BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF011N18

Length=291
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.0    1e-16   Nicotiana tomentosiformis
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     81.3    1e-15   Nicotiana sylvestris
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  75.5    2e-13   Nicotiana tomentosiformis
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  75.1    2e-13   Nicotiana tomentosiformis
ref|XP_009353369.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.1    8e-13   
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.2    9e-13   Solanum tuberosum [potatoes]
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12          71.2    4e-12   Solanum lycopersicum
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  70.9    6e-12   Pyrus x bretschneideri [bai li]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  70.9    6e-12   Pyrus x bretschneideri [bai li]
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12          68.2    5e-11   Solanum lycopersicum
ref|XP_008379931.1|  PREDICTED: protein TRANSPARENT TESTA 12          66.2    2e-10   
ref|XP_006375529.1|  hypothetical protein POPTR_0014s15140g           64.7    4e-10   
emb|CDP17486.1|  unnamed protein product                              64.7    9e-10   Coffea canephora [robusta coffee]
gb|KDO54650.1|  hypothetical protein CISIN_1g0100251mg                63.5    1e-09   Citrus sinensis [apfelsine]
ref|XP_009345548.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  63.5    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg           63.5    2e-09   Citrus clementina [clementine]
emb|CDY19294.1|  BnaC01g31860D                                        63.2    3e-09   Brassica napus [oilseed rape]
ref|XP_010278703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  63.2    3e-09   Nelumbo nucifera [Indian lotus]
emb|CDY39494.1|  BnaA01g24940D                                        62.8    3e-09   Brassica napus [oilseed rape]
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  62.8    4e-09   Nelumbo nucifera [Indian lotus]
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  62.8    4e-09   Pyrus x bretschneideri [bai li]
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  62.8    4e-09   Pyrus x bretschneideri [bai li]
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.4    5e-09   Camelina sativa [gold-of-pleasure]
emb|CDP11782.1|  unnamed protein product                              62.0    8e-09   Coffea canephora [robusta coffee]
emb|CDY19295.1|  BnaC01g31850D                                        60.8    9e-09   Brassica napus [oilseed rape]
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12          61.2    1e-08   Vitis vinifera
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  60.8    2e-08   Cicer arietinum [garbanzo]
emb|CBI28937.3|  unnamed protein product                              60.8    2e-08   Vitis vinifera
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.8    2e-08   Brassica rapa
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.8    2e-08   
ref|XP_003605914.1|  Transparent testa 12 protein                     60.8    2e-08   Medicago truncatula
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.8    2e-08   Cucumis sativus [cucumbers]
emb|CDP11780.1|  unnamed protein product                              60.5    2e-08   Coffea canephora [robusta coffee]
ref|XP_009362007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  60.1    3e-08   
ref|XP_008342001.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.7    3e-08   
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.1    3e-08   Brassica rapa
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                  60.1    3e-08   Arabis alpina [alpine rockcress]
emb|CDY38631.1|  BnaA05g19560D                                        60.1    4e-08   Brassica napus [oilseed rape]
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.3    6e-08   
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg           59.3    6e-08   
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.3    6e-08   Cucumis melo [Oriental melon]
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.9    7e-08   Prunus mume [ume]
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12          58.9    8e-08   Glycine max [soybeans]
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12          58.9    8e-08   
gb|KDO75454.1|  hypothetical protein CISIN_1g010798mg                 58.5    1e-07   Citrus sinensis [apfelsine]
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g           58.5    1e-07   
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g           58.2    1e-07   
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.2    2e-07   Fragaria vesca subsp. vesca
emb|CDY33130.1|  BnaCnng07010D                                        57.4    2e-07   Brassica napus [oilseed rape]
gb|KDO75455.1|  hypothetical protein CISIN_1g010798mg                 57.8    2e-07   Citrus sinensis [apfelsine]
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  58.2    2e-07   Populus euphratica
emb|CBI28939.3|  unnamed protein product                              57.4    2e-07   Vitis vinifera
ref|XP_011048008.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  57.8    2e-07   Populus euphratica
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                 57.8    2e-07   Citrus sinensis [apfelsine]
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  57.8    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  57.8    2e-07   Populus euphratica
gb|KJB57728.1|  hypothetical protein B456_009G178100                  57.4    3e-07   Gossypium raimondii
gb|KJB57730.1|  hypothetical protein B456_009G178100                  57.4    3e-07   Gossypium raimondii
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.4    3e-07   Eucalyptus grandis [rose gum]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.4    3e-07   Vitis vinifera
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.0    3e-07   Populus euphratica
gb|KJB57729.1|  hypothetical protein B456_009G178100                  56.6    3e-07   Gossypium raimondii
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg           57.0    4e-07   Citrus clementina [clementine]
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.0    4e-07   Citrus sinensis [apfelsine]
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein            57.0    4e-07   Gossypium arboreum [tree cotton]
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12          57.0    4e-07   Vitis vinifera
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg           57.0    4e-07   
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg           56.6    5e-07   Citrus clementina [clementine]
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  56.6    5e-07   Vitis vinifera
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  56.6    5e-07   Nicotiana tomentosiformis
ref|XP_008364096.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  56.2    6e-07   
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g           56.2    7e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     56.2    7e-07   Elaeis guineensis
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  56.2    7e-07   Populus euphratica
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g           55.8    9e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006389638.1|  MATE efflux family protein                       55.8    1e-06   
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.8    1e-06   
ref|XP_002883313.1|  mate efflux family protein                       55.5    1e-06   
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.8    1e-06   
gb|KEH39009.1|  MATE efflux family protein                            55.5    1e-06   Medicago truncatula
ref|XP_008364095.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.5    1e-06   
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.5    1e-06   
ref|XP_006389634.1|  hypothetical protein POPTR_0021s00830g           55.5    1e-06   
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.5    1e-06   
ref|XP_003596992.1|  Transparent testa 12 protein                     55.1    1e-06   Medicago truncatula
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12          55.1    1e-06   Vitis vinifera
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.1    2e-06   Prunus mume [ume]
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  55.1    2e-06   Nicotiana sylvestris
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.1    2e-06   Sesamum indicum [beniseed]
gb|KJB69294.1|  hypothetical protein B456_011G014800                  54.7    2e-06   Gossypium raimondii
emb|CAN69305.1|  hypothetical protein VITISV_021605                   53.9    2e-06   Vitis vinifera
dbj|BAF47751.1|  multi antimicrobial extrusion family protein         54.3    3e-06   Nicotiana tabacum [American tobacco]
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.3    3e-06   Nicotiana sylvestris
ref|XP_010930078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  54.3    3e-06   Elaeis guineensis
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.3    3e-06   Cucumis melo [Oriental melon]
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                  54.3    3e-06   Arabis alpina [alpine rockcress]
ref|XP_002518495.1|  multidrug resistance pump, putative              54.3    3e-06   Ricinus communis
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.3    3e-06   Pyrus x bretschneideri [bai li]
ref|XP_007045634.1|  MATE efflux family protein isoform 2             53.9    3e-06   
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.3    3e-06   Malus domestica [apple tree]
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg              54.3    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_011048000.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  54.3    3e-06   Populus euphratica
ref|XP_007045633.1|  MATE efflux family protein isoform 1             54.3    4e-06   
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  54.3    4e-06   Elaeis guineensis
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.9    4e-06   Elaeis guineensis
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  54.3    4e-06   Populus euphratica
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.9    4e-06   Camelina sativa [gold-of-pleasure]
gb|KJB69293.1|  hypothetical protein B456_011G014800                  53.9    4e-06   Gossypium raimondii
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.9    4e-06   Populus euphratica
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.9    4e-06   Cicer arietinum [garbanzo]
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.9    4e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                          53.9    5e-06   Glycine soja [wild soybean]
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.9    5e-06   Elaeis guineensis
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.9    5e-06   Elaeis guineensis
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12          53.5    5e-06   
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.5    6e-06   Brassica rapa
emb|CDY33129.1|  BnaCnng07000D                                        53.5    6e-06   Brassica napus [oilseed rape]
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.5    6e-06   Cicer arietinum [garbanzo]
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12          53.5    6e-06   Nelumbo nucifera [Indian lotus]
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                 53.1    7e-06   Citrus sinensis [apfelsine]
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  53.1    7e-06   Citrus sinensis [apfelsine]
ref|XP_008371179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.8    7e-06   
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  53.1    7e-06   Solanum tuberosum [potatoes]
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  53.1    7e-06   Solanum tuberosum [potatoes]
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.1    7e-06   Fragaria vesca subsp. vesca
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.1    9e-06   Prunus mume [ume]
emb|CDY69153.1|  BnaAnng29470D                                        52.4    9e-06   Brassica napus [oilseed rape]
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.8    9e-06   Pyrus x bretschneideri [bai li]
ref|XP_006467446.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.8    9e-06   Citrus sinensis [apfelsine]
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12          52.8    1e-05   Phoenix dactylifera
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12          52.8    1e-05   Tarenaya hassleriana [spider flower]
gb|AHI48506.1|  multidrug and toxic extrusion transporter             52.8    1e-05   Vaccinium corymbosum [American blueberry]
ref|XP_006348109.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.4    1e-05   Solanum tuberosum [potatoes]
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.8    1e-05   Nicotiana tomentosiformis
gb|KGN43526.1|  hypothetical protein Csa_7G043680                     52.4    1e-05   Cucumis sativus [cucumbers]
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.4    1e-05   Solanum lycopersicum
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.4    1e-05   Cicer arietinum [garbanzo]
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    2e-05   Prunus mume [ume]
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg           52.0    2e-05   Prunus persica
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    2e-05   Cucumis sativus [cucumbers]
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    2e-05   
gb|KGN43522.1|  Mate efflux family protein                            52.0    2e-05   Cucumis sativus [cucumbers]
ref|XP_004173828.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.2    2e-05   
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    2e-05   
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.6    2e-05   Cucumis melo [Oriental melon]
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                  51.6    2e-05   Arabis alpina [alpine rockcress]
gb|ACF85423.1|  unknown                                               51.6    2e-05   Zea mays [maize]
gb|KGN64598.1|  hypothetical protein Csa_1G071120                     51.6    2e-05   Cucumis sativus [cucumbers]
ref|NP_001148084.1|  transparent testa 12 protein                     51.6    3e-05   Zea mays [maize]
gb|ACZ55931.1|  MATE transporter 2                                    51.6    3e-05   Zea mays [maize]
ref|XP_010533819.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  50.8    3e-05   Tarenaya hassleriana [spider flower]
ref|XP_010533821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  50.8    3e-05   Tarenaya hassleriana [spider flower]
ref|XP_010533818.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  50.8    3e-05   Tarenaya hassleriana [spider flower]
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.6    3e-05   
ref|XP_010533820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  50.8    3e-05   Tarenaya hassleriana [spider flower]
ref|XP_010533817.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  50.8    3e-05   
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg           51.2    4e-05   
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.8    4e-05   Cucumis melo [Oriental melon]
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                          50.8    4e-05   Glycine soja [wild soybean]
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.8    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  50.8    5e-05   
ref|XP_006406243.1|  hypothetical protein EUTSA_v10020526mg           50.8    5e-05   
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g           50.8    5e-05   Phaseolus vulgaris [French bean]
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.8    5e-05   Populus euphratica
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg           50.8    5e-05   Capsella rubella
gb|KDP20757.1|  hypothetical protein JCGZ_21228                       50.1    6e-05   Jatropha curcas
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.4    6e-05   Glycine max [soybeans]
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.4    6e-05   Sesamum indicum [beniseed]
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.4    6e-05   Brassica rapa
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg           50.4    7e-05   Eutrema salsugineum [saltwater cress]
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2  50.1    8e-05   
ref|XP_007026054.1|  MATE efflux family protein isoform 1             50.1    8e-05   
gb|KGN43524.1|  hypothetical protein Csa_7G043660                     50.1    9e-05   Cucumis sativus [cucumbers]
gb|KDP20755.1|  hypothetical protein JCGZ_21226                       49.7    1e-04   Jatropha curcas
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g           49.7    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008455546.1|  PREDICTED: MATE efflux family protein LAL5-like  47.8    1e-04   Cucumis melo [Oriental melon]
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  49.7    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_007026056.1|  MATE efflux family protein                       49.7    1e-04   
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.3    1e-04   
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  49.3    1e-04   Pyrus x bretschneideri [bai li]
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg              49.3    1e-04   Erythranthe guttata [common monkey flower]
dbj|BAJ34540.1|  unnamed protein product                              49.3    2e-04   Eutrema halophilum
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.3    2e-04   Prunus mume [ume]
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                          48.9    2e-04   Glycine soja [wild soybean]
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.9    2e-04   Glycine max [soybeans]
gb|EPS61219.1|  hypothetical protein M569_13580                       47.0    2e-04   Genlisea aurea
gb|EPS67796.1|  hypothetical protein M569_06975                       48.9    2e-04   Genlisea aurea
gb|ACZ55932.1|  MATE transporter 2                                    48.9    2e-04   Zea mays [maize]
gb|KCW76957.1|  hypothetical protein EUGRSUZ_D01316                   48.5    3e-04   Eucalyptus grandis [rose gum]
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg              48.5    3e-04   Erythranthe guttata [common monkey flower]
emb|CDY39493.1|  BnaA01g24950D                                        48.5    3e-04   Brassica napus [oilseed rape]
emb|CDY65669.1|  BnaCnng48120D                                        48.1    3e-04   Brassica napus [oilseed rape]
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg              48.1    3e-04   Erythranthe guttata [common monkey flower]
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g           48.1    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008371177.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.8    4e-04   
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.1    4e-04   Eucalyptus grandis [rose gum]
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.1    4e-04   Populus euphratica
ref|XP_008371097.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.8    4e-04   
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.1    4e-04   Populus euphratica
ref|NP_001149176.1|  transparent testa 12 protein                     47.8    5e-04   Zea mays [maize]
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.8    5e-04   Setaria italica
gb|AGT17221.1|  transparent testa 12 protein                          47.8    5e-04   Saccharum hybrid cultivar R570
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.4    6e-04   Solanum tuberosum [potatoes]
gb|KDP20756.1|  hypothetical protein JCGZ_21227                       47.8    6e-04   Jatropha curcas
emb|CDM86692.1|  unnamed protein product                              47.4    7e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.4    7e-04   Brassica rapa
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.0    8e-04   Solanum lycopersicum
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.0    9e-04   
emb|CDM86687.1|  unnamed protein product                              47.0    9e-04   Triticum aestivum [Canadian hard winter wheat]
gb|KDP20758.1|  hypothetical protein JCGZ_21229                       47.0    0.001   Jatropha curcas
gb|EMT13256.1|  hypothetical protein F775_42803                       44.3    0.001   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.0    0.001   Tarenaya hassleriana [spider flower]
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                     46.6    0.001   



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 4/75 (5%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  245
            MDSS    Y P  E++G  + SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNTYQPFLENNGTSNLSPQLSETHNFESSNELETVLLDTEIPFWSKLRLATWIEM  60

Query  246  KLLCYLAAPAVVVYM  290
            KLL YLAAPAV+VYM
Sbjct  61   KLLFYLAAPAVMVYM  75



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 4/75 (5%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  245
            MDSS    Y P  +++G  S SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNIYQPFLDNNGNSSLSPQFSETHNFESSNELETVLLDTEIPLWNKLRLATWIEM  60

Query  246  KLLCYLAAPAVVVYM  290
            KLL +LAAPAV+VYM
Sbjct  61   KLLFHLAAPAVMVYM  75



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  245
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  246  KLLCYLAAPAVVVYM  290
            KLL +LAAPAV+VYM
Sbjct  61   KLLFFLAAPAVMVYM  75



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  245
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  246  KLLCYLAAPAVVVYM  290
            KLL +LAAPAV+VYM
Sbjct  61   KLLFFLAAPAVMVYM  75



>ref|XP_009353369.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=133

 Score = 70.1 bits (170),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  99   AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  278
             Y PLP +    S   HEE +AS ELE +L DTG P  QRLK A WIE KLL  LAAPA+
Sbjct  15   TYPPLPSTKSFTSKHAHEE-QASGELEQVLCDTGKPFSQRLKPALWIESKLLVVLAAPAI  73

Query  279  VVYM  290
            +VYM
Sbjct  74   IVYM  77



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 50/74 (68%), Gaps = 3/74 (4%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  248
            M S     Y P  +++    SP   E+   E+SNELE++L+DT IP W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEIPLWSKLRLATWIEMK  60

Query  249  LLCYLAAPAVVVYM  290
             L +LAAPAV+VYM
Sbjct  61   FLFFLAAPAVMVYM  74



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 50/74 (68%), Gaps = 3/74 (4%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  248
            M S     Y P  +++    SP   E+   E+SNELE++L+DT I  W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEITLWSKLRLATWIEMK  60

Query  249  LLCYLAAPAVVVYM  290
            LL +LAAPAV+VYM
Sbjct  61   LLFFLAAPAVMVYM  74



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 6/80 (8%)
 Frame = +3

Query  51   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  230
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  231  TWIELKLLCYLAAPAVVVYM  290
             WIE KLL  LAAPA++VYM
Sbjct  58   LWIESKLLVVLAAPAIIVYM  77



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 6/80 (8%)
 Frame = +3

Query  51   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  230
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  231  TWIELKLLCYLAAPAVVVYM  290
             WIE KLL  LAAPA++VYM
Sbjct  58   LWIESKLLVVLAAPAIIVYM  77



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  153  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            +SE+S ELES+L+D  +PRW RL+ ATWIE+KLL  LAAPAV+VYM
Sbjct  20   DSESSIELESVLLDHSLPRWNRLRQATWIEMKLLFSLAAPAVMVYM  65



>ref|XP_008379931.1| PREDICTED: protein TRANSPARENT TESTA 12 [Malus domestica]
Length=446

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  99   AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  278
            +Y PLP +    S   HEE  AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  15   SYRPLPSTKSFTSKHAHEE-HASGELEQVLCDTYKPFSQRLKPALWIESKLLVVLAAPAI  73

Query  279  VVYM  290
            +VYM
Sbjct  74   IVYM  77



>ref|XP_006375529.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
 gb|ERP53326.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
Length=326

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  144  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            P + + +S ELES+L DT +P ++RL+ ATWIE KLLC LAAPAVVVYM
Sbjct  28   PKQSNHSSIELESVLSDTEMPYFKRLRRATWIESKLLCRLAAPAVVVYM  76



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDG---VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  248
            M SS  ++Y  LP+++    +  +      EAS+ELE IL +T +P  +R+  ATWIE+K
Sbjct  1    MGSSGDSSYKTLPQNEKKPVLTHTQSQVRKEASDELERILSNTEVPFIKRVVPATWIEIK  60

Query  249  LLCYLAAPAVVVYM  290
            LL +LAAPAVVVYM
Sbjct  61   LLVHLAAPAVVVYM  74



>gb|KDO54650.1| hypothetical protein CISIN_1g0100251mg, partial [Citrus sinensis]
Length=351

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +3

Query  114  PESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            P    V+S  P E    SN ELE++L DT +  WQRL+ ATWIE KLL +LAAPAV+VYM
Sbjct  24   PAPPAVLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRATWIESKLLFHLAAPAVIVYM  83



>ref|XP_009345548.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=455

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 14/86 (16%)
 Frame = +3

Query  54   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  212
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  213  QRLKLATWIELKLLCYLAAPAVVVYM  290
            +R +LATWIELKLL  LAAPAV+VY+
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYV  90



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +3

Query  114  PESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            P    V+S  P E    SN ELE++L DT +  WQRL+ ATWIE KLL +LAAPAV+VYM
Sbjct  24   PAPPAVLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRATWIESKLLFHLAAPAVIVYM  83



>emb|CDY19294.1| BnaC01g31860D [Brassica napus]
Length=514

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +3

Query  84   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  258  YLAAPAVVVYM  290
             LAAPAV+VYM
Sbjct  63   KLAAPAVIVYM  73



>ref|XP_010278703.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nelumbo 
nucifera]
Length=484

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEA----SNELESILMDTGIPRWQRLKLATWIEL  245
            M++S      P+  S    +S   ++S A    S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  246  KLLCYLAAPAVVVYM  290
            KLL YLAAPAV+VYM
Sbjct  61   KLLFYLAAPAVIVYM  75



>emb|CDY39494.1| BnaA01g24940D [Brassica napus]
Length=514

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +3

Query  84   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  258  YLAAPAVVVYM  290
             LAAPAV+VYM
Sbjct  63   KLAAPAVIVYM  73



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEA----SNELESILMDTGIPRWQRLKLATWIEL  245
            M++S      P+  S    +S   ++S A    S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  246  KLLCYLAAPAVVVYM  290
            KLL YLAAPAV+VYM
Sbjct  61   KLLFYLAAPAVIVYM  75



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 14/86 (16%)
 Frame = +3

Query  54   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  212
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  213  QRLKLATWIELKLLCYLAAPAVVVYM  290
            +R +LATWIELKLL  LAAPAV+VY+
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYV  90



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 14/86 (16%)
 Frame = +3

Query  54   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  212
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  213  QRLKLATWIELKLLCYLAAPAVVVYM  290
            +R +LATWIELKLL  LAAPAV+VY+
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYV  90



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 5/72 (7%)
 Frame = +3

Query  78   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  254
            MDSS N  AY PL +S    SSP   ES ++ ELE++L D   P +QRL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQSQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESKLL  56

Query  255  CYLAAPAVVVYM  290
              LAAPAV+VYM
Sbjct  57   FNLAAPAVIVYM  68



>emb|CDP11782.1| unnamed protein product [Coffea canephora]
Length=524

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 42/71 (59%), Gaps = 9/71 (13%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSNDAGQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  258  YLAAPAVVVYM  290
            +LAAPAV+VYM
Sbjct  52   HLAAPAVIVYM  62



>emb|CDY19295.1| BnaC01g31850D [Brassica napus]
Length=304

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = +3

Query  78   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  248
            MDSS N   Y+ L  P+SDG V   P  ES  + ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQNDGLYEQLLHPQSDGTVPLSPSTESR-NGELERVLSDVETPLFHRLRKATMIESK  59

Query  249  LLCYLAAPAVVVYM  290
            LL  LAAPAV+VYM
Sbjct  60   LLFKLAAPAVIVYM  73



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  1    MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  58

Query  258  YLAAPAVVVYM  290
             LA PAV VYM
Sbjct  59   RLAGPAVAVYM  69



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query  78   MDSSNGAAYDPLPES-DGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  254
            MD    A  D  P+    + +     + E+  ELE IL DT +P  +R+ LATW+ELKLL
Sbjct  1    MDEPFLALNDSTPQQPSSIFTHSFGSKHESDGELERILSDTNVPFVKRIPLATWVELKLL  60

Query  255  CYLAAPAVVVYM  290
             YLAAPAV+VY+
Sbjct  61   FYLAAPAVIVYL  72



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  37   MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  94

Query  258  YLAAPAVVVYM  290
             LA PAV VYM
Sbjct  95   RLAGPAVAVYM  105



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +3

Query  84   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            S N   Y PL  P+SDG V   P  ES ++ ELE +L +   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSNVETPLFHRLRKATMIESKLLF  62

Query  258  YLAAPAVVVYM  290
             LAAPAV+VYM
Sbjct  63   KLAAPAVIVYM  73



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 48/74 (65%), Gaps = 5/74 (7%)
 Frame = +3

Query  72   SVMDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  248
            S MDSS N  AY PL +     SSP   ES ++ ELE++L D   P +QRL+ AT IE K
Sbjct  10   SAMDSSRNDGAYQPLLQPQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESK  65

Query  249  LLCYLAAPAVVVYM  290
            LL  LAAPAV+VYM
Sbjct  66   LLFNLAAPAVIVYM  79



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  159  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            E+  ELE IL DT +P  +R+KLATW+E KLL YLAAP+V+VY+
Sbjct  38   ESDGELERILSDTSVPFVKRIKLATWVEFKLLFYLAAPSVIVYL  81



>ref|XP_004144495.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004159201.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43525.1| hypothetical protein Csa_7G043670 [Cucumis sativus]
Length=510

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +3

Query  135  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            + PP    + E S+ELESIL DT +P  QR   ATWIE+KLL YLAAPAV VY+
Sbjct  19   TQPPVLSNKHEYSDELESILSDTHLPLLQRYTKATWIEMKLLFYLAAPAVFVYV  72



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 42/71 (59%), Gaps = 9/71 (13%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSVDASQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  258  YLAAPAVVVYM  290
            +LAAPAV+VYM
Sbjct  52   HLAAPAVIVYM  62



>ref|XP_009362007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=444

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 14/86 (16%)
 Frame = +3

Query  54   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  212
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  213  QRLKLATWIELKLLCYLAAPAVVVYM  290
            +R +LATWIELKLL  LAAPAV+VY+
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYV  90



>ref|XP_008342001.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=325

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  99   AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  278
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  279  VVYM  290
            +VY+
Sbjct  72   IVYV  75



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +3

Query  78   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  248
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  249  LLCYLAAPAVVVYM  290
            LL  LAAPAV+VYM
Sbjct  60   LLFKLAAPAVIVYM  73



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +3

Query  78   MDSS-NGAAYDPLPESDGVVSSPPH--EESEASN-ELESILMDTGIPRWQRLKLATWIEL  245
            MDSS N   Y PL    G  + PPH    +E++N ELE +L D   P + RL+ AT IE 
Sbjct  1    MDSSQNDGVYQPLLHPHGDATLPPHLPPSTESTNGELERVLSDVETPLFLRLRKATMIES  60

Query  246  KLLCYLAAPAVVVYM  290
            KLL  LAAPAV+VYM
Sbjct  61   KLLFKLAAPAVIVYM  75



>emb|CDY38631.1| BnaA05g19560D [Brassica napus]
Length=512

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +3

Query  78   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  248
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  249  LLCYLAAPAVVVYM  290
            LL  LAAPAV+VYM
Sbjct  60   LLFKLAAPAVIVYM  73



>ref|XP_008362257.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=506

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  99   AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  278
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  279  VVYM  290
            +VY+
Sbjct  72   IVYV  75



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  147  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            H +  +SNELE +L DT  P  +RLK A WIE KLL YLAAPAV+VYM
Sbjct  35   HHDLHSSNELERVLSDTNRPFLERLKPALWIESKLLFYLAAPAVIVYM  82



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = +3

Query  135  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            + PP    + E+S+ELE+IL DT +P  QR   ATWIE+KL+ YLAAPA+ VYM
Sbjct  19   TEPPLLSNKHESSDELEAILSDTHLPLLQRYTKATWIEMKLMFYLAAPAIFVYM  72



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  147  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            H +  +SNELE +L +T  P  +RLKLA WIE KLL YLA+PAV+VYM
Sbjct  35   HHDLHSSNELERVLSETDRPFLERLKLALWIESKLLFYLASPAVIVYM  82



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +3

Query  96   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  275
            A  +PL  ++G  S+  HE S +  +LE IL D  +P   R+  ATWIELKLL +LAAPA
Sbjct  4    AEKEPLLTAEGTRSNSKHESS-SHGQLERILSDDTLPFLNRVGPATWIELKLLFFLAAPA  62

Query  276  VVVYM  290
            V+VY+
Sbjct  63   VIVYL  67



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 46/79 (58%), Gaps = 10/79 (13%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPP--------HEESEASNELESILMDTGIPRWQRLKLAT  233
            M SS      P+ +SD   S PP           SE S +LESIL +T +   +RL+LAT
Sbjct  1    MKSSPEVVQKPILQSDD--SDPPLSSSLQSDDTRSETSAQLESILSNTQLRLSERLRLAT  58

Query  234  WIELKLLCYLAAPAVVVYM  290
            W ELKLL YLA PAV+VYM
Sbjct  59   WTELKLLFYLAGPAVLVYM  77



>gb|KDO75454.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=456

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 9/66 (14%)
 Frame = +3

Query  93   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  272
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  273  AVVVYM  290
            AV VY+
Sbjct  58   AVFVYL  63



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  147  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+VY+
Sbjct  15   HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLFHLAAPAVIVYL  62



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  135  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S   H +   SNELE IL +   P  +RL+LA+W+ELKLL  LAAPAV+VY+
Sbjct  10   SKVSHHDETVSNELEEILTNNQSPYSKRLRLASWVELKLLFQLAAPAVIVYL  61



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 7/61 (11%)
 Frame = +3

Query  129  VVSSPPHEES-------EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  287
            ++ S P  ES       E S+ LE +L DT +P ++RL+LATWIELKLL  LAAPAV VY
Sbjct  10   ILGSEPAYESLASASHGEESSSLEKVLSDTQLPYFKRLRLATWIELKLLFRLAAPAVFVY  69

Query  288  M  290
            +
Sbjct  70   V  70



>emb|CDY33130.1| BnaCnng07010D [Brassica napus]
Length=308

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +3

Query  78   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  248
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPFFHRLREATMIESK  59

Query  249  LLCYLAAPAVVVYM  290
            LL  LAAPAV+VYM
Sbjct  60   LLFKLAAPAVIVYM  73



>gb|KDO75455.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=444

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 9/66 (14%)
 Frame = +3

Query  93   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  272
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  273  AVVVYM  290
            AV VY+
Sbjct  58   AVFVYL  63



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +3

Query  63   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  236
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  237  IELKLLCYLAAPAVVVYM  290
            IELKLL  LAAPAV VY+
Sbjct  60   IELKLLFRLAAPAVFVYL  77



>emb|CBI28939.3| unnamed protein product [Vitis vinifera]
Length=353

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  11   MESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATSTESKLLF  68

Query  258  YLAAPAVVVYM  290
             LA PAV VYM
Sbjct  69   RLAGPAVAVYM  79



>ref|XP_011048008.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Populus 
euphratica]
Length=485

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +3

Query  63   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  236
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  237  IELKLLCYLAAPAVVVYM  290
            IELKLL  LAAPAV VY+
Sbjct  60   IELKLLFRLAAPAVFVYL  77



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 9/66 (14%)
 Frame = +3

Query  93   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  272
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  273  AVVVYM  290
            AV VY+
Sbjct  58   AVFVYL  63



>ref|XP_010546899.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546908.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=503

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  138  SPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            SP  +ESEA + LES+L DT +P ++RL LA+ +E+K L +LAAPAV VY+
Sbjct  16   SPKPQESEADHRLESVLSDTHLPYFRRLYLASMLEMKFLFHLAAPAVFVYL  66



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +3

Query  63   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  236
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  237  IELKLLCYLAAPAVVVYM  290
            IELKLL  LAAPAV VY+
Sbjct  60   IELKLLFRLAAPAVFVYL  77



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 46/78 (59%), Gaps = 6/78 (8%)
 Frame = +3

Query  57   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  236
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  237  IELKLLCYLAAPAVVVYM  290
            IE+KLL  LAAPAV VYM
Sbjct  63   IEMKLLFRLAAPAVFVYM  80



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 46/78 (59%), Gaps = 6/78 (8%)
 Frame = +3

Query  57   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  236
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  237  IELKLLCYLAAPAVVVYM  290
            IE+KLL  LAAPAV VYM
Sbjct  63   IEMKLLFRLAAPAVFVYM  80



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 3/49 (6%)
 Frame = +3

Query  144  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            PH+     ++LE++L D  +  + RL+LATWIELKLL YLAAPAV+VYM
Sbjct  32   PHQ---VDSKLETVLTDMELTYFNRLRLATWIELKLLFYLAAPAVMVYM  77



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            MDS +   + P+ ES    SS      E+S+ELE +L D  +P  +RL  ATWIELKLL 
Sbjct  1    MDSQDDQLHTPILESMQC-SSSTGNTFESSSELEKVLSDLQLPWLRRLLKATWIELKLLF  59

Query  258  YLAAPAVVVYM  290
             LAAPA++VY+
Sbjct  60   RLAAPAILVYL  70



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  135  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S   H +   SNELE IL +   P  +R++LA+W+ELKLL  LAAPAV+VY+
Sbjct  10   SKVSHHDETVSNELEEILTNNQSPYSKRVRLASWVELKLLFQLAAPAVIVYL  61



>gb|KJB57729.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=357

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +3

Query  57   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  236
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  237  IELKLLCYLAAPAVVVYM  290
            IE+KLL  LAAPAV VYM
Sbjct  63   IEMKLLFRLAAPAVFVYM  80



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 9/66 (14%)
 Frame = +3

Query  93   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  272
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  273  AVVVYM  290
            AV VY+
Sbjct  58   AVFVYL  63



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 9/66 (14%)
 Frame = +3

Query  93   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  272
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  273  AVVVYM  290
            AV VY+
Sbjct  58   AVFVYL  63



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 46/78 (59%), Gaps = 6/78 (8%)
 Frame = +3

Query  57   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  236
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSGLEKVLSDTELPFFKRLRLATL  62

Query  237  IELKLLCYLAAPAVVVYM  290
            IE+KLL  LAAPAV VYM
Sbjct  63   IEMKLLFRLAAPAVFVYM  80



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            M S +   + P+ ES    SS      E+S+ELE +L D  +P  +RL+ ATWIELKLL 
Sbjct  1    MGSQDDQLHTPILESMQR-SSSTGSTFESSSELEKVLSDLQLPWLRRLRTATWIELKLLF  59

Query  258  YLAAPAVVVYM  290
             LAAPAV+VY+
Sbjct  60   RLAAPAVLVYL  70



>ref|XP_007212447.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
 gb|EMJ13646.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
Length=490

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 7/59 (12%)
 Frame = +3

Query  135  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S P     EASN+       LE +L DT +P ++RL+LATWIEL LL  LAAPAV+VY+
Sbjct  15   SEPDSTALEASNQGDGLESPLEKVLSDTQLPSFKRLRLATWIELNLLFRLAAPAVLVYV  73



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 6/76 (8%)
 Frame = +3

Query  63   LTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIE  242
            + +S  D +N   ++P+ +S+G    P       S+ELE  L D  +  +QR+K ATWIE
Sbjct  1    MDSSNTDINNNNVHEPMLQSNGSEVEP------VSSELEEALSDDSLSFFQRIKKATWIE  54

Query  243  LKLLCYLAAPAVVVYM  290
            LK L  LAAPA++VYM
Sbjct  55   LKNLFRLAAPAILVYM  70



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATSTESKLLF  58

Query  258  YLAAPAVVVYM  290
             LA PAV VYM
Sbjct  59   RLAGPAVAVYM  69



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            AS+ELE +L D+ +P +QRL+ A+WIE +LL  LAAPAV VYM
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIEFQLLFRLAAPAVAVYM  65



>ref|XP_008364096.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Malus 
domestica]
Length=462

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 14/86 (16%)
 Frame = +3

Query  54   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  212
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  213  QRLKLATWIELKLLCYLAAPAVVVYM  290
            +R + ATWIELKLL  LAAPAV+VY+
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYV  90



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +3

Query  147  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            H+E+  S+ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+VY+
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVELKLLFHLAAPAVIVYL  61



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +3

Query  105  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  284
             PLP S   ++    +   +S  LE IL DT IP  +RL LAT IE+KLL +LAAPAV+V
Sbjct  22   QPLPTSTPSMAGDVDDPHGSSGRLERILTDTSIPWARRLPLATAIEMKLLIHLAAPAVIV  81

Query  285  YM  290
            YM
Sbjct  82   YM  83



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  147  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+ Y+
Sbjct  15   HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLLHLAAPAVIDYL  62



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +3

Query  147  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            H++ E  S+ELE IL DT  P  +R++ A+W+ELKLL +LAAPAV+VY+
Sbjct  15   HDDHETVSDELEQILTDTEAPYSKRIRSASWVELKLLFHLAAPAVIVYL  63



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +3

Query  78   MDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKL  251
            MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+WIELKL
Sbjct  1    MDSKESRGELQEPLVLSSTEPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASWIELKL  59

Query  252  LCYLAAPAVVVYM  290
            L  LAAPAV VY+
Sbjct  60   LFRLAAPAVFVYL  72



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 14/86 (16%)
 Frame = +3

Query  54   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  212
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  213  QRLKLATWIELKLLCYLAAPAVVVYM  290
            +R + ATWIELKLL  LAAPAV+VY+
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYV  90



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 44/72 (61%), Gaps = 5/72 (7%)
 Frame = +3

Query  78   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  254
            MDSS N   Y PL        SPP  ES ++ ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGVYQPLLHPQ---PSPPTTES-SNGELETVLSDVETPLFLRLRKATTIESKLL  56

Query  255  CYLAAPAVVVYM  290
              LAAPAV+VYM
Sbjct  57   FNLAAPAVIVYM  68



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 14/86 (16%)
 Frame = +3

Query  54   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  212
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  213  QRLKLATWIELKLLCYLAAPAVVVYM  290
            +R + ATWIELKLL  LAAPAV+VY+
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYV  90



>gb|KEH39009.1| MATE efflux family protein [Medicago truncatula]
Length=461

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 2/52 (4%)
 Frame = +3

Query  135  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+
Sbjct  20   TSQKHHESDG--ELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYL  69



>ref|XP_008364095.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X5 [Malus 
domestica]
Length=509

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 14/86 (16%)
 Frame = +3

Query  54   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  212
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  213  QRLKLATWIELKLLCYLAAPAVVVYM  290
            +R + ATWIELKLL  LAAPAV+VY+
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYV  90



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 14/86 (16%)
 Frame = +3

Query  54   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  212
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  213  QRLKLATWIELKLLCYLAAPAVVVYM  290
            +R + ATWIELKLL  LAAPAV+VY+
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYV  90



>ref|XP_006389634.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
 gb|ERP48548.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
Length=486

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 7/78 (9%)
 Frame = +3

Query  63   LTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  236
            + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ AT+
Sbjct  6    IENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRATF  60

Query  237  IELKLLCYLAAPAVVVYM  290
            IELK L  LA PAVVVY+
Sbjct  61   IELKTLFQLAGPAVVVYL  78



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 14/86 (16%)
 Frame = +3

Query  54   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  212
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  213  QRLKLATWIELKLLCYLAAPAVVVYM  290
            +R + ATWIELKLL  LAAPAV+VY+
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYV  90



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 2/52 (4%)
 Frame = +3

Query  135  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+
Sbjct  20   TSQKHHESDG--ELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYL  69



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  258  YLAAPAVVVYM  290
             LA PAV VYM
Sbjct  59   RLAGPAVAVYM  69



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  159  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
             +SNELE +L DT  P  +RLK A WIE KLL YLAAPAV+VYM
Sbjct  38   HSSNELERVLSDTDRPFLERLKPALWIESKLLFYLAAPAVIVYM  81



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            AS+ELE +L D+ +P +QRL+ A+WI+ +LL  LAAPAV VYM
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIKFQLLFRLAAPAVAVYM  65



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  141  PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            PP    E S++LE IL D G+    R K ATW+ELKLL  LAAPA++VY+
Sbjct  20   PPPVGEEVSSDLEQILTDDGLTFSTRYKKATWVELKLLTRLAAPAIIVYL  69



>gb|KJB69294.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=497

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 13/84 (15%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEES-------------EASNELESILMDTGIPRWQR  218
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  219  LKLATWIELKLLCYLAAPAVVVYM  290
            L+LA+WIEL+LL +LA PAV VY+
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYL  84



>emb|CAN69305.1| hypothetical protein VITISV_021605 [Vitis vinifera]
Length=320

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  258  YLAAPAVVVYM  290
             LA PAV VYM
Sbjct  59   RLAGPAVAVYM  69



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
             S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYM
Sbjct  20   GSSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYM  62



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
             S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYM
Sbjct  20   GSSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYM  62



>ref|XP_010930078.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Elaeis 
guineensis]
Length=494

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 42/64 (66%), Gaps = 5/64 (8%)
 Frame = +3

Query  105  DPLPESDGVVSSP--PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  278
             PLP S  + +    PH    +   LESIL +T +P  +RL+LAT IE+KLL +LAAPAV
Sbjct  23   HPLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRLATVIEMKLLIHLAAPAV  79

Query  279  VVYM  290
            +VYM
Sbjct  80   IVYM  83



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  153  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            ++  ++ELE++L +T +P   R   ATWIE+KLL YLAAPA++VYM
Sbjct  13   KNACNDELETLLSNTHLPLLHRYTQATWIEMKLLFYLAAPAILVYM  58



>gb|KFK39485.1| hypothetical protein AALP_AA3G250300 [Arabis alpina]
Length=510

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +3

Query  78   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  248
            MDSS N   Y PL  P  DG + SP  E    + ELE +L D   P +  L+ AT IE K
Sbjct  1    MDSSQNEGVYQPLIQPHGDGTLPSPLSESR--NGELERVLSDFEAPLFLCLRKATIIESK  58

Query  249  LLCYLAAPAVVVYM  290
            LL  LAAPAV+VYM
Sbjct  59   LLFKLAAPAVIVYM  72



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  147  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            H   E ++ LE IL DT +P  +RL+LA+ IELKLL  LAAPAV VYM
Sbjct  21   HAHCEVNSRLEKILNDTQLPYLKRLRLASVIELKLLFRLAAPAVFVYM  68



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 7/61 (11%)
 Frame = +3

Query  129  VVSSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  287
            ++ S P   +E S+        LE +L DT +P ++RL++ATWIELKLL  LAAPAV+VY
Sbjct  10   IIDSEPEPAAETSSNGDGVDFLLEKVLSDTQLPPFKRLRMATWIELKLLFRLAAPAVLVY  69

Query  288  M  290
            +
Sbjct  70   V  70



>ref|XP_007045634.1| MATE efflux family protein isoform 2 [Theobroma cacao]
 gb|EOY01466.1| MATE efflux family protein isoform 2 [Theobroma cacao]
Length=424

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = +3

Query  75   VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  254
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQS-----QTSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  255  CYLAAPAVVVYM  290
             +LAAPAV+VYM
Sbjct  56   FHLAAPAVIVYM  67



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 7/72 (10%)
 Frame = +3

Query  87   SNGAAYDPLPESDGVVSSPPHEESEASNE----LESILMDTGIPRWQRLKLATWIELKLL  254
            S G  + P+  S+     P  E S   +     LE++L DT +P ++RL++ATWIELKLL
Sbjct  2    SQGQLHQPILASE---QEPAAEASSNGDRVDFLLETVLSDTQLPPFKRLRMATWIELKLL  58

Query  255  CYLAAPAVVVYM  290
              LAAPAV VY+
Sbjct  59   FRLAAPAVSVYV  70



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  156  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            + +S+ELE +L DT +P   R K ATWIEL+LL  LAAPAV++YM
Sbjct  34   THSSSELEKVLSDTDLPFLTRYKKATWIELRLLFKLAAPAVMMYM  78



>ref|XP_011048000.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=505

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 7/78 (9%)
 Frame = +3

Query  63   LTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  236
            + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ AT+
Sbjct  24   IENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRATF  78

Query  237  IELKLLCYLAAPAVVVYM  290
            IELK L  LA PA+VVY+
Sbjct  79   IELKTLFQLAGPAIVVYL  96



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = +3

Query  75   VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  254
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQS-----QTSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  255  CYLAAPAVVVYM  290
             +LAAPAV+VYM
Sbjct  56   FHLAAPAVIVYM  67



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 42/64 (66%), Gaps = 5/64 (8%)
 Frame = +3

Query  105  DPLPESDGVVSSP--PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  278
             PLP S  + +    PH    +   LESIL +T +P  +RL+LAT IE+KLL +LAAPAV
Sbjct  23   HPLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRLATVIEMKLLIHLAAPAV  79

Query  279  VVYM  290
            +VYM
Sbjct  80   IVYM  83



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = +3

Query  105  DPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  278
             PLP S  V      PH    +S  LESIL DT IP  +RL+LAT IE+KLL +LA P+V
Sbjct  22   HPLPPSSPVTGDIDDPHG---SSGRLESILTDTSIPWARRLRLATIIEMKLLLHLAVPSV  78

Query  279  VVYM  290
             VYM
Sbjct  79   TVYM  82



>ref|XP_011047999.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=534

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 7/78 (9%)
 Frame = +3

Query  63   LTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  236
            + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ AT+
Sbjct  24   IENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRATF  78

Query  237  IELKLLCYLAAPAVVVYM  290
            IELK L  LA PA+VVY+
Sbjct  79   IELKTLFQLAGPAIVVYL  96



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 42/66 (64%), Gaps = 8/66 (12%)
 Frame = +3

Query  114  PESDGV-------VSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  272
            P++DGV        SSP   ES ++ ELE++L D   P  QRL+ AT IE KLL  LAAP
Sbjct  4    PQNDGVDQPLLQPQSSPSTTES-SNGELETVLSDVETPLVQRLRKATMIESKLLFNLAAP  62

Query  273  AVVVYM  290
            AV+VYM
Sbjct  63   AVIVYM  68



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 13/84 (15%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPH-------------EESEASNELESILMDTGIPRWQR  218
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  219  LKLATWIELKLLCYLAAPAVVVYM  290
            L+LA+WIEL+LL +LA PAV VY+
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYL  84



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +3

Query  147  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            H+E+  S+ELE IL DT  P ++R++ A+W+E+KLL  LAAPAV+VY+
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVEMKLLFRLAAPAVIVYL  61



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  141  PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            P     E+  ELE +L DT +P + R+  ATWIEL+LL +LAAPAV VY+
Sbjct  16   PGKGAHESDGELERLLSDTTVPYFTRVCSATWIELRLLFFLAAPAVFVYL  65



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  153  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            ES AS +LESIL D  IP  +R+ +A+ +E+KLL YLAAPAV+VYM
Sbjct  4    ESGASQKLESILSDNSIPWARRIWMASLVEMKLLVYLAAPAVMVYM  49



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +3

Query  105  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  284
            +P PE      S   +   +  ELE IL +T +P  +RL  ATW+ELKLL +LAAPAV+V
Sbjct  19   EPSPEPPSCTQSFSSKHG-SDGELERILSNTSVPFAKRLGPATWVELKLLFHLAAPAVIV  77

Query  285  YM  290
            Y+
Sbjct  78   YL  79



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 4/59 (7%)
 Frame = +3

Query  114  PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            P  DG +  P          LESIL D   PR +RL+LAT +E+KLL +LAAP V+VYM
Sbjct  29   PSMDGDIDDPHGSR----GRLESILTDPSFPRARRLQLATIVEMKLLVHLAAPTVIVYM  83



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 40/65 (62%), Gaps = 7/65 (11%)
 Frame = +3

Query  105  DPLPESD---GVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  275
             PLP S    G V  P      +S  LESIL DT +P  +RL+LAT +E+KLL +LA PA
Sbjct  22   HPLPPSSPTTGTVDDP----HGSSGRLESILTDTTVPWSRRLRLATIVEMKLLLHLAGPA  77

Query  276  VVVYM  290
            V VYM
Sbjct  78   VTVYM  82



>ref|XP_010051023.1| PREDICTED: protein TRANSPARENT TESTA 12 [Eucalyptus grandis]
 gb|KCW89409.1| hypothetical protein EUGRSUZ_A01710 [Eucalyptus grandis]
Length=520

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 44/82 (54%), Gaps = 11/82 (13%)
 Frame = +3

Query  78   MDSSNGAA----YDPLPESDGVVSSPPHEES-------EASNELESILMDTGIPRWQRLK  224
            M SS  A     YDPLPES  V   P            E S  LES+L D  +    R++
Sbjct  1    MGSSQAAGGDRKYDPLPESTQVPPPPSPRPHRPRPDHHETSGHLESVLSDPSLTLGARVR  60

Query  225  LATWIELKLLCYLAAPAVVVYM  290
             A+ IELKLL +LAAPAVVVYM
Sbjct  61   AASRIELKLLFHLAAPAVVVYM  82



>ref|XP_009145464.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 6/72 (8%)
 Frame = +3

Query  78   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  254
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  255  CYLAAPAVVVYM  290
              LAAPAV+VYM
Sbjct  56   FKLAAPAVIVYM  67



>emb|CDY33129.1| BnaCnng07000D [Brassica napus]
Length=505

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 6/72 (8%)
 Frame = +3

Query  78   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  254
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  255  CYLAAPAVVVYM  290
              LAAPAV+VYM
Sbjct  56   FKLAAPAVIVYM  67



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  159  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            E+  ELE +L DT +P  +R+  ATWIEL+LL +LAAPAV VY+
Sbjct  26   ESDGELERLLSDTTVPFLRRVGSATWIELRLLFFLAAPAVFVYL  69



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  153  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            E   S++LE IL D  IP  +R ++ATWIELK L  LAAPAVVVYM
Sbjct  29   EYRWSDQLEKILTDPHIPTLKRYRMATWIELKRLFLLAAPAVVVYM  74



>gb|KDO78208.1| hypothetical protein CISIN_1g010561mg [Citrus sinensis]
Length=507

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 6/63 (10%)
 Frame = +3

Query  102  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  281
            ++P+ +S+G    P       S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNGSEVEP------VSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  282  VYM  290
            VYM
Sbjct  67   VYM  69



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 6/63 (10%)
 Frame = +3

Query  102  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  281
            ++P+ +S+G    P       S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNGSEVEP------VSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  282  VYM  290
            VYM
Sbjct  67   VYM  69



>ref|XP_008371179.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=340

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 14/86 (16%)
 Frame = +3

Query  54   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  212
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  213  QRLKLATWIELKLLCYLAAPAVVVYM  290
            +R + ATWIELKLL  LAAPAV+VY+
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYV  90



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYM
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYM  61



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYM
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYM  61



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ELE  L +T +P + RL+ ATW+ELK+L  LAAPAVVVY+
Sbjct  27   SSELEETLSNTELPYFHRLRRATWVELKILFRLAAPAVVVYL  68



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 38/59 (64%), Gaps = 7/59 (12%)
 Frame = +3

Query  135  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S P    +EAS         LE +L DT +  ++RL+LATWIELKLL  LAAPAV+VY+
Sbjct  15   SEPDLAAAEASGHGDGFESPLEKVLSDTQLSSFKRLRLATWIELKLLFRLAAPAVLVYI  73



>emb|CDY69153.1| BnaAnng29470D [Brassica napus]
Length=317

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 6/72 (8%)
 Frame = +3

Query  78   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  254
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  255  CYLAAPAVVVYM  290
              LAAPAV+VYM
Sbjct  56   FKLAAPAVIVYM  67



>ref|XP_009345550.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ELE  L +T    +QRL+ ATW+E K LC LAAPAVVVY+
Sbjct  26   SSELEDTLNNTDFSYFQRLRTATWLEAKTLCRLAAPAVVVYL  67



>ref|XP_006467446.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Citrus 
sinensis]
 ref|XP_006467447.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Citrus 
sinensis]
Length=488

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 6/63 (10%)
 Frame = +3

Query  102  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  281
            ++P+ +S+G    P       S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNGSEVEP------VSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  282  VYM  290
            VYM
Sbjct  67   VYM  69



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 42/64 (66%), Gaps = 5/64 (8%)
 Frame = +3

Query  105  DPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  278
             PLP S  + +    PH    +S  LESIL DT +   +RL+LAT IE+KLL +LAAPAV
Sbjct  22   QPLPSSSPMAADMDDPHG---SSGRLESILTDTSLSWARRLQLATIIEMKLLIHLAAPAV  78

Query  279  VVYM  290
            +VYM
Sbjct  79   IVYM  82



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 39/70 (56%), Gaps = 8/70 (11%)
 Frame = +3

Query  84   SSNGAAYDPLPESDGVVSSPPHEESE-ASNELESILMDTGIPRWQRLKLATWIELKLLCY  260
            S N A Y PL +       P    +E    ELE +L D   P  +R+  ATWIE KLL +
Sbjct  4    SRNDAVYQPLLQ-------PVAAAAEYGGGELERVLTDAETPAMRRVGRATWIESKLLFH  56

Query  261  LAAPAVVVYM  290
            LAAPAV+VYM
Sbjct  57   LAAPAVIVYM  66



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S ELE +L DT +P + RL+LA+WIEL+LL  LA PAV++Y+
Sbjct  44   STELEGVLSDTQLPLFNRLRLASWIELRLLFRLAGPAVMMYL  85



>ref|XP_006348109.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Solanum 
tuberosum]
Length=427

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYM
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYM  61



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
             S+ELE +L D+ +P ++RL+ A+WIE +LL  LAAP+V VYM
Sbjct  20   GSSELEEVLSDSQLPYFRRLRYASWIEFQLLYRLAAPSVAVYM  62



>gb|KGN43526.1| hypothetical protein Csa_7G043680 [Cucumis sativus]
Length=517

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  159  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            + S+ELE +L DT +   +R  LA+WIE+KL+ YLAAPAV VY+
Sbjct  32   KTSDELEKVLSDTQLSVLRRYSLASWIEMKLMFYLAAPAVFVYV  75



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPAV VY+
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAVAVYL  61



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  159  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            E+  ELE IL ++ +P  +R++LAT +ELKLL YLAAP+V+VY+
Sbjct  31   ESDGELERILSNSSVPFIKRIQLATRVELKLLFYLAAPSVIVYL  74



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 37/59 (63%), Gaps = 7/59 (12%)
 Frame = +3

Query  135  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S P     EASN        LE +L DT +P ++RL+ ATWIEL LL  LAAPAV+VY+
Sbjct  15   SEPDSTAPEASNHGDGLESPLEKVLSDTQLPFFKRLRSATWIELNLLFRLAAPAVLVYV  73



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 7/59 (12%)
 Frame = +3

Query  135  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S P    +EAS         LE +L DT +  ++RL+LA+WIELKLL  LAAPAV+VY+
Sbjct  15   SEPDSAAAEASGHGDGLESLLEKVLSDTQLSSFKRLRLASWIELKLLFRLAAPAVLVYI  73



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
             + ELE IL DT I    R + ATWIE+KLL YLAAPAV VY+
Sbjct  34   GNEELERILSDTEISVMDRYRRATWIEIKLLFYLAAPAVFVYI  76



>ref|XP_004144588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 6/62 (10%)
 Frame = +3

Query  105  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  284
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  285  YM  290
            Y+
Sbjct  62   YL  63



>gb|KGN43522.1| Mate efflux family protein [Cucumis sativus]
Length=507

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 6/62 (10%)
 Frame = +3

Query  105  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  284
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  285  YM  290
            Y+
Sbjct  62   YL  63



>ref|XP_004173828.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=307

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  153  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM
Sbjct  13   KNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYM  58



>ref|XP_004159226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 6/62 (10%)
 Frame = +3

Query  105  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  284
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  285  YM  290
            Y+
Sbjct  62   YL  63



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +3

Query  105  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  284
             PLP S     +   E   AS +LE +L D  IP  +R+ LA+ IE+KLL +LAAPAV+V
Sbjct  22   QPLPPSTPPAMADEGEAHGASGQLEIVLNDASIPWARRMWLASLIEMKLLVFLAAPAVMV  81

Query  285  YM  290
            YM
Sbjct  82   YM  83



>ref|XP_008455433.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=515

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  159  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            + S+ELE IL DT +   +R   ATWIE+KL+ YLAAPAV VY+
Sbjct  33   KTSDELEKILSDTQLSVVRRYSQATWIEMKLMFYLAAPAVFVYV  76



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 41/72 (57%), Gaps = 3/72 (4%)
 Frame = +3

Query  78   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  254
            MDSS N   Y P  +  G  + P  E S    ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDDFYQPFLQPLGDETVPSTESS--IGELERVLSDVETPLFLRLRKATMIESKLL  58

Query  255  CYLAAPAVVVYM  290
              LAAPAVVVYM
Sbjct  59   FNLAAPAVVVYM  70



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  258  YLAAPAVVVYM  290
             LAAPAV+VYM
Sbjct  61   RLAAPAVLVYM  71



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  153  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM
Sbjct  13   KNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYM  58



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  258  YLAAPAVVVYM  290
             LAAPAV+VYM
Sbjct  61   RLAAPAVLVYM  71



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = +3

Query  78   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  258  YLAAPAVVVYM  290
             LAAPAV+VYM
Sbjct  61   RLAAPAVLVYM  71



>ref|XP_010533819.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Tarenaya 
hassleriana]
Length=320

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 4/52 (8%)
 Frame = +3

Query  135  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYV  64



>ref|XP_010533821.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X5 [Tarenaya 
hassleriana]
 ref|XP_010533822.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Tarenaya 
hassleriana]
Length=313

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 4/52 (8%)
 Frame = +3

Query  135  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYV  64



>ref|XP_010533818.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=328

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 4/52 (8%)
 Frame = +3

Query  135  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYV  64



>ref|XP_009361291.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
 ref|XP_009361361.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  168  NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            +ELE  L +T    +QRL+ ATW+E K LC LAAPAVVVY+
Sbjct  27   SELEDTLNNTDFSYFQRLRTATWLETKTLCRLAAPAVVVYL  67



>ref|XP_010533820.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Tarenaya 
hassleriana]
Length=315

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 4/52 (8%)
 Frame = +3

Query  135  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYV  64



>ref|XP_010533817.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
Length=351

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 4/52 (8%)
 Frame = +3

Query  135  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYV  64



>ref|XP_007212986.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
 gb|EMJ14185.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
Length=487

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S ELE  L +T +  +QRL+  TW+ELK+L  LAAPAVVVY+
Sbjct  5    SRELEDTLNNTELSYFQRLRTGTWLELKILFRLAAPAVVVYL  46



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
             + ELE IL DT +   +R   ATWIE+KLL YLAAPAV VY+
Sbjct  34   GNEELERILSDTEMSAMERYSRATWIEIKLLFYLAAPAVFVYI  76



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 7/69 (10%)
 Frame = +3

Query  105  DPLPESDGVVSSPPHEESEA-------SNELESILMDTGIPRWQRLKLATWIELKLLCYL  263
            +PL  SD   S  P   +++         ELE IL +T +P  +R+  ATW+ELK L +L
Sbjct  12   EPLLVSDEPSSPQPPSFTQSFSSRHGSDGELERILSNTSVPFAKRIGPATWVELKFLFHL  71

Query  264  AAPAVVVYM  290
            AAPAV+VY+
Sbjct  72   AAPAVIVYL  80



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +3

Query  138  SPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            SP   ES ++ ELE++L D   P +QRL+ AT IE KLL  LAAPAV+VYM
Sbjct  19   SPKTTES-SNGELETVLSDVETPLFQRLRKATMIESKLLFNLAAPAVIVYM  68



>ref|XP_008347106.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12-like 
[Malus domestica]
Length=508

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ELE  L +T +  +QRL+ ATW+E K+L  LAAPAVVVY+
Sbjct  26   SSELEDTLNNTDLSNFQRLRTATWLETKILYRLAAPAVVVYL  67



>ref|XP_006406243.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47696.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=468

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = +3

Query  78   MDSS--NGAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  239
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  240  ELKLLCYLAAPAVVVYM  290
            E KLL  LAAPAVVVYM
Sbjct  61   ESKLLFKLAAPAVVVYM  77



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            +S ELE IL D  +P  +R+  ATW+ELKLL  LAAPAV+VY+
Sbjct  37   SSGELEQILTDISLPYSKRVGAATWLELKLLFNLAAPAVIVYL  79



>ref|XP_011048004.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
 ref|XP_011048005.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ELE IL +  + R +RL  ATW+ELK+L  LAAPA+VVYM
Sbjct  34   SSELEDILSNMELSRSKRLLRATWVELKILFPLAAPAIVVYM  75



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 42/72 (58%), Gaps = 4/72 (6%)
 Frame = +3

Query  78   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  254
            MDSS N     PL     +  SP   ES  + ELE++L D   P  QRL+ AT IE KLL
Sbjct  1    MDSSQNDGVSQPLLHPPQL--SPSTTESN-NGELETVLSDVETPLLQRLRKATMIESKLL  57

Query  255  CYLAAPAVVVYM  290
              LAAPAV+VYM
Sbjct  58   FNLAAPAVIVYM  69



>gb|KDP20757.1| hypothetical protein JCGZ_21228 [Jatropha curcas]
Length=301

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  147  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            + E   S+ELE IL ++ IP +QR + ATW+ELK +  LAAPA VVY+
Sbjct  3    NNEKPVSSELEQILSNSEIPCFQRPRRATWLELKTVFSLAAPAAVVYL  50



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            +  ELE IL +T +P  +R+  ATW+ELK L +LAAPAV+VY+
Sbjct  38   SDGELERILSNTSVPFAKRIGPATWVELKFLFHLAAPAVIVYL  80



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 7/61 (11%)
 Frame = +3

Query  108  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  287
            P P SD V        S +S+ELE +L D  +P  +R + ATWIELKLL  LAAPAV++Y
Sbjct  18   PPPPSDAV-------ASHSSSELEKVLSDADLPCLKRYRKATWIELKLLFKLAAPAVMMY  70

Query  288  M  290
            +
Sbjct  71   L  71



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 43/73 (59%), Gaps = 7/73 (10%)
 Frame = +3

Query  78   MDSSN-GAAYDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKL  251
            MDS+     Y PL + D +   P     E++N ELE +L D   P + RL+ AT IE KL
Sbjct  1    MDSAQTDGVYQPLLQPDQLSPLP-----ESNNCELERVLADVETPLFLRLRKATMIETKL  55

Query  252  LCYLAAPAVVVYM  290
            L  LAAPAV+VYM
Sbjct  56   LFKLAAPAVIVYM  68



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = +3

Query  78   MDSS--NGAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  239
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  240  ELKLLCYLAAPAVVVYM  290
            E KLL  LAAPAVVVYM
Sbjct  61   ESKLLFKLAAPAVVVYM  77



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 7/57 (12%)
 Frame = +3

Query  141  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYM
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYM  77



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 7/57 (12%)
 Frame = +3

Query  141  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYM
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYM  77



>gb|KGN43524.1| hypothetical protein Csa_7G043660 [Cucumis sativus]
Length=485

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 6/62 (10%)
 Frame = +3

Query  105  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  284
            +PL E     S+  HE    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEK----SAAKHEA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  285  YM  290
            Y+
Sbjct  62   YL  63



>gb|KDP20755.1| hypothetical protein JCGZ_21226 [Jatropha curcas]
Length=359

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            ++ELE IL DT    + R++LA+W+ELKLL  +A PAV+VY+
Sbjct  19   NSELEEILTDTETSSFTRIQLASWVELKLLFRIAGPAVIVYL  60



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ELE IL +  + R +R+  ATW+ELK+L  LAAPA+VVYM
Sbjct  34   SSELEDILSNMELSRSKRILRATWVELKILFPLAAPAIVVYM  75



>ref|XP_008455546.1| PREDICTED: MATE efflux family protein LAL5-like [Cucumis melo]
Length=177

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  123  DGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            + +V     +    S ELE+IL +T +    R++ A WIELKLL  LAAPAV VYM
Sbjct  8    ESLVEKAAAKHEAVSGELENILSNTELGYVIRIRRAAWIELKLLSKLAAPAVFVYM  63



>ref|XP_009361804.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=509

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY+
Sbjct  26   SSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYL  67



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  147  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            H   E  + LE +L D+ +  ++RL+LA+ IEL+LL  LAAPAV VYM
Sbjct  34   HRGHEVDSRLEKVLTDSDLSFFKRLRLASGIELRLLFRLAAPAVFVYM  81



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 18/92 (20%)
 Frame = +3

Query  30   EQAAPRFPPHHLTNSVMDSSNG---AAYDPLP--ESDGVVSSPPHEESEASNELESILMD  194
            E ++P   P H      D  +G    A  PLP   +DG            S +LESIL D
Sbjct  9    ELSSPLIFPAH------DDGHGLPLQASTPLPPVAADG-------TAHGTSGKLESILND  55

Query  195  TGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            T IP  +R+ LA+ IE++LL  LAAPA++VY+
Sbjct  56   TSIPWLRRVGLASLIEMRLLLSLAAPAIIVYL  87



>ref|XP_009345545.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY+
Sbjct  26   SSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYL  67



>ref|XP_009361725.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=509

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY+
Sbjct  26   SSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYL  67



>gb|EYU29855.1| hypothetical protein MIMGU_mgv1a004845mg [Erythranthe guttata]
Length=507

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 39/71 (55%), Gaps = 9/71 (13%)
 Frame = +3

Query  84   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            S N    +PL  P S+G          E S+ELE +L DT +  W+R + A  IEL+ L 
Sbjct  4    SKNKGVSEPLLEPNSNG-------GTEEVSSELEDVLCDTTLSGWRRFQKAIVIELRYLL  56

Query  258  YLAAPAVVVYM  290
             LA PAVVVY+
Sbjct  57   RLAGPAVVVYL  67



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 40/74 (54%), Gaps = 10/74 (14%)
 Frame = +3

Query  78   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  248
            MDSS N     PL  P +D       H    ++ ELE +L D   P   RL+ AT IE K
Sbjct  1    MDSSQNDGVNQPLLQPHAD-------HGTESSNGELERVLSDVETPLSSRLRKATMIESK  53

Query  249  LLCYLAAPAVVVYM  290
            LL  LAAPAV+VYM
Sbjct  54   LLFKLAAPAVIVYM  67



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 36/64 (56%), Gaps = 5/64 (8%)
 Frame = +3

Query  114  PESDGVVSSPPHEESEAS-----NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  278
            P SD  +S P      +S      ELE  L +T +  +QR +  TW+ELK L  LAAPAV
Sbjct  3    PSSDNELSEPLLLSKSSSMHIVSRELEDTLNNTELSYFQRFRTGTWLELKTLFRLAAPAV  62

Query  279  VVYM  290
            VVY+
Sbjct  63   VVYL  66



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            +++S  H    A + LE +L D  +P  +R+  ATWIEL LL  LAAPA++VY+
Sbjct  13   LINSTHHHHHSADSRLEEVLSDPTLPWSKRILSATWIELNLLFPLAAPAILVYV  66



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            +++S  H    A + LE +L D  +P  +R+  ATWIEL LL  LAAPA++VY+
Sbjct  14   LINSTHHHHHSADSRLEEVLSDPTLPWSKRILSATWIELNLLFPLAAPAILVYV  67



>gb|EPS61219.1| hypothetical protein M569_13580, partial [Genlisea aurea]
Length=159

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  159  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            E S++LE  L +T +P+W+RL+ A  IEL++L  LA PAV+ Y+
Sbjct  2    EVSSDLEDALSNTAVPQWRRLERAVRIELRILSRLAGPAVISYL  45



>gb|EPS67796.1| hypothetical protein M569_06975, partial [Genlisea aurea]
Length=484

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  159  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            E S+ LE +L +  + RW+RL+ AT IELK+LC LA PAVV Y+
Sbjct  13   EISSHLEDVLSNAEMARWRRLQKATSIELKILCRLAGPAVVSYL  56



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  147  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            H E+  S +LESIL D  +P   R+  A+ +E++LL  LAAPAV+VYM
Sbjct  26   HGETAVSGQLESILGDASVPWGTRMASASAVEMRLLVRLAAPAVLVYM  73



>gb|KCW76957.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=458

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ LE +L DT +PR++RL  AT IEL  L  LAAPAVVVY+
Sbjct  35   SSALEDMLSDTELPRFRRLSRATRIELNTLFRLAAPAVVVYL  76



>gb|EYU29854.1| hypothetical protein MIMGU_mgv1a005159mg [Erythranthe guttata]
Length=495

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +3

Query  87   SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLA  266
            + GA   PL ES     + P    E S+ELE IL D  +  W+R + A+ IEL+    LA
Sbjct  6    NKGAVNQPLLES--YKPALPEAAEEVSSELEEILSDATLSWWRRYQKASVIELRYFFRLA  63

Query  267  APAVVVYM  290
             PAV+VY+
Sbjct  64   GPAVIVYL  71



>emb|CDY39493.1| BnaA01g24950D [Brassica napus]
Length=503

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 42/73 (58%), Gaps = 7/73 (10%)
 Frame = +3

Query  78   MDSSN-GAAYDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKL  251
            MDS+     Y PL + D +   P     E++N ELE  L D   P + RL+ AT IE KL
Sbjct  1    MDSAQTDGVYQPLLQPDQLSPLP-----ESNNCELERGLADVETPLFLRLRKATMIETKL  55

Query  252  LCYLAAPAVVVYM  290
            L  LAAPAV+VYM
Sbjct  56   LFKLAAPAVIVYM  68



>emb|CDY65669.1| BnaCnng48120D [Brassica napus]
Length=495

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 37/65 (57%), Gaps = 4/65 (6%)
 Frame = +3

Query  96   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  275
              Y PL + D + + P  +  E    LE +L D   P + RL+ AT IE KLL  LAAPA
Sbjct  8    GVYQPLLQPDQLSALPESKNCE----LERVLADVETPLFLRLRKATMIETKLLFKLAAPA  63

Query  276  VVVYM  290
            VVVYM
Sbjct  64   VVVYM  68



>gb|EYU29852.1| hypothetical protein MIMGU_mgv1a004818mg [Erythranthe guttata]
Length=508

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 39/71 (55%), Gaps = 11/71 (15%)
 Frame = +3

Query  87   SNGAAYDPLPESD---GVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  257
            + G   DPL ES    GV         E S+ELE +L DT +  W+R + A  IEL+ L 
Sbjct  6    NKGETTDPLLESSYGGGV--------EEVSSELEDVLCDTTLSGWRRFQKAIVIELRYLL  57

Query  258  YLAAPAVVVYM  290
             LA PAV+VY+
Sbjct  58   RLAGPAVLVYL  68



>ref|XP_006389635.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
 gb|ERP48549.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
Length=513

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ELE IL +  + R  R+  ATW+ELK+L  LAAPA+VVY+
Sbjct  34   SSELEDILCNMELSRSHRILRATWVELKILFPLAAPAIVVYL  75



>ref|XP_008371177.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVVY+
Sbjct  25   SSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVVYL  66



>ref|XP_010052837.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76956.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=514

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ LE +L DT +PR++RL  AT IEL  L  LAAPAVVVY+
Sbjct  35   SSALEDMLSDTELPRFRRLSRATRIELNTLFRLAAPAVVVYL  76



>ref|XP_011037659.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 5/74 (7%)
 Frame = +3

Query  69   NSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  248
            +S ++ +    Y+P+       S  P      S+ELE IL     PR QR+  AT +ELK
Sbjct  7    DSRIEYAEDEPYEPILHDKRSFSGEP-----VSSELEEILSVMEFPRSQRILRATRLELK  61

Query  249  LLCYLAAPAVVVYM  290
            +L  LAAPA+VVY+
Sbjct  62   ILSRLAAPAIVVYL  75



>ref|XP_008371097.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVVY+
Sbjct  25   SSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVVYL  66



>ref|XP_011048003.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=516

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ELE IL +  + R  R+  ATW+ELK+L  LAAPA+VVY+
Sbjct  34   SSELEDILCNMELSRSHRILKATWVELKILFPLAAPAIVVYL  75



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 4/62 (6%)
 Frame = +3

Query  108  PLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  284
            P P S    +   H   EA S +LESIL D  +P  QR+  A+ +E++LL  LAAPAV+V
Sbjct  19   PAPGSS---AGSGHSHGEAVSGQLESILSDASLPWRQRMLSASMVEMRLLVRLAAPAVLV  75

Query  285  YM  290
            YM
Sbjct  76   YM  77



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +3

Query  135  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            +   H     S  LESIL D  +P  +R+  AT +E++LL  LAAPAVVVYM
Sbjct  24   TGSGHGVEAVSGRLESILSDESLPWGRRMSAATLVEMRLLVRLAAPAVVVYM  75



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +3

Query  147  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            H   EA S +LESIL DT +P  +R+  A+ +E++LL  LAAPAV+VYM
Sbjct  26   HGHGEAVSGQLESILSDTSLPWGRRMVAASVVEMRLLVRLAAPAVLVYM  74



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 5/62 (8%)
 Frame = +3

Query  105  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  284
            +PL ES+      P    + S+ELE IL DT + R QR + A+ IEL+ L  LAAP+++V
Sbjct  5    EPLLESE-----EPILAEQISSELEEILSDTSLSRIQRFRRASVIELRNLFRLAAPSIIV  59

Query  285  YM  290
            Y+
Sbjct  60   YL  61



>gb|KDP20756.1| hypothetical protein JCGZ_21227 [Jatropha curcas]
Length=999

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  165  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            S+ELE IL +T     QR + AT +ELK L YLAAPA+VVY+
Sbjct  30   SDELEQILCNTQFTYLQRTRKATLVELKTLFYLAAPAIVVYL  71



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +3

Query  147  HE-ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            HE E  AS  LESIL DT  P   R  LA  +EL+LL  LA PAVVVYM
Sbjct  7    HEHEHAASCRLESILTDTSAPLATRAWLAGAVELRLLARLATPAVVVYM  55



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 35/61 (57%), Gaps = 13/61 (21%)
 Frame = +3

Query  108  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  287
            PLPES+             + ELE +L D   P + RL+ AT IE KLL  LAAPAV+VY
Sbjct  20   PLPESN-------------NGELERVLSDLETPLFPRLRKATMIESKLLFKLAAPAVIVY  66

Query  288  M  290
            M
Sbjct  67   M  67



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +3

Query  105  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  284
            +PL ES+  + +    E + S+ELE IL DT +   QR K A+ IEL+ L  LAAPA++V
Sbjct  5    EPLLESESPILASAATE-KISSELEEILSDTSLSCIQRFKRASVIELRNLFRLAAPAIIV  63

Query  285  YM  290
            Y+
Sbjct  64   YL  65



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  174  LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            LESIL +  +P  +RL+LAT +E+KLL  +AAPAV+VYM
Sbjct  14   LESILTNPSVPWVRRLQLATIVEMKLLIRIAAPAVMVYM  52



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  162  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            AS  LESIL DT  P  +R  LA  +EL+LL  LAAPAVVVYM
Sbjct  15   ASCLLESILTDTSAPLARRAWLAGAVELRLLARLAAPAVVVYM  57



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score = 47.0 bits (110),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  156  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            +E ++ LE +L DT +P  +R+ LA+ IELKLL  LA PAV VYM
Sbjct  24   NEVNSRLEKVLNDTELPYLKRILLASAIELKLLFPLAGPAVFVYM  68



>gb|EMT13256.1| hypothetical protein F775_42803 [Aegilops tauschii]
Length=100

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +3

Query  153  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            + +AS  LESIL D+ +P  +R   A  IEL +L  LAAPAVVVYM
Sbjct  5    DGDASGRLESILTDSSVPLARR-AWAAAIELGMLARLAAPAVVVYM  49



>ref|XP_010538707.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Tarenaya hassleriana]
Length=512

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 45/77 (58%), Gaps = 6/77 (8%)
 Frame = +3

Query  66   TNSVMDSSNGAA--YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWI  239
            +N+V  ++  A   + P  E   V   PP  + E    LE++L DT +P  +R+ +  WI
Sbjct  4    SNTVTAAAGDATDLHRPFLEDRTVGKPPPPPDVE----LETVLTDTTVPYVRRVYVGAWI  59

Query  240  ELKLLCYLAAPAVVVYM  290
            E++LL +LA PA++VY+
Sbjct  60   EMRLLFHLAVPAILVYV  76



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  290
            ++S  P    E+S ELE IL DT  P  +RL  A  +E +LL +LA PAV+VYM
Sbjct  25   LLSPSPKTSHESSGELERILTDTTRPFLRRLGPALLMESRLLFHLAGPAVIVYM  78



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570625233910