICTED: costars family protein-like [Pyrus x bretschneideri]
Length=95

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I+RLG+ QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAA +RK + YDGELLLQ
Sbjct  14   IQRLGQLQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKRRKFLTYDGELLLQ  68



>ref|XP_009120730.1| PREDICTED: costars family protein ST45-2 [Brassica rapa]
 gb|AID60087.1| At4g33640-like protein [Brassica napus]
 emb|CDX75369.1| BnaA01g03330D [Brassica napus]
Length=95

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSLQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  237  YDGELLLQ  260
            + GELLLQ
Sbjct  61   FPGELLLQ  68



>gb|KFK29986.1| hypothetical protein AALP_AA7G203000 [Arabis alpina]
Length=94

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+VA+ GELLLQ
Sbjct  14   IHRLGSVQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVAFPGELLLQ  68



>ref|XP_002867166.1| hypothetical protein ARALYDRAFT_491316 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43425.1| hypothetical protein ARALYDRAFT_491316 [Arabidopsis lyrata subsp. 
lyrata]
Length=93

 Score = 96.3 bits (238),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAA KRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSLQTDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  237  YDGELLLQ  260
            + GELLLQ
Sbjct  61   FQGELLLQ  68



>gb|ACG31036.1| hypothetical protein [Zea mays]
 gb|ACG33628.1| hypothetical protein [Zea mays]
 tpg|DAA50758.1| TPA: hypothetical protein ZEAMMB73_943086 [Zea mays]
Length=87

 Score = 95.9 bits (237),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV RL+EEI RLG++Q DGSYKV FGVLFNDD+CANIFEALVGTLRAA KRK++ 
Sbjct  1    MNVEEEVGRLKEEIHRLGQQQPDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRKILT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_010923309.1| PREDICTED: costars family protein [Elaeis guineensis]
Length=86

 Score = 95.5 bits (236),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV RL+EEI+RLG++Q DGS KV FGVLFNDD+CANIFEALVGTLRAA KRKVV 
Sbjct  1    MNVEEEVGRLKEEIRRLGQQQQDGSCKVKFGVLFNDDRCANIFEALVGTLRAAKKRKVVT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_006852895.1| hypothetical protein AMTR_s00033p00221650 [Amborella trichopoda]
 gb|ERN14362.1| hypothetical protein AMTR_s00033p00221650 [Amborella trichopoda]
Length=95

 Score = 95.9 bits (237),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            IKRLG+ Q+DGSYKV FGVLFNDD+CANIFEALVGTLRAA +RK++ Y+GELLLQ
Sbjct  16   IKRLGQPQNDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKRRKILTYEGELLLQ  70



>gb|ACG47970.1| hypothetical protein [Zea mays]
Length=108

 Score = 95.9 bits (237),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV RL+EEI RLG++Q DGSYKV FGVLFNDD+CANIFEALVGTLRAA KRK++ 
Sbjct  1    MNVEEEVGRLKEEIHRLGQQQPDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRKILT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_009412481.1| PREDICTED: costars family protein [Musa acuminata subsp. malaccensis]
Length=87

 Score = 94.7 bits (234),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV RL+EE++RLG+ Q DGSYKV FGVLFNDD+CANIFEALVGTLRAA KRKVV 
Sbjct  1    MNVEEEVGRLKEEMQRLGQLQPDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRKVVK  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_003608396.1| hypothetical protein MTR_4g093660 [Medicago truncatula]
 gb|AES90593.1| costars family protein abracl protein [Medicago truncatula]
Length=87

 Score = 94.4 bits (233),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            IKRLG  Q DGS KVTFG LF+DD+CANIFEALVGTLRAA KRKVVAYDGELLLQ
Sbjct  14   IKRLGNVQTDGSCKVTFGTLFHDDRCANIFEALVGTLRAAKKRKVVAYDGELLLQ  68



>sp|A9NK39.1|COSA_PICSI RecName: Full=Costars family protein WS02710_H03 [Picea sitchensis]
 gb|ABK21000.1| unknown [Picea sitchensis]
Length=95

 Score = 93.2 bits (230),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            T+NV+EEVERL+EEIKRL + + DGSY V FGVLF+DD+CANIFEALVGTLRAA KRKVV
Sbjct  2    TLNVDEEVERLKEEIKRLAQPRPDGSYVVKFGVLFSDDRCANIFEALVGTLRAAKKRKVV  61

Query  234  AYDGELLLQ  260
             YDGELLLQ
Sbjct  62   TYDGELLLQ  70



>ref|XP_004147507.1| PREDICTED: costars family protein-like [Cucumis sativus]
 ref|XP_004163936.1| PREDICTED: costars family protein-like [Cucumis sativus]
Length=120

 Score = 91.7 bits (226),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 66/93 (71%), Gaps = 25/93 (27%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYK-------------------------VTFGVLFN  161
            MNVEEEVERL+EEIKRLGK QDDGSYK                         VTFGVLFN
Sbjct  1    MNVEEEVERLKEEIKRLGKLQDDGSYKITFLIAQNQICLPMPITCLMFCHYWVTFGVLFN  60

Query  162  DDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            DD+CANIFEALVGTLRAA KRK+V+YDGELLLQ
Sbjct  61   DDRCANIFEALVGTLRAAKKRKIVSYDGELLLQ  93



>ref|XP_009062533.1| hypothetical protein LOTGIDRAFT_207050 [Lottia gigantea]
 gb|ESO86839.1| hypothetical protein LOTGIDRAFT_207050 [Lottia gigantea]
Length=82

 Score = 90.5 bits (223),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV  L EEIKRLG +  +G Y+VTFGVLFNDD+CANIFEALVGTLRAA ++K+V 
Sbjct  1    MNVEHEVNLLVEEIKRLGTQNGNGQYEVTFGVLFNDDRCANIFEALVGTLRAAKRKKIVT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_005102609.1| PREDICTED: costars family protein ABRACL-like isoform X1 [Aplysia 
californica]
 ref|XP_005102610.1| PREDICTED: costars family protein ABRACL-like isoform X2 [Aplysia 
californica]
Length=79

 Score = 88.6 bits (218),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            IKRLGKE  DG  +VTFG LFNDD+CAN+FEALVGTLRAA ++K++ YDGELLLQ
Sbjct  14   IKRLGKEGSDGKCEVTFGALFNDDKCANLFEALVGTLRAAKRKKIIKYDGELLLQ  68



>ref|XP_002131888.1| PREDICTED: costars family protein ABRACL-like [Ciona intestinalis]
Length=82

 Score = 87.8 bits (216),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV+ L EEIKRLGK+  DG + VTFGVLF+DD+CANIFEALVGTLRAA ++K+V 
Sbjct  1    MNVDHEVKLLVEEIKRLGKQNADGQFVVTFGVLFSDDRCANIFEALVGTLRAAKRKKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YTGELLLQ  68



>ref|XP_002963364.1| hypothetical protein SELMODRAFT_8583, partial [Selaginella moellendorffii]
 gb|EFJ35235.1| hypothetical protein SELMODRAFT_8583, partial [Selaginella moellendorffii]
Length=80

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVEEEV RLR EI+RLG  Q DGS  V FG+LFNDD+CAN+FEALVGTLRAA KRK++ 
Sbjct  1    MNVEEEVGRLRLEIERLGTVQPDGSTVVKFGILFNDDRCANLFEALVGTLRAAKKRKLLT  60

Query  237  YDGELLLQ  260
            YDGELLLQ
Sbjct  61   YDGELLLQ  68



>ref|XP_008311631.1| PREDICTED: costars family protein ABRACL [Cynoglossus semilaevis]
Length=81

 Score = 85.9 bits (211),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV  EV  L EEI+RLG E  DG+  V FGVLFNDD+CANIFEALVGTLRAA K+K+V 
Sbjct  1    MNVAHEVNMLVEEIQRLGTENADGNISVKFGVLFNDDRCANIFEALVGTLRAAKKKKIVD  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YKGELLLQ  68



>ref|XP_011423954.1| PREDICTED: costars family protein ABRACL-like [Crassostrea gigas]
 ref|XP_011423955.1| PREDICTED: costars family protein ABRACL-like [Crassostrea gigas]
Length=83

 Score = 85.5 bits (210),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EVE L EEIKRLG    DG   VTFG LF+DD+CANIFEALVGTLRAA ++KVV 
Sbjct  1    MNVQHEVELLIEEIKRLGSPDADGKVSVTFGTLFSDDRCANIFEALVGTLRAAKRKKVVT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>dbj|GAM18052.1| hypothetical protein SAMD00019534_012270 [Acytostelium subglobosum 
LB1]
Length=83

 Score = 85.5 bits (210),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L  EIKRLG  Q +G+  V FGVLFNDDQ ANIFEALVGTL+AA KRK++ 
Sbjct  1    MNVDHEVTLLIREIKRLGTAQPNGTTVVKFGVLFNDDQVANIFEALVGTLKAAKKRKIIN  60

Query  237  YDGELLLQ  260
            YDGE+LLQ
Sbjct  61   YDGEILLQ  68



>ref|XP_003971945.1| PREDICTED: costars family protein ABRACL-like [Takifugu rubripes]
Length=81

 Score = 84.3 bits (207),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV  E+E L EEIKRLG +  DG   V FGVLFNDD+CANIFEALVGTL+AA KRK+++
Sbjct  1    MNVSHEIELLMEEIKRLGSKNADGQTCVKFGVLFNDDRCANIFEALVGTLKAAKKRKLIS  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|NP_998807.1| costars family protein ABRACL [Danio rerio]
 sp|Q6TGV7.1|ABRAL_DANRE RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Danio rerio]
 gb|AAQ97832.1| hypothetical protein PRO2013 [Danio rerio]
 gb|AAH97017.1| C6orf115 homolog (H. sapiens) [Danio rerio]
Length=81

 Score = 84.0 bits (206),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV  L +EI+RLG +  DG   V FGVLFNDDQCAN+FEALVGTL+AA ++KV+ 
Sbjct  1    MNVEHEVSLLIDEIRRLGSKNADGKTSVKFGVLFNDDQCANLFEALVGTLKAAKRKKVIT  60

Query  237  YDGELLLQ  260
            +DGELLLQ
Sbjct  61   FDGELLLQ  68



>ref|XP_008112706.1| PREDICTED: costars family protein ABRACL isoform X1 [Anolis carolinensis]
Length=96

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKV  230
             TMNVE E+  L EEI+RLG +  DG+  V FGVLF D++CAN+FEALVGTL+AA +RK+
Sbjct  14   ATMNVEHEISLLVEEIQRLGTKNPDGTLSVKFGVLFADEKCANLFEALVGTLKAAKRRKI  73

Query  231  VAYDGELLLQ  260
            V+Y GELLLQ
Sbjct  74   VSYPGELLLQ  83



>ref|XP_002974652.1| hypothetical protein SELMODRAFT_8582, partial [Selaginella moellendorffii]
 gb|EFJ24172.1| hypothetical protein SELMODRAFT_8582, partial [Selaginella moellendorffii]
Length=80

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I+RLG    DGS  V FG+LFNDD+CAN+FEALVGTLRAA KRK++ YDGELLLQ
Sbjct  14   IERLGTVLPDGSTVVKFGILFNDDRCANLFEALVGTLRAAKKRKLLTYDGELLLQ  68



>gb|ETO27738.1| hypothetical protein RFI_09392 [Reticulomyxa filosa]
Length=100

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            IKRLGK   +G Y VTF  +FND+QCANIFEALVGTL+AA KRKV+ Y G++LLQ
Sbjct  18   IKRLGKPNSNGKYSVTFKTIFNDEQCANIFEALVGTLKAAKKRKVIDYQGQILLQ  72



>ref|NP_001165090.1| costars family protein ABRACL [Xenopus laevis]
 sp|Q498C5.1|ABRAL_XENLA RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Xenopus laevis]
 gb|AAI00274.1| MGC116503 protein [Xenopus laevis]
Length=81

 Score = 82.8 bits (203),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I+RLG + +DG + V FGVLF+DD+CAN+FEALVGTL+AA KRK++ Y GELLLQ
Sbjct  14   IRRLGSKGNDGKFSVKFGVLFSDDKCANLFEALVGTLKAAKKRKIITYQGELLLQ  68



>ref|NP_001154032.1| CF115 protein [Oncorhynchus mykiss]
 sp|B5X8A5.1|ABRAL_SALSA RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Salmo salar]
 gb|ACI67075.1| C6orf115 [Salmo salar]
 gb|ACM08715.1| C6orf115 [Salmo salar]
 gb|ACM09336.1| C6orf115 [Salmo salar]
 gb|ACO07598.1| C6orf115 [Oncorhynchus mykiss]
 gb|ADM16247.1| C6orf115 [Salmo salar]
 emb|CDQ64641.1| unnamed protein product [Oncorhynchus mykiss]
Length=81

 Score = 82.4 bits (202),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L  EI+RLG +  DG   V FGVLFNDD+CANIFEALVGTLRAA ++K++A
Sbjct  1    MNVQHEVSLLVGEIQRLGSKNADGQTCVKFGVLFNDDRCANIFEALVGTLRAAKRKKIIA  60

Query  237  YDGELLLQ  260
            ++GELLLQ
Sbjct  61   FEGELLLQ  68



>ref|XP_002505679.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66937.1| predicted protein [Micromonas sp. RCC299]
Length=82

 Score = 82.4 bits (202),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I+RLG E  DG   V FGVLF DD+CANIFEALVGTLRAA KRKV+ ++GE+LLQ
Sbjct  16   IRRLGSEGPDGKIAVKFGVLFADDRCANIFEALVGTLRAAKKRKVIHFEGEMLLQ  70



>ref|XP_003446311.1| PREDICTED: costars family protein ABRACL-like isoform X1 [Oreochromis 
niloticus]
 ref|XP_005475126.1| PREDICTED: costars family protein ABRACL-like isoform X2 [Oreochromis 
niloticus]
Length=81

 Score = 82.4 bits (202),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV  E++ L +EI+RLG +  DG + V FGVLFNDD+CANIFEALVGTL+AA K+KV+ 
Sbjct  1    MNVSHEIDLLVQEIQRLGSKNADGKFSVKFGVLFNDDRCANIFEALVGTLKAAKKKKVID  60

Query  237  YDGELLLQ  260
            + GELLLQ
Sbjct  61   FQGELLLQ  68



>gb|KFQ69396.1| Costars family protein ABRACL, partial [Phaethon lepturus]
Length=82

 Score = 82.4 bits (202),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEISLLVEEIQRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
            AY GELLLQ
Sbjct  61   AYQGELLLQ  69



>ref|XP_002158724.1| PREDICTED: costars family protein ABRACL-like [Hydra vulgaris]
Length=84

 Score = 82.4 bits (202),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV  EVE L +EIKRLG +  DG Y+V FG +FND +CANIFEALVGTLRAA ++KVV 
Sbjct  1    MNVAHEVELLVQEIKRLGTKNKDGQYEVLFGKIFNDTRCANIFEALVGTLRAAKRKKVVT  60

Query  237  YDGELLLQ  260
            ++GELLLQ
Sbjct  61   FEGELLLQ  68



>ref|NP_001165089.1| costars family protein ABRACL [Xenopus (Silurana) tropicalis]
 sp|A4IHJ3.1|ABRAL_XENTR RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Xenopus (Silurana) tropicalis]
 gb|AAI35555.1| LOC100124856 protein [Xenopus (Silurana) tropicalis]
Length=81

 Score = 82.0 bits (201),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI+RLG + +DG   V FGVLF+DD+CAN+FEALVGTL+AA KRK+V 
Sbjct  1    MNVDHEVNLLVEEIRRLGSKGNDGKLSVKFGVLFSDDKCANLFEALVGTLKAAKKRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>gb|KFR07389.1| Costars family protein ABRACL, partial [Opisthocomus hoazin]
Length=82

 Score = 82.0 bits (201),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
            AY GELLLQ
Sbjct  61   AYQGELLLQ  69



>ref|XP_003387508.1| PREDICTED: costars family protein ABRACL-like [Amphimedon queenslandica]
Length=81

 Score = 82.0 bits (201),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EVE L  EIKRLG +  DG Y VTFG LF DD+CAN+FEALVGTL+AA ++K+V 
Sbjct  1    MNVEHEVELLVGEIKRLGTQNADGQYVVTFGTLFADDKCANLFEALVGTLKAAKRKKIVK  60

Query  237  YDGELLLQ  260
            YD E+LLQ
Sbjct  61   YDAEILLQ  68



>ref|XP_010737667.1| PREDICTED: costars family protein ABRACL [Larimichthys crocea]
Length=81

 Score = 81.6 bits (200),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV+ L EEI+RLG +  DG   V FGVLF+DD+CANIFEALVGTL+AA KRKVV+
Sbjct  1    MNVEHEVKLLVEEIQRLGTKNADGQTTVKFGVLFSDDRCANIFEALVGTLKAAKKRKVVS  60

Query  237  YDGELLLQ  260
            Y  ELLLQ
Sbjct  61   YQAELLLQ  68



>gb|KFQ35820.1| Costars family protein ABRACL, partial [Merops nubicus]
Length=82

 Score = 81.6 bits (200),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEISLLVEEIQRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
            +Y+GELLLQ
Sbjct  61   SYEGELLLQ  69



>gb|KFZ52453.1| Costars family protein ABRACL, partial [Caprimulgus carolinensis]
Length=82

 Score = 81.6 bits (200),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEINLLVEEIRRLGTKNADGQVSVKFGVLFADDKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>gb|AAQ55814.1| hypothetical protein [Coturnix coturnix]
Length=108

 Score = 82.4 bits (202),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +3

Query  39   RHQTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAX  218
            R +  TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA 
Sbjct  22   RWERTTMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAK  81

Query  219  KRKVVAYDGELLLQ  260
            +RK+V Y GELLLQ
Sbjct  82   RRKIVTYQGELLLQ  95



>gb|ACO09013.1| C6orf115 [Osmerus mordax]
Length=81

 Score = 81.6 bits (200),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI+RLG +  DG   V FGVLF+DD+CANIFEALVGTLRAA ++K+V 
Sbjct  1    MNVQHEVSLLVEEIQRLGSKNADGKTSVKFGVLFSDDRCANIFEALVGTLRAAKRKKIVT  60

Query  237  YDGELLLQ  260
            ++GELLLQ
Sbjct  61   FEGELLLQ  68



>gb|KFQ08843.1| Costars family protein ABRACL, partial [Leptosomus discolor]
Length=82

 Score = 81.6 bits (200),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
            +Y GELLLQ
Sbjct  61   SYQGELLLQ  69



>gb|KGL81992.1| Costars family protein ABRACL, partial [Tinamus guttatus]
Length=82

 Score = 81.3 bits (199),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE EV  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RKVV
Sbjct  1    TMNVEHEVNLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKVV  60

Query  234  AYDGELLLQ  260
            +Y GELLLQ
Sbjct  61   SYQGELLLQ  69



>ref|XP_009687213.1| PREDICTED: costars family protein ABRACL isoform X1 [Struthio 
camelus australis]
Length=105

 Score = 82.0 bits (201),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +3

Query  39   RHQT-GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAA  215
            RH +  TMNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA
Sbjct  18   RHSSKNTMNVEHEINLLVEEIQRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAA  77

Query  216  XKRKVVAYDGELLLQ  260
             +RK+V+Y GELLLQ
Sbjct  78   KRRKIVSYQGELLLQ  92



>ref|XP_003223326.1| PREDICTED: costars family protein ABRACL isoform X2 [Anolis carolinensis]
 ref|XP_008112707.1| PREDICTED: costars family protein ABRACL isoform X2 [Anolis carolinensis]
 ref|XP_008112708.1| PREDICTED: costars family protein ABRACL isoform X2 [Anolis carolinensis]
 ref|XP_008112709.1| PREDICTED: costars family protein ABRACL isoform X2 [Anolis carolinensis]
 ref|XP_008112710.1| PREDICTED: costars family protein ABRACL isoform X2 [Anolis carolinensis]
Length=81

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG+  V FGVLF D++CAN+FEALVGTL+AA +RK+V+
Sbjct  1    MNVEHEISLLVEEIQRLGTKNPDGTLSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVS  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>gb|EMC83349.1| UPF0727 protein C6orf115 like protein, partial [Columba livia]
Length=83

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  2    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  61

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  62   TYPGELLLQ  70



>ref|XP_010880879.1| PREDICTED: costars family protein ABRACL [Esox lucius]
 gb|ACO13801.1| C6orf115 [Esox lucius]
Length=81

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L +EI+RLG +  DG   V FGVLFNDD+CANIFEALVGTLRAA ++K++ 
Sbjct  1    MNVQHEVSLLVDEIQRLGSKNADGKMCVKFGVLFNDDRCANIFEALVGTLRAAKRKKIIT  60

Query  237  YDGELLLQ  260
            ++GELLLQ
Sbjct  61   FEGELLLQ  68



>gb|KFV63720.1| Costars family protein ABRACL, partial [Picoides pubescens]
Length=82

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGRVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
             Y+GELLLQ
Sbjct  61   TYNGELLLQ  69



>ref|XP_007423586.1| PREDICTED: costars family protein ABRACL isoform X1 [Python bivittatus]
 ref|XP_007423587.1| PREDICTED: costars family protein ABRACL isoform X2 [Python bivittatus]
 gb|ETE71276.1| hypothetical protein L345_02896 [Ophiophagus hannah]
Length=81

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG+  V FGVLF D++CAN+FEALVGTL+AA +RK+V+
Sbjct  1    MNVEHEINLLVEEIRRLGTKNPDGTLSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVS  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_004636782.1| PREDICTED: costars family protein ABRACL-like [Octodon degus]
Length=81

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG + V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKFSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YSGELLLQ  68



>gb|KFO73634.1| Costars family protein ABRACL, partial [Cuculus canorus]
 gb|KFP40603.1| Costars family protein ABRACL, partial [Chlamydotis macqueenii]
 gb|KGL91071.1| Costars family protein ABRACL, partial [Charadrius vociferus]
Length=82

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>gb|KFM09004.1| Costars family protein ABRACL, partial [Aptenodytes forsteri]
 gb|KFO60897.1| Costars family protein ABRACL, partial [Corvus brachyrhynchos]
 gb|KFO83467.1| Costars family protein ABRACL, partial [Buceros rhinoceros silvestris]
 gb|KFP20518.1| Costars family protein ABRACL, partial [Egretta garzetta]
 gb|KFP46725.1| Costars family protein ABRACL, partial [Cathartes aura]
 gb|KFP57947.1| Costars family protein ABRACL, partial [Cariama cristata]
 gb|KFP76783.1| Costars family protein ABRACL, partial [Acanthisitta chloris]
 gb|KFQ93630.1| Costars family protein ABRACL, partial [Nipponia nippon]
 gb|KFV02017.1| Costars family protein ABRACL, partial [Pterocles gutturalis]
 gb|KFV42367.1| Costars family protein ABRACL, partial [Gavia stellata]
 gb|KFW04301.1| Costars family protein ABRACL, partial [Fulmarus glacialis]
 gb|KFW63685.1| Costars family protein ABRACL, partial [Pygoscelis adeliae]
 gb|KFW88410.1| Costars family protein ABRACL, partial [Manacus vitellinus]
Length=82

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>gb|KFV46510.1| Costars family protein ABRACL, partial [Tyto alba]
Length=82

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>gb|KFZ55568.1| Costars family protein ABRACL, partial [Podiceps cristatus]
Length=82

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RKVV
Sbjct  1    TMNVEHEINLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKVV  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>ref|XP_783554.1| PREDICTED: costars family protein ABRACL-like [Strongylocentrotus 
purpuratus]
Length=79

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV+ L EE+KRLG+   DG   V FGVLF DD+CAN+FEALVGTLRAA ++K+V 
Sbjct  1    MNVEHEVQLLVEEMKRLGEPNADGKVAVKFGVLFADDRCANLFEALVGTLRAAKRKKIVT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_004628595.1| PREDICTED: costars family protein ABRACL [Octodon degus]
Length=81

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG + V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKFSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_007649289.1| PREDICTED: costars family protein ABRACL isoform X1 [Cricetulus 
griseus]
 ref|XP_007631501.1| PREDICTED: costars family protein ABRACL isoform X1 [Cricetulus 
griseus]
Length=90

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  45   QTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKR  224
            Q   MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +R
Sbjct  6    QCSAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRR  65

Query  225  KVVAYDGELLLQ  260
            K+V Y GELLLQ
Sbjct  66   KIVTYTGELLLQ  77



>gb|EDL03471.1| mCG7517, isoform CRA_a [Mus musculus]
 gb|EDL93764.1| rCG57402, isoform CRA_a [Rattus norvegicus]
Length=90

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  45   QTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKR  224
            Q   MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +R
Sbjct  6    QRSAMNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRR  65

Query  225  KVVAYDGELLLQ  260
            K+V Y GELLLQ
Sbjct  66   KIVTYAGELLLQ  77



>gb|KFW11356.1| Costars family protein ABRACL, partial [Eurypyga helias]
Length=82

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQMSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>gb|KFO13502.1| Costars family protein ABRACL, partial [Balearica regulorum gibbericeps]
Length=82

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEINLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>ref|XP_002714893.1| PREDICTED: costars family protein ABRACL [Oryctolagus cuniculus]
 ref|XP_008261798.1| PREDICTED: costars family protein ABRACL [Oryctolagus cuniculus]
Length=81

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RKVV 
Sbjct  1    MNVEHEVNLLVEEIHRLGSKNADGKISVKFGVLFQDDKCANLFEALVGTLKAAKRRKVVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>gb|KFQ49984.1| Costars family protein ABRACL, partial [Nestor notabilis]
Length=82

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE EV  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA +RK++
Sbjct  1    TMNVEHEVSLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKII  60

Query  234  AYDGELLLQ  260
            +Y GELLLQ
Sbjct  61   SYQGELLLQ  69



>gb|KFQ52259.1| Costars family protein ABRACL, partial [Pelecanus crispus]
Length=82

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>ref|XP_001640937.1| predicted protein [Nematostella vectensis]
 sp|A7RHL5.1|COSA_NEMVE RecName: Full=Costars family protein v1g158749 [Nematostella 
vectensis]
 gb|EDO48874.1| predicted protein [Nematostella vectensis]
Length=82

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV+ L EE+KRLG+   D    V FGVLFNDD+CANIFEALVGTL+AA ++K+V 
Sbjct  1    MNVEHEVKLLVEELKRLGQPNSDDKIVVKFGVLFNDDRCANIFEALVGTLKAAKRKKIVH  60

Query  237  YDGELLLQ  260
            YD ELLLQ
Sbjct  61   YDSELLLQ  68



>gb|KFP80599.1| Costars family protein ABRACL, partial [Apaloderma vittatum]
Length=82

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK++
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKII  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>gb|KFP31952.1| Costars family protein ABRACL, partial [Colius striatus]
Length=82

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK++
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKII  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>gb|KGN53893.1| hypothetical protein Csa_4G182240 [Cucumis sativus]
Length=91

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +3

Query  135  KVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
             VTFGVLFNDD+CANIFEALVGTLRAA KRK+V+YDGELLLQ
Sbjct  23   PVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVSYDGELLLQ  64



>ref|XP_010284041.1| PREDICTED: costars family protein ABRACL [Phaethon lepturus]
Length=81

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+VA
Sbjct  1    MNVEHEISLLVEEIQRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVA  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|NP_001134634.1| costars family protein ABRACL [Salmo salar]
 gb|ACI68284.1| C6orf115 [Salmo salar]
Length=81

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L  EI+RLG +  DG   V FGVLFNDD+CANIFEALVGTLRAA ++K++A
Sbjct  1    MNVQHEVSLLVGEIQRLGSKNADGQTCVKFGVLFNDDRCANIFEALVGTLRAAKRKKIIA  60

Query  237  YDGELLLQ  260
            ++GEL LQ
Sbjct  61   FEGELPLQ  68



>gb|KFV88505.1| Costars family protein ABRACL, partial [Struthio camelus australis]
Length=82

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEINLLVEEIQRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
            +Y GELLLQ
Sbjct  61   SYQGELLLQ  69



>ref|XP_002817467.1| PREDICTED: costars family protein ABRACL [Pongo abelii]
Length=81

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF+DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFHDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_006642989.1| PREDICTED: costars family protein ABRACL-like [Lepisosteus oculatus]
Length=81

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV  L +EI+RLG    DG   V FGVLFNDD+CAN+FEALVGTL+AA ++K+V 
Sbjct  1    MNVEHEVSLLADEIRRLGSPNADGKISVKFGVLFNDDKCANLFEALVGTLKAAKRKKIVT  60

Query  237  YDGELLLQ  260
            + GELLLQ
Sbjct  61   FQGELLLQ  68



>ref|XP_009930257.1| PREDICTED: costars family protein ABRACL [Opisthocomus hoazin]
Length=81

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA +RK+VA
Sbjct  1    MNVEHEISLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVA  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_004550622.1| PREDICTED: costars family protein ABRACL-like [Maylandia zebra]
 ref|XP_005737337.1| PREDICTED: costars family protein ABRACL-like isoform X1 [Pundamilia 
nyererei]
 ref|XP_005931598.1| PREDICTED: costars family protein ABRACL-like [Haplochromis burtoni]
 ref|XP_006792768.1| PREDICTED: costars family protein ABRACL-like [Neolamprologus 
brichardi]
Length=81

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV  E++ L +EI+RLG +  DG   V FGVLFNDD+CANIFEALVGTL+AA K+KV+ 
Sbjct  1    MNVSHEIDLLVQEIQRLGSKNADGKCSVKFGVLFNDDRCANIFEALVGTLKAAKKKKVID  60

Query  237  YDGELLLQ  260
            + GELLLQ
Sbjct  61   FQGELLLQ  68



>gb|KFQ22819.1| Costars family protein ABRACL, partial [Mesitornis unicolor]
Length=82

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEIGLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>ref|XP_004609058.1| PREDICTED: costars family protein ABRACL [Sorex araneus]
Length=81

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA KRK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKKRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YTGELLLQ  68



>ref|XP_008820248.1| PREDICTED: costars family protein ABRACL [Nannospalax galili]
Length=81

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI+RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIQRLGSKNTDGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_006885004.1| PREDICTED: costars family protein ABRACL [Elephantulus edwardii]
Length=81

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V+
Sbjct  1    MNVDHEVSLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVS  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>gb|KFP01035.1| Costars family protein ABRACL, partial [Calypte anna]
Length=82

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEIGLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>ref|XP_007245508.1| PREDICTED: costars family protein ABRACL [Astyanax mexicanus]
Length=113

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV  L EEI+RLG +  DG   V FGVLF+DD+CAN+FEALVGTL+AA ++KV+ 
Sbjct  33   MNVEHEVTLLVEEIRRLGSKNSDGKTSVKFGVLFSDDKCANLFEALVGTLKAAKRKKVIM  92

Query  237  YDGELLLQ  260
            ++GELLLQ
Sbjct  93   FEGELLLQ  100



>gb|EPQ03269.1| hypothetical protein D623_10035727 [Myotis brandtii]
Length=90

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   TGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRK  227
               MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK
Sbjct  7    VAAMNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRK  66

Query  228  VVAYDGELLLQ  260
            +V Y GELLLQ
Sbjct  67   IVTYPGELLLQ  77



>ref|XP_008689265.1| PREDICTED: costars family protein ABRACL [Ursus maritimus]
Length=203

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  33   RNRHQTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRA  212
            R +  +  MNV+ E+  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+A
Sbjct  115  RKKGGSAAMNVDHEINLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKA  174

Query  213  AXKRKVVAYDGELLLQ  260
            A +RK+V Y GELLLQ
Sbjct  175  AKRRKIVTYPGELLLQ  190



>ref|XP_005043771.1| PREDICTED: costars family protein ABRACL [Ficedula albicollis]
Length=81

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADDKCANLFEALVGTLKAAKRRKIIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_005329869.1| PREDICTED: costars family protein ABRACL [Ictidomys tridecemlineatus]
Length=81

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RKVV 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKVVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_004368930.1| PREDICTED: costars family protein ABRACL [Trichechus manatus 
latirostris]
Length=81

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V+
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVS  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>gb|KFU90284.1| Costars family protein ABRACL, partial [Chaetura pelagica]
Length=82

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   NYQGELLLQ  69



>ref|XP_008304863.1| PREDICTED: costars family protein ABRACL-like [Stegastes partitus]
 ref|XP_008304865.1| PREDICTED: costars family protein ABRACL-like [Stegastes partitus]
 ref|XP_008304867.1| PREDICTED: costars family protein ABRACL-like [Stegastes partitus]
 ref|XP_008304868.1| PREDICTED: costars family protein ABRACL-like [Stegastes partitus]
Length=81

 Score = 79.7 bits (195),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I+RLG +  DG   V FGVLF+DD+CANIFEALVGTL+AA KRKV+ + GELLLQ
Sbjct  14   IQRLGSKNADGQTSVKFGVLFSDDRCANIFEALVGTLKAAKKRKVINFQGELLLQ  68



>ref|XP_003986651.1| PREDICTED: costars family protein ABRACL [Felis catus]
 ref|XP_006932115.1| PREDICTED: costars family protein ABRACL [Felis catus]
 ref|XP_007096440.1| PREDICTED: costars family protein ABRACL isoform X1 [Panthera 
tigris altaica]
 ref|XP_007096441.1| PREDICTED: costars family protein ABRACL isoform X2 [Panthera 
tigris altaica]
Length=81

 Score = 79.7 bits (195),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RKVV 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKVVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_003204212.1| PREDICTED: costars family protein ABRACL [Meleagris gallopavo]
Length=81

 Score = 79.7 bits (195),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF+D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFSDEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_005361042.1| PREDICTED: costars family protein ABRACL isoform X1 [Microtus 
ochrogaster]
 ref|XP_005361043.1| PREDICTED: costars family protein ABRACL isoform X2 [Microtus 
ochrogaster]
Length=81

 Score = 79.7 bits (195),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI+RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIRRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YTGELLLQ  68



>ref|XP_010176388.1| PREDICTED: costars family protein ABRACL [Caprimulgus carolinensis]
Length=81

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEINLLVEEIRRLGTKNADGQVSVKFGVLFADDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_005280433.1| PREDICTED: costars family protein ABRACL isoform X1 [Chrysemys 
picta bellii]
Length=127

 Score = 80.9 bits (198),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  46   TMNVEHEINLLVEEIRRLGTKNADGKLSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  105

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  106  TYPGELLLQ  114



>ref|XP_005859127.1| PREDICTED: costars family protein ABRACL [Myotis brandtii]
 ref|XP_006084472.1| PREDICTED: costars family protein ABRACL [Myotis lucifugus]
 ref|XP_008160128.1| PREDICTED: costars family protein ABRACL [Eptesicus fuscus]
Length=81

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_008945039.1| PREDICTED: costars family protein ABRACL [Merops nubicus]
Length=81

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V+
Sbjct  1    MNVEHEISLLVEEIQRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVS  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_005065907.1| PREDICTED: costars family protein ABRACL [Mesocricetus auratus]
Length=81

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVSLLVEEIHRLGSKNADGKLSVKFGVLFRDDRCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YSGELLLQ  68



>ref|XP_002912685.1| PREDICTED: costars family protein ABRACL [Ailuropoda melanoleuca]
Length=81

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEINLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_004702032.1| PREDICTED: costars family protein ABRACL [Echinops telfairi]
Length=81

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKISVKFGVLFQDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YSGELLLQ  68



>ref|XP_004587333.1| PREDICTED: costars family protein ABRACL [Ochotona princeps]
Length=81

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKISVKFGVLFQDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_006834682.1| PREDICTED: costars family protein ABRACL [Chrysochloris asiatica]
Length=81

 Score = 79.3 bits (194),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|NP_001180288.1| uncharacterized protein LOC708266 [Macaca mulatta]
 ref|XP_003898153.1| PREDICTED: costars family protein ABRACL [Papio anubis]
 ref|XP_005552041.1| PREDICTED: costars family protein ABRACL [Macaca fascicularis]
 ref|XP_008005042.1| PREDICTED: costars family protein ABRACL isoform X3 [Chlorocebus 
sabaeus]
 ref|XP_010377821.1| PREDICTED: costars family protein ABRACL [Rhinopithecus roxellana]
 gb|EHH18651.1| hypothetical protein EGK_15299 [Macaca mulatta]
 gb|EHH53346.1| hypothetical protein EGM_13967 [Macaca fascicularis]
Length=81

 Score = 79.3 bits (194),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YSGELLLQ  68



>ref|XP_008005040.1| PREDICTED: costars family protein ABRACL isoform X2 [Chlorocebus 
sabaeus]
Length=109

 Score = 80.1 bits (196),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  45   QTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKR  224
            +   MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +R
Sbjct  25   RMAAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRR  84

Query  225  KVVAYDGELLLQ  260
            K+V Y GELLLQ
Sbjct  85   KIVTYSGELLLQ  96



>ref|XP_010219792.1| PREDICTED: costars family protein ABRACL [Tinamus guttatus]
Length=81

 Score = 79.3 bits (194),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RKVV+
Sbjct  1    MNVEHEVNLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKVVS  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_004442153.1| PREDICTED: costars family protein ABRACL [Ceratotherium simum 
simum]
 ref|XP_005389320.1| PREDICTED: costars family protein ABRACL isoform X2 [Chinchilla 
lanigera]
 ref|XP_005389321.1| PREDICTED: costars family protein ABRACL isoform X3 [Chinchilla 
lanigera]
Length=81

 Score = 79.3 bits (194),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_001513946.1| PREDICTED: costars family protein ABRACL [Ornithorhynchus anatinus]
Length=81

 Score = 79.3 bits (194),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E++ L EEI+RLGK   DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEIDLLVEEIRRLGKRGADGKLSVKFGVLFLDDRCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_009946947.1| PREDICTED: costars family protein ABRACL [Leptosomus discolor]
Length=81

 Score = 79.3 bits (194),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V+
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVS  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>gb|AIC62228.1| ABRACL, partial [synthetic construct]
Length=80

 Score = 79.3 bits (194),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_008516613.1| PREDICTED: costars family protein ABRACL [Equus przewalskii]
Length=95

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKV  230
              MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+
Sbjct  13   AAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKI  72

Query  231  VAYDGELLLQ  260
            V Y GELLLQ
Sbjct  73   VTYPGELLLQ  82



>ref|NP_001160033.1| costars family protein ABRACL [Bos taurus]
 ref|XP_004011429.1| PREDICTED: costars family protein ABRACL [Ovis aries]
 ref|XP_005211043.1| PREDICTED: costars family protein ABRACL isoform X1 [Bos taurus]
 ref|XP_005684871.1| PREDICTED: costars family protein ABRACL [Capra hircus]
 ref|XP_005892019.1| PREDICTED: costars family protein ABRACL [Bos mutus]
 ref|XP_006074720.1| PREDICTED: costars family protein ABRACL isoform X1 [Bubalus 
bubalis]
 ref|XP_006074721.1| PREDICTED: costars family protein ABRACL isoform X2 [Bubalus 
bubalis]
 ref|XP_010842515.1| PREDICTED: costars family protein ABRACL [Bison bison bison]
 sp|Q3ZBN0.1|ABRAL_BOVIN RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Bos taurus]
 gb|AAI03207.1| C9H6ORF115 protein [Bos taurus]
 tpg|DAA26078.1| TPA: hypothetical protein LOC505914 [Bos taurus]
 gb|ELR59097.1| hypothetical protein M91_20305 [Bos mutus]
Length=81

 Score = 79.3 bits (194),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV+ L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVDHEVKLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YSGELLLQ  68



>ref|XP_006915428.1| PREDICTED: costars family protein ABRACL [Pteropus alecto]
 ref|XP_011354447.1| PREDICTED: costars family protein ABRACL [Pteropus vampyrus]
 gb|ELK09672.1| hypothetical protein PAL_GLEAN10014030 [Pteropus alecto]
Length=81

 Score = 79.3 bits (194),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YSGELLLQ  68



>gb|AAF28958.1|AF161398_1 HSPC280 [Homo sapiens]
Length=141

 Score = 80.9 bits (198),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKV  230
              MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+
Sbjct  59   AAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKI  118

Query  231  VAYDGELLLQ  260
            V Y GELLLQ
Sbjct  119  VTYPGELLLQ  128



>ref|XP_005973408.1| PREDICTED: costars family protein ABRACL [Pantholops hodgsonii]
Length=81

 Score = 79.3 bits (194),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV+ L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVDHEVKLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YSGELLLQ  68



>ref|XP_010624898.1| PREDICTED: costars family protein ABRACL [Fukomys damarensis]
Length=81

 Score = 79.3 bits (194),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|NP_067066.1| costars family protein ABRACL [Homo sapiens]
 ref|XP_003255842.1| PREDICTED: costars family protein ABRACL isoform 1 [Nomascus 
leucogenys]
 ref|XP_001159255.2| PREDICTED: costars family protein ABRACL [Pan troglodytes]
 ref|XP_003365779.1| PREDICTED: costars family protein ABRACL [Equus caballus]
 ref|XP_003790329.1| PREDICTED: costars family protein ABRACL [Otolemur garnettii]
 ref|XP_003827759.1| PREDICTED: costars family protein ABRACL [Pan paniscus]
 ref|XP_004044801.1| PREDICTED: costars family protein ABRACL isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004044802.1| PREDICTED: costars family protein ABRACL isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_004880934.1| PREDICTED: costars family protein ABRACL isoform X1 [Heterocephalus 
glaber]
 ref|XP_004880935.1| PREDICTED: costars family protein ABRACL isoform X2 [Heterocephalus 
glaber]
 ref|XP_004846113.1| PREDICTED: costars family protein ABRACL isoform X1 [Heterocephalus 
glaber]
 ref|XP_004846114.1| PREDICTED: costars family protein ABRACL isoform X2 [Heterocephalus 
glaber]
 ref|XP_008563765.1| PREDICTED: costars family protein ABRACL [Galeopterus variegatus]
 ref|XP_009450382.1| PREDICTED: costars family protein ABRACL [Pan troglodytes]
 sp|Q9P1F3.1|ABRAL_HUMAN RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Homo sapiens]
 gb|AAF71102.1|AF116721_82 PRO2013 [Homo sapiens]
 gb|AAH14953.1| C6orf115 protein [Homo sapiens]
 gb|EAW47902.1| hCG1640751 [Homo sapiens]
 gb|EHB00646.1| hypothetical protein GW7_00275 [Heterocephalus glaber]
Length=81

 Score = 79.3 bits (194),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_003404025.1| PREDICTED: costars family protein ABRACL [Loxodonta africana]
 ref|XP_003732795.1| PREDICTED: costars family protein ABRACL [Callithrix jacchus]
 ref|XP_008993414.1| PREDICTED: costars family protein ABRACL [Callithrix jacchus]
 ref|XP_010335859.1| PREDICTED: costars family protein ABRACL [Saimiri boliviensis 
boliviensis]
Length=81

 Score = 79.3 bits (194),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_004410330.1| PREDICTED: costars family protein ABRACL [Odobenus rosmarus divergens]
 ref|XP_004740371.1| PREDICTED: costars family protein ABRACL [Mustela putorius furo]
 ref|XP_004789047.1| PREDICTED: costars family protein ABRACL [Mustela putorius furo]
 ref|XP_006731712.1| PREDICTED: costars family protein ABRACL [Leptonychotes weddellii]
Length=81

 Score = 79.3 bits (194),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ E+  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEINLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>gb|KFO32243.1| hypothetical protein H920_06346 [Fukomys damarensis]
Length=100

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
             MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V
Sbjct  19   IMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIV  78

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  79   TYPGELLLQ  87



>ref|XP_006986145.1| PREDICTED: costars family protein ABRACL isoform X1 [Peromyscus 
maniculatus bairdii]
 ref|XP_006986146.1| PREDICTED: costars family protein ABRACL isoform X2 [Peromyscus 
maniculatus bairdii]
 ref|XP_006986147.1| PREDICTED: costars family protein ABRACL isoform X3 [Peromyscus 
maniculatus bairdii]
Length=81

 Score = 79.3 bits (194),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI+RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIQRLGSKNADGKLSVKFGVLFRDDRCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YTGELLLQ  68



>ref|XP_005509479.1| PREDICTED: costars family protein ABRACL [Columba livia]
Length=81

 Score = 79.0 bits (193),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_005389319.1| PREDICTED: costars family protein ABRACL isoform X1 [Chinchilla 
lanigera]
Length=99

 Score = 79.7 bits (195),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
             MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V
Sbjct  18   IMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIV  77

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  78   TYPGELLLQ  86



>ref|XP_009909861.1| PREDICTED: costars family protein ABRACL [Picoides pubescens]
Length=81

 Score = 79.0 bits (193),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGRVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YNGELLLQ  68



>ref|XP_004673954.1| PREDICTED: costars family protein ABRACL [Condylura cristata]
 ref|XP_004683317.1| PREDICTED: costars family protein ABRACL-like [Condylura cristata]
Length=81

 Score = 79.0 bits (193),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_003465701.1| PREDICTED: costars family protein ABRACL isoform X1 [Cavia porcellus]
 ref|XP_005001887.1| PREDICTED: costars family protein ABRACL isoform X2 [Cavia porcellus]
Length=81

 Score = 79.0 bits (193),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGRLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_004083943.1| PREDICTED: costars family protein ABRACL [Oryzias latipes]
Length=81

 Score = 79.0 bits (193),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I+RLG +   G   V FGVLFNDD+CANIFEALVGTL+AA KRKV+++  ELLLQ
Sbjct  14   IQRLGSKNASGQTSVKFGVLFNDDRCANIFEALVGTLKAAKKRKVISFQSELLLQ  68



>ref|NP_001093117.1| costars family protein ABRACL [Rattus norvegicus]
 sp|Q4KML4.1|ABRAL_MOUSE RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Mus musculus]
 gb|AAH98509.1| 3110003A17Rik protein [Mus musculus]
 dbj|BAE42271.1| unnamed protein product [Mus musculus]
 gb|EDL03474.1| mCG7517, isoform CRA_d [Mus musculus]
 gb|EDL93765.1| rCG57402, isoform CRA_b [Rattus norvegicus]
 gb|ACD47057.1| ASL1/3110003A17Rik fusion protein [Mus musculus]
Length=81

 Score = 79.0 bits (193),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YAGELLLQ  68



>ref|XP_003770544.1| PREDICTED: costars family protein ABRACL-like [Sarcophilus harrisii]
Length=81

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EE++RLG    DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEMQRLGTRGADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y+GELLLQ
Sbjct  61   YEGELLLQ  68



>ref|XP_010200782.1| PREDICTED: costars family protein ABRACL [Colius striatus]
Length=89

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>gb|KFW92191.1| Costars family protein ABRACL, partial [Phalacrocorax carbo]
Length=82

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +  +G   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNANGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>ref|XP_003121220.1| PREDICTED: costars family protein ABRACL isoformX2 [Sus scrofa]
Length=86

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKV  230
              MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+
Sbjct  4    AAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKI  63

Query  231  VAYDGELLLQ  260
            + Y GELLLQ
Sbjct  64   ITYPGELLLQ  73



>ref|XP_003496586.1| PREDICTED: costars family protein ABRACL isoform X2 [Cricetulus 
griseus]
 ref|XP_007649294.1| PREDICTED: costars family protein ABRACL isoform X2 [Cricetulus 
griseus]
 ref|XP_007631502.1| PREDICTED: costars family protein ABRACL isoform X2 [Cricetulus 
griseus]
 ref|XP_007631503.1| PREDICTED: costars family protein ABRACL isoform X2 [Cricetulus 
griseus]
Length=81

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YTGELLLQ  68



>ref|XP_006776246.1| PREDICTED: uncharacterized protein LOC102758438 [Myotis davidii]
Length=265

 Score = 82.0 bits (201),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 46/70 (66%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKV  230
              MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+
Sbjct  183  AAMNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKI  242

Query  231  VAYDGELLLQ  260
            V Y GELLLQ
Sbjct  243  VTYPGELLLQ  252



>ref|XP_533427.3| PREDICTED: costars family protein ABRACL [Canis lupus familiaris]
Length=81

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YTGELLLQ  68



>ref|XP_003353243.1| PREDICTED: costars family protein ABRACL isoform X3 [Sus scrofa]
 ref|XP_003353244.1| PREDICTED: costars family protein ABRACL isoform X4 [Sus scrofa]
Length=81

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>gb|AAH39801.1| 3110003A17Rik protein, partial [Mus musculus]
Length=104

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
             MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V
Sbjct  23   AMNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIV  82

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  83   TYAGELLLQ  91



>ref|XP_007944483.1| PREDICTED: costars family protein ABRACL [Orycteropus afer afer]
Length=81

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FG+LF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGILFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_008005039.1| PREDICTED: costars family protein ABRACL isoform X1 [Chlorocebus 
sabaeus]
Length=157

 Score = 80.9 bits (198),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = +3

Query  12   DNLQFCVRNRHQTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEA  191
            DNL F   ++     MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEA
Sbjct  65   DNLDFFFLSQ---AAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEA  121

Query  192  LVGTLRAAXKRKVVAYDGELLLQ  260
            LVGTL+AA +RK+V Y GELLLQ
Sbjct  122  LVGTLKAAKRRKIVTYSGELLLQ  144



>ref|XP_009961435.1| PREDICTED: costars family protein ABRACL [Tyto alba]
Length=81

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_005230222.1| PREDICTED: costars family protein ABRACL [Falco peregrinus]
 ref|XP_005435855.1| PREDICTED: costars family protein ABRACL [Falco cherrug]
 ref|XP_009555782.1| PREDICTED: costars family protein ABRACL [Cuculus canorus]
 ref|XP_009880604.1| PREDICTED: costars family protein ABRACL [Charadrius vociferus]
 ref|XP_010115907.1| PREDICTED: costars family protein ABRACL [Chlamydotis macqueenii]
 sp|Q6V289.2|ABRAL_COTCO RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Coturnix coturnix]
Length=81

 Score = 79.0 bits (193),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_002197784.1| PREDICTED: costars family protein ABRACL [Taeniopygia guttata]
Length=81

 Score = 79.0 bits (193),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGAKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|NP_001289105.1| costars family protein ABRACL [Gallus gallus]
 ref|XP_004935739.1| PREDICTED: costars family protein ABRACL isoform X2 [Gallus gallus]
 ref|XP_008634205.1| PREDICTED: costars family protein ABRACL [Corvus brachyrhynchos]
 ref|XP_008930603.1| PREDICTED: costars family protein ABRACL [Manacus vitellinus]
 ref|XP_009069395.1| PREDICTED: costars family protein ABRACL [Acanthisitta chloris]
 ref|XP_009091056.1| PREDICTED: costars family protein ABRACL [Serinus canaria]
 ref|XP_009279736.1| PREDICTED: costars family protein ABRACL [Aptenodytes forsteri]
 ref|XP_009317376.1| PREDICTED: costars family protein ABRACL [Pygoscelis adeliae]
 ref|XP_009458986.1| PREDICTED: costars family protein ABRACL [Nipponia nippon]
 ref|XP_009575376.1| PREDICTED: costars family protein ABRACL [Fulmarus glacialis]
 ref|XP_009642612.1| PREDICTED: costars family protein ABRACL [Egretta garzetta]
 ref|XP_009809147.1| PREDICTED: costars family protein ABRACL [Gavia stellata]
 ref|XP_009697257.1| PREDICTED: costars family protein ABRACL [Cariama cristata]
 ref|XP_009914680.1| PREDICTED: costars family protein ABRACL [Haliaeetus albicilla]
 ref|XP_010133216.1| PREDICTED: costars family protein ABRACL [Buceros rhinoceros 
silvestris]
 ref|XP_010082823.1| PREDICTED: costars family protein ABRACL [Pterocles gutturalis]
 ref|XP_010398175.1| PREDICTED: costars family protein ABRACL [Corvus cornix cornix]
 ref|XP_010398184.1| PREDICTED: costars family protein ABRACL [Corvus cornix cornix]
 ref|XP_010398192.1| PREDICTED: costars family protein ABRACL [Corvus cornix cornix]
 ref|XP_010572920.1| PREDICTED: costars family protein ABRACL [Haliaeetus leucocephalus]
 ref|XP_010572921.1| PREDICTED: costars family protein ABRACL [Haliaeetus leucocephalus]
Length=81

 Score = 79.0 bits (193),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_006188561.1| PREDICTED: costars family protein ABRACL [Camelus ferus]
 ref|XP_010963945.1| PREDICTED: costars family protein ABRACL [Camelus bactrianus]
 ref|XP_010963946.1| PREDICTED: costars family protein ABRACL [Camelus bactrianus]
 ref|XP_010981993.1| PREDICTED: costars family protein ABRACL [Camelus dromedarius]
 ref|XP_010981994.1| PREDICTED: costars family protein ABRACL [Camelus dromedarius]
 gb|EQB78760.1| costars family protein [Camelus ferus]
Length=81

 Score = 79.0 bits (193),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIIM  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_006151148.1| PREDICTED: costars family protein ABRACL [Tupaia chinensis]
 gb|ELW64180.1| hypothetical protein TREES_T100019446 [Tupaia chinensis]
Length=81

 Score = 79.0 bits (193),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDRCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YTGELLLQ  68



>ref|XP_010156542.1| PREDICTED: costars family protein ABRACL [Eurypyga helias]
Length=81

 Score = 79.0 bits (193),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQMSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>gb|EDL03473.1| mCG7517, isoform CRA_c [Mus musculus]
Length=132

 Score = 80.1 bits (196),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
             MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V
Sbjct  51   AMNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIV  110

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  111  TYAGELLLQ  119



>ref|XP_003340441.1| PREDICTED: costars family protein ABRACL [Monodelphis domestica]
Length=81

 Score = 78.6 bits (192),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EE++RLG    DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEMQRLGTRGPDGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_006112767.1| PREDICTED: costars family protein ABRACL [Pelodiscus sinensis]
Length=81

 Score = 78.6 bits (192),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEINLLVEEIRRLGTKNADGKLSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YSGELLLQ  68



>ref|XP_006020731.1| PREDICTED: costars family protein ABRACL isoform X1 [Alligator 
sinensis]
 ref|XP_006020732.1| PREDICTED: costars family protein ABRACL isoform X2 [Alligator 
sinensis]
 ref|XP_006020733.1| PREDICTED: costars family protein ABRACL isoform X3 [Alligator 
sinensis]
 ref|XP_006020734.1| PREDICTED: costars family protein ABRACL isoform X4 [Alligator 
sinensis]
 ref|XP_006267511.1| PREDICTED: costars family protein ABRACL isoform X1 [Alligator 
mississippiensis]
 ref|XP_006267512.1| PREDICTED: costars family protein ABRACL isoform X2 [Alligator 
mississippiensis]
 ref|XP_006267513.1| PREDICTED: costars family protein ABRACL isoform X3 [Alligator 
mississippiensis]
Length=81

 Score = 78.6 bits (192),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEINLLIEEIRRLGTKNADGKMSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>gb|KFQ75069.1| Costars family protein ABRACL, partial [Phoenicopterus ruber 
ruber]
Length=82

 Score = 78.6 bits (192),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNVE E+  L EEI+RLG +   G   V FGVLF D++CAN+FEALVGTL+AA +RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNAHGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  61   TYQGELLLQ  69



>ref|XP_010306042.1| PREDICTED: costars family protein ABRACL [Balearica regulorum 
gibbericeps]
Length=81

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEINLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_007058144.1| PREDICTED: costars family protein ABRACL [Chelonia mydas]
 gb|EMP37425.1| hypothetical protein UY3_05406 [Chelonia mydas]
Length=81

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEINLLVEEIRRLGTKNADGKLSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_005280434.1| PREDICTED: costars family protein ABRACL isoform X2 [Chrysemys 
picta bellii]
 ref|XP_005280435.1| PREDICTED: costars family protein ABRACL isoform X2 [Chrysemys 
picta bellii]
Length=81

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEINLLVEEIRRLGTKNADGKLSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|NP_082716.1| costars family protein ABRACL [Mus musculus]
 ref|XP_011241512.1| PREDICTED: costars family protein ABRACL isoform X1 [Mus musculus]
Length=81

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV  L EEI RLG    DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEVNLLVEEIHRLGSRNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YAGELLLQ  68



>ref|XP_004459985.1| PREDICTED: costars family protein ABRACL isoform 2 [Dasypus novemcinctus]
Length=84

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKV  230
              MNV+ EV  L EE+ RLG    DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+
Sbjct  2    AAMNVDHEVSLLVEEMHRLGSRNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKI  61

Query  231  VAYDGELLLQ  260
            V Y GELLLQ
Sbjct  62   VTYPGELLLQ  71



>ref|XP_005518508.1| PREDICTED: costars family protein ABRACL [Pseudopodoces humilis]
Length=81

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_006197837.1| PREDICTED: costars family protein ABRACL [Vicugna pacos]
Length=81

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YAGELLLQ  68



>ref|XP_005420151.1| PREDICTED: costars family protein ABRACL [Geospiza fortis]
Length=81

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_007531554.1| PREDICTED: costars family protein ABRACL [Erinaceus europaeus]
Length=81

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFGDDRCANLFEALVGTLKAAKRRKIVM  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YKGELLLQ  68



>ref|XP_010013288.1| PREDICTED: costars family protein ABRACL [Nestor notabilis]
Length=81

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA +RK+++
Sbjct  1    MNVEHEVSLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIIS  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_007191007.1| PREDICTED: costars family protein ABRACL isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=84

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKV  230
              MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+
Sbjct  2    AAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKM  61

Query  231  VAYDGELLLQ  260
            + Y GELLLQ
Sbjct  62   ITYPGELLLQ  71



>ref|XP_009876408.1| PREDICTED: costars family protein ABRACL [Apaloderma vittatum]
Length=81

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_005017805.1| PREDICTED: costars family protein ABRACL [Anas platyrhynchos]
Length=81

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEITLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_009482515.1| PREDICTED: costars family protein ABRACL [Pelecanus crispus]
Length=81

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_009687214.1| PREDICTED: costars family protein ABRACL isoform X2 [Struthio 
camelus australis]
 ref|XP_009687215.1| PREDICTED: costars family protein ABRACL isoform X2 [Struthio 
camelus australis]
Length=81

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V+
Sbjct  1    MNVEHEINLLVEEIQRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVS  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_001764433.1| predicted protein [Physcomitrella patens]
 gb|EDQ70700.1| predicted protein, partial [Physcomitrella patens]
Length=79

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I RLG +  DGS  V FG LFND++CANIFEALVGTLRAA KRK+V ++ E+L Q
Sbjct  14   IVRLGTKNADGSITVKFGTLFNDERCANIFEALVGTLRAAKKRKIVTFNSEMLFQ  68



>ref|XP_007191008.1| PREDICTED: costars family protein ABRACL isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007191009.1| PREDICTED: costars family protein ABRACL isoform X3 [Balaenoptera 
acutorostrata scammoni]
Length=81

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKMIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_008492282.1| PREDICTED: costars family protein ABRACL [Calypte anna]
Length=81

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEIGLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_010182672.1| PREDICTED: costars family protein ABRACL [Mesitornis unicolor]
Length=81

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEIGLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_004459984.1| PREDICTED: costars family protein ABRACL isoform 1 [Dasypus novemcinctus]
Length=99

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKV  230
              MNV+ EV  L EE+ RLG    DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+
Sbjct  17   AAMNVDHEVSLLVEEMHRLGSRNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKI  76

Query  231  VAYDGELLLQ  260
            V Y GELLLQ
Sbjct  77   VTYPGELLLQ  86



>gb|EHB16825.1| hypothetical protein GW7_19800 [Heterocephalus glaber]
Length=81

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV  EV  L EEI RLG +  DG   V FGVLF DD+C N+FEALVGTL+AA +RK+V 
Sbjct  1    MNVNHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCTNLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_009996826.1| PREDICTED: costars family protein ABRACL [Chaetura pelagica]
Length=81

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVN  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>gb|ERE84208.1| putative costars family protein [Cricetulus griseus]
Length=154

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
             MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V
Sbjct  73   AMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIV  132

Query  234  AYDGELLLQ  260
             Y GELLLQ
Sbjct  133  TYTGELLLQ  141



>ref|XP_007467653.1| PREDICTED: costars family protein ABRACL [Lipotes vexillifer]
Length=81

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV+ L EEI RLG    DG   V FGVLF DD+CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVDHEVKLLVEEIHRLGSRNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKMIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_005489295.1| PREDICTED: costars family protein ABRACL isoform X1 [Zonotrichia 
albicollis]
 ref|XP_005489296.1| PREDICTED: costars family protein ABRACL isoform X2 [Zonotrichia 
albicollis]
 ref|XP_005489297.1| PREDICTED: costars family protein ABRACL isoform X3 [Zonotrichia 
albicollis]
Length=81

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVEHEINLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_007101089.1| PREDICTED: costars family protein ABRACL [Physeter catodon]
Length=81

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVDREVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKMIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_004651218.1| PREDICTED: costars family protein ABRACL [Jaculus jaculus]
Length=81

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  +G   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNAEGKLSVKFGVLFRDDRCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_004263816.1| PREDICTED: costars family protein ABRACL [Orcinus orca]
 ref|XP_004328615.1| PREDICTED: costars family protein ABRACL-like [Tursiops truncatus]
Length=81

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG    DG   V FGVLF DD+CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVDHEVNLLVEEIHRLGSRNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKMIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_007909195.1| PREDICTED: costars family protein ABRACL [Callorhinchus milii]
 ref|XP_007909196.1| PREDICTED: costars family protein ABRACL [Callorhinchus milii]
 ref|XP_007909197.1| PREDICTED: costars family protein ABRACL [Callorhinchus milii]
 gb|AFK11444.1| hypothetical protein [Callorhinchus milii]
Length=81

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV  L EEI+RLG    DG   V FGVLF DD+CAN+FEALVGTLRAA ++K++ 
Sbjct  1    MNVENEVNLLVEEIRRLGAPGVDGKITVKFGVLFADDKCANLFEALVGTLRAAKRKKIIM  60

Query  237  YDGELLLQ  260
            Y+GE+LLQ
Sbjct  61   YEGEMLLQ  68



>ref|XP_008067195.1| PREDICTED: costars family protein ABRACL [Tarsius syrichta]
Length=81

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  +G   V FGVLF DD+CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNANGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>ref|XP_005154833.1| PREDICTED: costars family protein ABRACL [Melopsittacus undulatus]
Length=81

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA +RK++ 
Sbjct  1    MNVEHEVNLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIIT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_005805218.1| PREDICTED: costars family protein ABRACL-like [Xiphophorus maculatus]
Length=81

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV  E+  L EEI+RLG + D G   V FGVLF+DD+CANIFEALVGTL+AA K+K++ 
Sbjct  1    MNVSHEISLLVEEIQRLGCKNDKGQTSVKFGVLFSDDRCANIFEALVGTLKAAKKQKIID  60

Query  237  YDGELLLQ  260
            + GELLLQ
Sbjct  61   FQGELLLQ  68



>ref|XP_003059997.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55949.1| predicted protein [Micromonas pusilla CCMP1545]
Length=82

 Score = 77.0 bits (188),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            IKRLG   D G   V FGVLF DD+CANIFEALVGTLRAA KRKV+ +DGE+LLQ
Sbjct  16   IKRLGGNVD-GKTTVKFGVLFADDRCANIFEALVGTLRAAKKRKVIHFDGEMLLQ  69



>ref|XP_009505112.1| PREDICTED: costars family protein ABRACL [Phalacrocorax carbo]
Length=81

 Score = 77.0 bits (188),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE E+  L EEI+RLG +  +G   V FGVLF D++CAN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNANGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YQGELLLQ  68



>ref|XP_006013904.1| PREDICTED: costars family protein ABRACL-like [Latimeria chalumnae]
Length=80

 Score = 76.6 bits (187),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I RLG    DG   V FGVLF D++CAN+FEALVGTLRAA KRK++ Y+G+LLLQ
Sbjct  14   ICRLGTRNADGKISVKFGVLFADEKCANLFEALVGTLRAAKKRKIITYEGQLLLQ  68



>gb|ACO51940.1| C6orf115 [Rana catesbeiana]
Length=81

 Score = 76.3 bits (186),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNVE EV  L E+I RLG    DG  KV FGVLF+DDQCAN+FEA+VGTL+AA ++K++ 
Sbjct  1    MNVEHEVSLLVEQIHRLGTRDLDGKLKVKFGVLFHDDQCANLFEAMVGTLKAAKRKKILT  60

Query  237  YDGELLLQ  260
            Y  ELLLQ
Sbjct  61   YGTELLLQ  68



>gb|KDQ20442.1| hypothetical protein BOTBODRAFT_26447 [Botryobasidium botryosum 
FD-172 SS1]
Length=85

 Score = 76.3 bits (186),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = +3

Query  96   IKRLGKEQDDGSY---KVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            IKRLGK  +DG      V FGVL  DD+CANIFEALVGTLRAA KR VVAYD  LLLQ
Sbjct  15   IKRLGKPVEDGKAGIASVKFGVLVRDDRCANIFEALVGTLRAAKKRGVVAYDSPLLLQ  72



>ref|XP_006898818.1| PREDICTED: costars family protein ABRACL-like [Elephantulus edwardii]
Length=78

 Score = 76.3 bits (186),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  102  RLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
             LG +  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V+Y GELLLQ
Sbjct  14   HLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVSYQGELLLQ  66



>pdb|2L2O|A Chain A, Solution Structure Of Human Hspc280 Protein
Length=89

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+ AN+FEALVGTL+AA +RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKSANLFEALVGTLKAAKRRKIVT  60

Query  237  YDGELLLQ  260
            Y GELLLQ
Sbjct  61   YPGELLLQ  68



>gb|EFA82987.1| hypothetical protein PPL_03765 [Polysphondylium pallidum PN500]
Length=81

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVV  233
            TMNV+EEV RL EEI RLG ++ DG   V +GVLFNDD  AN FEAL+GTL+AA ++K++
Sbjct  2    TMNVDEEVSRLIEEITRLGTKRPDGKIVVKYGVLFNDDIVANTFEALLGTLKAAKRKKLI  61

Query  234  AYDGELLLQ  260
             YDGE+LLQ
Sbjct  62   TYDGEILLQ  70



>ref|XP_004350571.1| hypothetical protein DFA_11624 [Dictyostelium fasciculatum]
 gb|EGG13863.1| hypothetical protein DFA_11624 [Dictyostelium fasciculatum]
Length=79

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I RLG +  +G   V +GVLFNDD+ AN FEALVGTL+AA KRK++ YDGE+LLQ
Sbjct  14   INRLGTKGANGKVSVKYGVLFNDDEVANTFEALVGTLKAAKKRKILTYDGEILLQ  68



>ref|XP_644929.1| hypothetical protein DDB_G0272861 [Dictyostelium discoideum AX4]
 sp|Q558Y7.1|COSA_DICDI RecName: Full=Protein costars [Dictyostelium discoideum]
 gb|EAL71068.1| hypothetical protein DDB_G0272861 [Dictyostelium discoideum AX4]
Length=82

 Score = 73.6 bits (179),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            IK+LG +  DG Y V +GVLFNDD  AN FEALVGTL+AA KR ++ + GE+LLQ
Sbjct  14   IKKLGTKGADGKYSVKYGVLFNDDDVANFFEALVGTLKAAKKRGIITFQGEILLQ  68



>ref|XP_004347370.1| hypothetical protein CAOG_04623 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93906.1| hypothetical protein CAOG_004623 [Capsaspora owczarzaki ATCC 
30864]
Length=81

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            IKRLG +   G Y V +GVLF DD+ ANIFEAL+GTL++A KRK+V + GE+LLQ
Sbjct  14   IKRLGAKNASGQYSVKYGVLFKDDRVANIFEALLGTLKSAKKRKIVDFKGEMLLQ  68



>gb|KGL85702.1| Costars family protein ABRACL, partial [Tinamus guttatus]
Length=61

 Score = 72.4 bits (176),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  123  DGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            DG   V FGVLF DD+CAN+FEALVGTL+AA +RKVV+Y GELLLQ
Sbjct  3    DGQVSVKFGVLFADDKCANLFEALVGTLKAAKRRKVVSYQGELLLQ  48



>gb|KII85529.1| hypothetical protein PLICRDRAFT_166123 [Plicaturopsis crispa 
FD-325 SS-3]
Length=86

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = +3

Query  96   IKRLGKEQD---DGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            IKRLG       +G   V FG+L  DD+CANIFEALVGTLRAA KRKV+ Y GE+LLQ
Sbjct  16   IKRLGGPPPAGVEGVASVKFGILVKDDRCANIFEALVGTLRAAKKRKVITYAGEMLLQ  73



>gb|EFB26624.1| hypothetical protein PANDA_000424 [Ailuropoda melanoleuca]
Length=61

 Score = 71.6 bits (174),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  123  DGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V Y GELLLQ
Sbjct  3    DGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQ  48



>ref|XP_010793085.1| PREDICTED: costars family protein ABRACL [Notothenia coriiceps]
 ref|XP_010793086.1| PREDICTED: costars family protein ABRACL [Notothenia coriiceps]
Length=81

 Score = 72.0 bits (175),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVA  236
            MNV+ EV+RL EEI+RLG +  DG   VTFGVLFND+QCANIFEALVGTL+AA KRKVV 
Sbjct  1    MNVDHEVKRLVEEIQRLGSKNADGQTSVTFGVLFNDEQCANIFEALVGTLKAAKKRKVVK  60

Query  237  YDGELLLQ  260
            YD ELLLQ
Sbjct  61   YDSELLLQ  68



>gb|EDL03472.1| mCG7517, isoform CRA_b [Mus musculus]
Length=85

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  EQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            E  DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V Y GELLLQ
Sbjct  24   EDADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVTYAGELLLQ  72



>ref|XP_003294793.1| hypothetical protein DICPUDRAFT_43951 [Dictyostelium purpureum]
 ref|XP_003294794.1| hypothetical protein DICPUDRAFT_96120 [Dictyostelium purpureum]
 gb|EGC28682.1| hypothetical protein DICPUDRAFT_43951 [Dictyostelium purpureum]
 gb|EGC28683.1| hypothetical protein DICPUDRAFT_96120 [Dictyostelium purpureum]
Length=85

 Score = 70.5 bits (171),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  96   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            IKRLG +  +  Y V +GVLFNDD   N+FEAL+GTL++A ++K++ ++GELLLQ
Sbjct  18   IKRLGTKNANNQYVVKYGVLFNDDTVGNVFEALMGTLKSAKRKKIITFEGELLLQ  72



>gb|EOB02642.1| Uncharacterized protein C6orf115, partial [Anas platyrhynchos]
Length=61

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  123  DGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            DG   V FGVLF D++CAN+FEALVGTL+AA +RK+V Y GELLLQ
Sbjct  3    DGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVTYQGELLLQ  48



>ref|XP_009985907.1| PREDICTED: costars family protein ABRACL, partial [Tauraco erythrolophus]
Length=60

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  123  DGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            DG   V FGVLF D++CAN+FEALVGTL+AA +RK++ Y GELLLQ
Sbjct  2    DGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIITYQGELLLQ  47



>gb|KFV18849.1| Costars family protein ABRACL, partial [Tauraco erythrolophus]
Length=61

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  123  DGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            DG   V FGVLF D++CAN+FEALVGTL+AA +RK++ Y GELLLQ
Sbjct  3    DGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIITYQGELLLQ  48



>gb|EGV96086.1| Epithelial cell transforming sequence 2 oncogene-like [Cricetulus 
griseus]
Length=939

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  123  DGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            DG   V FGVLF DD+CAN+FEALVGTL+AA +RK+V Y GELLLQ
Sbjct  881  DGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVTYTGELLLQ  926



>gb|AAH89921.1| LOC685045 protein [Rattus norvegicus]
Length=133

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  KEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            K   DG   V FGVLF DD+CAN+FEALVGT +AA +RK+V Y GELLLQ
Sbjct  71   KLDADGKLSVKFGVLFQDDRCANLFEALVGTPKAAKRRKIVTYAGELLLQ  120



>ref|XP_008869272.1| hypothetical protein H310_06125 [Aphanomyces invadans]
 gb|ETW02667.1| hypothetical protein H310_06125 [Aphanomyces invadans]
Length=134

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 4/59 (7%)
 Frame = +3

Query  96   IKRLGKE--QDDGS--YKVTFGVLFNDDQCANIFEALVGTLRAAXKRKVVAYDGELLLQ  260
            I+RLG E   DDGS  + VTFGVLF D++C ++FEAL+GTLRAA ++KV+ Y G+LLL+
Sbjct  63   IQRLGHEITSDDGSKQFGVTFGVLFGDERCQDLFEALMGTLRAAKRKKVIDYQGQLLLK  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 569309995650