BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF011L22

Length=273
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         90.1    5e-19   Prunus mume [ume]
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg           88.6    2e-18   Prunus persica
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         86.3    1e-17   Vitis vinifera
emb|CAN83418.1|  hypothetical protein VITISV_041351                   86.3    1e-17   Vitis vinifera
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         85.1    4e-17   Pyrus x bretschneideri [bai li]
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         85.1    4e-17   Malus domestica [apple tree]
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                    84.7    6e-17   Morus notabilis
ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    84.3    8e-17   Nicotiana sylvestris
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         84.0    9e-17   Solanum lycopersicum
ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    84.0    9e-17   Nicotiana tomentosiformis
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         83.6    1e-16   Fragaria vesca subsp. vesca
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    83.6    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                83.2    2e-16   Medicago truncatula
gb|AFK49564.1|  unknown                                               83.2    2e-16   Medicago truncatula
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    82.8    2e-16   Nelumbo nucifera [Indian lotus]
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         82.8    2e-16   Sesamum indicum [beniseed]
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    82.8    3e-16   Solanum tuberosum [potatoes]
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    81.6    6e-16   Cicer arietinum [garbanzo]
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         80.9    1e-15   Eucalyptus grandis [rose gum]
dbj|BAE71216.1|  putative NAD dependent epimerase                     80.9    1e-15   Trifolium pratense [peavine clover]
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    80.9    1e-15   Cucumis sativus [cucumbers]
gb|KDP39331.1|  hypothetical protein JCGZ_01088                       79.7    3e-15   Jatropha curcas
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         78.6    8e-15   Cucumis melo [Oriental melon]
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    78.2    1e-14   Citrus sinensis [apfelsine]
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                 78.2    1e-14   Citrus sinensis [apfelsine]
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg           78.2    1e-14   Citrus clementina [clementine]
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein   78.2    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    77.8    2e-14   Populus euphratica
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    77.4    2e-14   Glycine max [soybeans]
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  76.3    6e-14   Phoenix dactylifera
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g           74.7    2e-13   Phaseolus vulgaris [French bean]
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                         74.7    2e-13   Phaseolus vulgaris [French bean]
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                     74.7    2e-13   Phaseolus vulgaris [French bean]
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g           74.3    3e-13   
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                  73.9    4e-13   Theobroma cacao [chocolate]
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    72.8    9e-13   Solanum tuberosum [potatoes]
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    72.4    1e-12   Elaeis guineensis
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    72.4    1e-12   Populus euphratica
gb|KJB28115.1|  hypothetical protein B456_005G028000                  71.6    2e-12   Gossypium raimondii
ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    71.6    2e-12   Nicotiana sylvestris
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                     71.6    3e-12   Gossypium hirsutum [American cotton]
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    71.2    3e-12   Nicotiana tomentosiformis
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    70.9    5e-12   Elaeis guineensis
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    68.9    2e-11   Phoenix dactylifera
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    65.1    5e-10   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP21869.1|  unnamed protein product                              62.0    5e-09   Coffea canephora [robusta coffee]
gb|KJB72008.1|  hypothetical protein B456_011G153500                  60.8    2e-08   Gossypium raimondii
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                     60.5    2e-08   Gossypium hirsutum [American cotton]
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    55.1    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010421811.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    53.1    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         52.8    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    52.8    8e-06   Camelina sativa [gold-of-pleasure]
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                     52.8    9e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAN60250.1|  unknown                                               52.8    9e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                  52.4    1e-05   Arabis alpina [alpine rockcress]
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg           52.4    1e-05   Capsella rubella
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  52.0    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926           52.0    1e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg           52.0    2e-05   Eutrema salsugineum [saltwater cress]
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         48.9    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    48.5    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006848494.1|  hypothetical protein AMTR_s00013p00257170        48.5    2e-04   Amborella trichopoda
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         48.1    3e-04   Brassica rapa
emb|CDY18087.1|  BnaA01g23480D                                        48.1    3e-04   Brassica napus [oilseed rape]
emb|CDY64583.1|  BnaCnng44170D                                        46.6    9e-04   Brassica napus [oilseed rape]



>ref|XP_008222861.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Prunus mume]
Length=440

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LIFFFTINYPPL+E
Sbjct  1    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLIFFFTINYPPLSE  60

Query  262  SSGG  273
              GG
Sbjct  61   HMGG  64



>ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
 gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
Length=461

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LIFFFTINYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLIFFFTINYPPLSD  60

Query  262  SSGG  273
              GG
Sbjct  61   HMGG  64



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSYIRRVNS+KL+AASSKLLFRATL+VAL+LIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYIRRVNSTKLMAASSKLLFRATLLVALVLIFFFTLNYPPLSD  60

Query  262  S  264
            +
Sbjct  61   N  61



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSYIRRVNS+KL+AASSKLLFRATL+VAL+LIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYIRRVNSTKLMAASSKLLFRATLLVALVLIFFFTLNYPPLSD  60

Query  262  S  264
            +
Sbjct  61   N  61



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LI FFT+NYPPL++
Sbjct  5    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLILFFTLNYPPLSD  64

Query  262  SSGG  273
              GG
Sbjct  65   HVGG  68



>ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica]
Length=465

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LI FFT+NYPPL++
Sbjct  5    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLILFFTLNYPPLSD  64

Query  262  SSGG  273
              GG
Sbjct  65   HVGG  68



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSYIRRVNS+KL+ ASSKLLFRATL++AL+LI FFT+NYPPL+ 
Sbjct  1    MASPPDTSKTMKLERYNSYIRRVNSTKLLNASSKLLFRATLLIALVLILFFTLNYPPLSS  60

Query  262  SS  267
            SS
Sbjct  61   SS  62



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPLA 
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPLAS  60

Query  262  SS  267
             +
Sbjct  61   DN  62



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL  255
            MA PPDTSK +KLERYNSYIRRVNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPL
Sbjct  5    MASPPDTSKTTKLERYNSYIRRVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPL  62



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPLA 
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRITLLVALLLIFFFTINYPPLAS  60

Query  262  SS  267
             +
Sbjct  61   DN  62



>ref|XP_004297013.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Fragaria vesca subsp. 
vesca]
Length=451

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RRVNS+KLI ASSKLLFR TL+VAL+LIFFFT+NYPPL+ 
Sbjct  3    MASPPDTSKTIKLERYNSYLRRVNSTKLINASSKLLFRVTLLVALVLIFFFTLNYPPLSS  62

Query  262  SS  267
            SS
Sbjct  63   SS  64



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSY+RRVNS+K +AASSKLLFR TL+VALILIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYLRRVNSTKFLAASSKLLFRVTLLVALILIFFFTLNYPPLSD  60

Query  262  S  264
            +
Sbjct  61   N  61



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  262  SS  267
            S+
Sbjct  61   ST  62



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  262  SS  267
            S+
Sbjct  61   ST  62



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSY+RRVNS+KL+AASSKLLFR TL+VALILIFFFT+N+PPL+ 
Sbjct  1    MASPPDTSKTTKLERYNSYLRRVNSTKLLAASSKLLFRVTLLVALILIFFFTLNHPPLSS  60

Query  262  SS  267
             S
Sbjct  61   DS  62



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  85   AFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            A PPDTSK +KLERYNSYIRRVNS+KL+ ASSKLLFR TL+VALILIFFFT+NYPPL+ +
Sbjct  10   ASPPDTSKTTKLERYNSYIRRVNSTKLLQASSKLLFRVTLLVALILIFFFTLNYPPLSSA  69



>ref|XP_006360928.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=448

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL  255
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPL
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPL  58



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++ALIL+F FT NYPPL+E
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALILVFLFTFNYPPLSE  60

Query  262  SS  267
            ++
Sbjct  61   TA  62



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPD+SK +KLERYNSYIRRVNS+KL+ ASSKLLFRATL++AL L+ FFT+NYPPL+ 
Sbjct  1    MAPPPDSSKTAKLERYNSYIRRVNSTKLLNASSKLLFRATLLIALALVLFFTLNYPPLSS  60

Query  262  SS  267
            SS
Sbjct  61   SS  62



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 ref|XP_004166629.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+R+VNS+KLI ASSKLLFRATL+VAL+L+F FT+NYPPL+ 
Sbjct  4    MASPPDTSKTLKLERYNSYLRKVNSTKLINASSKLLFRATLLVALVLVFIFTLNYPPLSS  63

Query  262  SSG  270
             +G
Sbjct  64   ENG  66



>gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFTINYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRIHSTKVLNASSKLLFRATLLIALVLILFFTINYPPLSD  60



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLA  258
            MA PPDTSK  KLERYNSY+R+VNS+KL+ ASSKLLFRATL+VAL+L+F FT+NYPPL+
Sbjct  4    MASPPDTSKTLKLERYNSYLRKVNSTKLLNASSKLLFRATLLVALVLVFIFTLNYPPLS  62



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  262  SSG  270
            ++G
Sbjct  61   NTG  63



>gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=469

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  262  SSG  270
            ++G
Sbjct  61   NTG  63



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  262  SSG  270
            ++G
Sbjct  61   NTG  63



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHSTKVLNASSKLLFRATLLIALVLILFFTLNYPPLSD  60

Query  262  S  264
            +
Sbjct  61   N  61



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHSTKVLNASSKLLFRATLLIALVLILFFTLNYPPLSD  60

Query  262  S  264
            +
Sbjct  61   N  61



>ref|XP_003538527.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=462

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  91   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLA  258
            PPDTSK+ KLERYNSYIRR+NS+KL+ ASSKLLFRAT++VALIL+F FT NYPPLA
Sbjct  20   PPDTSKSIKLERYNSYIRRLNSTKLLNASSKLLFRATILVALILVFLFTFNYPPLA  75



>ref|XP_008794651.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Phoenix dactylifera]
Length=468

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL  255
            MA PPDTSK +KLERYNSYIRRVNS+KL+AAS+ LLFRATL+ A++LI  FT++YPPL
Sbjct  1    MAPPPDTSKTTKLERYNSYIRRVNSTKLLAASTNLLFRATLLTAVVLILLFTLHYPPL  58



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  267
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST  58



>gb|AHA84281.1| UDP-glucuronate 4-epimerase 6 [Phaseolus vulgaris]
Length=444

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  267
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST  58



>gb|AGV54436.1| UDP-D-glucuronic acid 4-epimerase [Phaseolus vulgaris]
Length=437

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  267
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST  58



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PP TSK  KLERYNSY+RR++S+K++ ASSKL+FR TL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPHTSKTLKLERYNSYLRRLHSTKVLNASSKLIFRVTLLIALVLILFFTLNYPPLSD  60

Query  262  SS  267
             +
Sbjct  61   KN  62



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            M  PPDTSK  KLERYNSY+R+++S+KL+ ASSKLLFR TL++AL+LI FFTINYPPL++
Sbjct  1    MPTPPDTSKTVKLERYNSYLRKLHSTKLLNASSKLLFRVTLLIALVLILFFTINYPPLSD  60

Query  262  S  264
            +
Sbjct  61   N  61



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  91   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            P DTSK  KLERYNSYIRR+NS+KLI ASSKLLFR TL+VALILIFFF INYPP   S
Sbjct  5    PIDTSKEMKLERYNSYIRRLNSTKLIVASSKLLFRVTLLVALILIFFFIINYPPFTSS  62



>ref|XP_010905148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=463

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL  255
            MA PPD SK +KLERYNSY+RRVNS+KL+AASS +LFRATL+ A++LI  FT++YPPL
Sbjct  1    MAPPPDNSKTTKLERYNSYLRRVNSTKLLAASSNILFRATLLTAVVLILLFTLHYPPL  58



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PP TSK  KLERYN+Y+RR++S+K++ ASSKL+FR TL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPHTSKTLKLERYNNYLRRLHSTKVLNASSKLIFRVTLLIALVLILFFTLNYPPLSD  60

Query  262  SS  267
             +
Sbjct  61   KN  62



>gb|KJB28115.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=409

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  91   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  267
            P DTSK  KLERYNSYIR+V+S+KL+ ASSK LFR TL++AL+LI FFTINYPPL++++
Sbjct  2    PTDTSKPMKLERYNSYIRKVHSTKLLNASSKFLFRVTLLIALVLILFFTINYPPLSDNT  60



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLA  258
            MA   DTSK  KLERYNSYIRRVNSSKLIAASSKLLFR TL+VAL+LIFFFTINY PL+
Sbjct  1    MASSLDTSKVMKLERYNSYIRRVNSSKLIAASSKLLFRVTLLVALLLIFFFTINYHPLS  59



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB28114.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=453

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  91   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  267
            P DTSK  KLERYNSYIR+V+S+KL+ ASSK LFR TL++AL+LI FFTINYPPL++++
Sbjct  2    PTDTSKPMKLERYNSYIRKVHSTKLLNASSKFLFRVTLLIALVLILFFTINYPPLSDNT  60



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL  255
            MA   DTSK  KLERYNSYIRRVNSSKLIAASSKLLFR TL+VAL+LIFFFTINY PL
Sbjct  1    MASSLDTSKVMKLERYNSYIRRVNSSKLIAASSKLLFRVTLLVALLLIFFFTINYHPL  58



>ref|XP_010906178.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=467

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL  255
            MA  PDTSK +KLERYNSY+RRVN++KL+A +S LLFRATL+ A++LI  FT++YPPL
Sbjct  1    MAPLPDTSKTTKLERYNSYLRRVNTTKLLATTSNLLFRATLLTAVVLILLFTLHYPPL  58



>ref|XP_008792930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Phoenix dactylifera]
Length=464

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL  255
            MA   DTSK +KLERYNSY+RRVNS+KL+AAS   LFRATL+ A++LI  FT++YPPL
Sbjct  1    MALLTDTSKTTKLERYNSYLRRVNSTKLLAASWNFLFRATLLTAIVLILLFTLHYPPL  58



>ref|XP_009408344.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL  255
            MA PPDTSK +KLER N+Y+RRVNS+K+I+ASS+LLFRA+++  + LI  FT++YPPL
Sbjct  1    MASPPDTSKTAKLERCNNYLRRVNSAKIISASSRLLFRASILATVALILLFTLHYPPL  58



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  91   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            PPD SK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LI FFT+NYPPL+E+
Sbjct  6    PPDFSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLILFFTLNYPPLSEN  63



>gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii]
Length=454

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            M  PPDTSK  KLERYN+Y+R+++S+KLI ASSKLLFRATL++ALILI FFTINYPPL++
Sbjct  1    MPTPPDTSKTLKLERYNNYLRKIHSTKLITASSKLLFRATLLIALILILFFTINYPPLSD  60

Query  262  S  264
            +
Sbjct  61   T  61



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            M  PPDTSK  KLERYN+Y+R+++S+KLI ASSKLLFRATL++ALILI FFTINYPPL++
Sbjct  1    MPTPPDTSKTLKLERYNNYLRKIHSTKLITASSKLLFRATLLIALILILFFTINYPPLSD  60

Query  262  S  264
            +
Sbjct  61   T  61



>ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYI-RRVNsskliaasskllFRATLMVALILIFFFTINYPPL  255
            MA  PDTSK+ KLER+  Y+ RR+NS+K+IAASS LLFRA+++  ++LI  FT++YPPL
Sbjct  1    MASAPDTSKSFKLERHGGYLLRRINSTKVIAASSHLLFRASILATVVLILLFTLHYPPL  59



>ref|XP_010421811.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=372

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  262  S  264
            S
Sbjct  63   S  63



>ref|XP_010488461.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Camelina sativa]
Length=462

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  262  S  264
            S
Sbjct  63   S  63



>ref|XP_010468437.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=456

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  262  S  264
            S
Sbjct  63   S  63



>ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic 
acid epimerase 6; Short=AtUGlcAE2 [Arabidopsis 
thaliana]
 gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana]
 dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana]
 gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana]
 emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana]
Length=460

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLIFAINYPPLSDS  63



>gb|AAN60250.1| unknown [Arabidopsis thaliana]
Length=460

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            DTSK  KLERYNSY+R+++S+K++ ASSK LFRATL+VAL+L+  F INYPPL++S
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKXLFRATLLVALVLVLIFAINYPPLSDS  63



>gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina]
Length=458

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDS  63



>ref|XP_006297629.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
 gb|EOA30527.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
Length=462

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDS  63



>ref|XP_010527460.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Tarenaya hassleriana]
Length=460

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  267
            DTSK  KLERYNSY+R+++S+K+I ASSKLLFRATL++AL+L+  FT+NYPPL+ S+
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVINASSKLLFRATLLIALVLVLIFTLNYPPLSSST  64



>ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDS  63



>ref|XP_006418833.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
 gb|ESQ37269.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
Length=461

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALLLVLLFAINYPPLSDS  63



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYP  249
            MA   D SK++KLERYNSY+RRVN++KL+AASSKLLFRATL+VAL+L+FFFT+NYP
Sbjct  1    MALSSDLSKSTKLERYNSYLRRVNNTKLLAASSKLLFRATLLVALLLVFFFTLNYP  56



>ref|XP_009412723.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSY-IRRVNsskliaasskllFRATLMVALILIFFFTINYPP  252
            MA PPDTSK+SKLERYNSY +RRV+S+KLIAASS LLFRAT++ ALILIF F ++YPP
Sbjct  2    MASPPDTSKSSKLERYNSYLLRRVSSAKLIAASSHLLFRATILAALILIFLFLLHYPP  59



>ref|XP_006848494.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
 gb|ERN10075.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
Length=446

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 42/46 (91%), Gaps = 1/46 (2%)
 Frame = +1

Query  115  KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTI-NYP  249
            KLERYNSYIR++NSSK +AASSKLLFRA++++AL L+FF T+ +YP
Sbjct  9    KLERYNSYIRKMNSSKALAASSKLLFRASILIALFLVFFLTLTSYP  54



>ref|XP_009106288.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=460

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDS  64



>emb|CDY18087.1| BnaA01g23480D [Brassica napus]
Length=460

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDS  64



>emb|CDY64583.1| BnaCnng44170D [Brassica napus]
Length=460

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            DTSK  KLERYN+Y+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S
Sbjct  9    DTSKTVKLERYNNYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDS  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561713539050