BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF011L06

Length=387
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011075499.1|  PREDICTED: probable methyltransferase PMT2         155   1e-41   Sesamum indicum [beniseed]
ref|XP_011071001.1|  PREDICTED: probable methyltransferase PMT2         154   3e-41   Sesamum indicum [beniseed]
gb|EYU28744.1|  hypothetical protein MIMGU_mgv1a003087mg                150   8e-40   Erythranthe guttata [common monkey flower]
emb|CDP00327.1|  unnamed protein product                                144   8e-38   Coffea canephora [robusta coffee]
gb|EYU22422.1|  hypothetical protein MIMGU_mgv1a003056mg                142   5e-37   Erythranthe guttata [common monkey flower]
gb|EYU22421.1|  hypothetical protein MIMGU_mgv1a003056mg                142   6e-37   Erythranthe guttata [common monkey flower]
ref|XP_008221626.1|  PREDICTED: probable methyltransferase PMT2         140   4e-36   Prunus mume [ume]
ref|XP_007222021.1|  hypothetical protein PRUPE_ppa002971mg             139   6e-36   Prunus persica
ref|XP_007046111.1|  S-adenosyl-L-methionine-dependent methyltran...    139   7e-36   
ref|XP_009761475.1|  PREDICTED: probable methyltransferase PMT2         137   3e-35   Nicotiana sylvestris
ref|XP_009793104.1|  PREDICTED: probable methyltransferase PMT2         137   4e-35   Nicotiana sylvestris
ref|XP_009626042.1|  PREDICTED: probable methyltransferase PMT2         137   4e-35   Nicotiana tomentosiformis
ref|XP_009624681.1|  PREDICTED: probable methyltransferase PMT2         137   4e-35   Nicotiana tomentosiformis
ref|XP_006438677.1|  hypothetical protein CICLE_v10030989mg             137   5e-35   Citrus clementina [clementine]
gb|KJB80180.1|  hypothetical protein B456_013G084900                    136   8e-35   Gossypium raimondii
ref|XP_010527898.1|  PREDICTED: probable methyltransferase PMT2         135   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_006366703.1|  PREDICTED: probable methyltransferase PMT2-l...    134   5e-34   Solanum tuberosum [potatoes]
gb|AFK36214.1|  unknown                                                 125   5e-34   Lotus japonicus
ref|XP_002273644.1|  PREDICTED: probable methyltransferase PMT2         134   8e-34   Vitis vinifera
gb|KJB60758.1|  hypothetical protein B456_009G324300                    132   8e-34   Gossypium raimondii
ref|XP_002522425.1|  ATP binding protein, putative                      133   1e-33   
ref|XP_008389474.1|  PREDICTED: probable methyltransferase PMT2         133   1e-33   Malus domestica [apple tree]
gb|KDP41191.1|  hypothetical protein JCGZ_15598                         133   1e-33   Jatropha curcas
ref|XP_010089758.1|  putative methyltransferase PMT2                    133   1e-33   Morus notabilis
gb|KHG10506.1|  hypothetical protein F383_11349                         132   2e-33   Gossypium arboreum [tree cotton]
gb|KHG23981.1|  hypothetical protein F383_09020                         132   2e-33   Gossypium arboreum [tree cotton]
gb|KJB60755.1|  hypothetical protein B456_009G324300                    131   2e-33   Gossypium raimondii
gb|KJB60756.1|  hypothetical protein B456_009G324300                    131   3e-33   Gossypium raimondii
ref|XP_009360348.1|  PREDICTED: probable methyltransferase PMT2         132   3e-33   Pyrus x bretschneideri [bai li]
gb|KJB60757.1|  hypothetical protein B456_009G324300                    132   4e-33   Gossypium raimondii
gb|EPS59468.1|  hypothetical protein M569_15338                         131   5e-33   Genlisea aurea
ref|XP_010258374.1|  PREDICTED: probable methyltransferase PMT2         131   5e-33   Nelumbo nucifera [Indian lotus]
gb|ABO92980.1|  putative methyltransferase                              130   9e-33   Solanum tuberosum [potatoes]
gb|AAT38756.2|  Putative methyltransferase family protein               132   1e-32   Solanum demissum
gb|AAT38682.2|  Methyltransferase family protein, putative              130   2e-32   Solanum demissum
ref|XP_004238796.1|  PREDICTED: probable methyltransferase PMT2         129   2e-32   Solanum lycopersicum
ref|XP_004228376.1|  PREDICTED: probable methyltransferase PMT2         129   2e-32   Solanum lycopersicum
ref|XP_007153607.1|  hypothetical protein PHAVU_003G049900g             129   3e-32   Phaseolus vulgaris [French bean]
ref|NP_001280936.1|  uncharacterized protein LOC103402903               129   3e-32   Malus domestica [apple tree]
ref|XP_006439600.1|  hypothetical protein CICLE_v10019341mg             129   4e-32   Citrus clementina [clementine]
ref|XP_007157631.1|  hypothetical protein PHAVU_002G085900g             129   4e-32   Phaseolus vulgaris [French bean]
ref|XP_006476610.1|  PREDICTED: probable methyltransferase PMT2-l...    129   4e-32   Citrus sinensis [apfelsine]
ref|XP_006602298.1|  PREDICTED: probable methyltransferase PMT2-like    128   5e-32   Glycine max [soybeans]
gb|KHN17371.1|  Putative methyltransferase PMT2                         128   6e-32   Glycine soja [wild soybean]
ref|XP_006439601.1|  hypothetical protein CICLE_v10019341mg             128   6e-32   
ref|XP_004297305.1|  PREDICTED: probable methyltransferase PMT2         128   7e-32   Fragaria vesca subsp. vesca
ref|XP_006366112.1|  PREDICTED: probable methyltransferase PMT2-l...    128   7e-32   Solanum tuberosum [potatoes]
gb|AAU90305.2|  Methyltransferase, putative                             129   9e-32   Solanum tuberosum [potatoes]
ref|XP_006586024.1|  PREDICTED: probable methyltransferase PMT2-l...    127   1e-31   
ref|XP_003532062.1|  PREDICTED: probable methyltransferase PMT2-l...    127   1e-31   Glycine max [soybeans]
gb|KDO76124.1|  hypothetical protein CISIN_1g0367251mg                  124   2e-31   Citrus sinensis [apfelsine]
ref|XP_006415973.1|  hypothetical protein EUTSA_v10007096mg             126   3e-31   Eutrema salsugineum [saltwater cress]
ref|XP_008339908.1|  PREDICTED: probable methyltransferase PMT2         126   3e-31   
ref|XP_011015217.1|  PREDICTED: probable methyltransferase PMT2         126   5e-31   Populus euphratica
ref|XP_011021619.1|  PREDICTED: probable methyltransferase PMT2         126   5e-31   Populus euphratica
ref|XP_010552579.1|  PREDICTED: probable methyltransferase PMT2         125   8e-31   Tarenaya hassleriana [spider flower]
ref|XP_010257294.1|  PREDICTED: probable methyltransferase PMT2         125   8e-31   Nelumbo nucifera [Indian lotus]
gb|AAT39937.2|  Putative methyltransferase family protein               126   1e-30   Solanum demissum
ref|XP_010460256.1|  PREDICTED: probable methyltransferase PMT2         125   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010498988.1|  PREDICTED: probable methyltransferase PMT2         125   1e-30   Camelina sativa [gold-of-pleasure]
emb|CDY16198.1|  BnaA09g29320D                                          124   1e-30   Brassica napus [oilseed rape]
gb|AAD14491.1|  Unknown protein                                         124   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303579.1|  hypothetical protein CARUB_v10011097mg             124   2e-30   Capsella rubella
ref|XP_010532828.1|  PREDICTED: probable methyltransferase PMT2         124   2e-30   Tarenaya hassleriana [spider flower]
ref|NP_849711.1|  putative methyltransferase PMT2                       123   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315803.2|  hypothetical protein POPTR_0010s10420g             124   2e-30   Populus trichocarpa [western balsam poplar]
ref|NP_564265.1|  putative methyltransferase PMT2                       124   2e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19504.1|  AT1G26850                                              124   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893375.1|  dehydration-responsive family protein              124   2e-30   
ref|XP_009115418.1|  PREDICTED: probable methyltransferase PMT2         124   2e-30   Brassica rapa
ref|XP_004138921.1|  PREDICTED: probable methyltransferase PMT2-like    124   3e-30   Cucumis sativus [cucumbers]
ref|XP_008239959.1|  PREDICTED: probable methyltransferase PMT2         124   4e-30   Prunus mume [ume]
ref|XP_003518725.1|  PREDICTED: probable methyltransferase PMT2-like    123   5e-30   Glycine max [soybeans]
ref|XP_004159999.1|  PREDICTED: probable methyltransferase PMT2-like    120   7e-30   
ref|XP_003517972.1|  PREDICTED: probable methyltransferase PMT2-like    122   8e-30   Glycine max [soybeans]
ref|XP_003628357.1|  hypothetical protein MTR_8g055840                  122   8e-30   Medicago truncatula
ref|XP_009103114.1|  PREDICTED: probable methyltransferase PMT2         122   8e-30   Brassica rapa
ref|XP_008441700.1|  PREDICTED: probable methyltransferase PMT2         122   8e-30   Cucumis melo [Oriental melon]
gb|ACJ85858.1|  unknown                                                 122   9e-30   Medicago truncatula
ref|XP_007210881.1|  hypothetical protein PRUPE_ppa003018mg             122   1e-29   Prunus persica
ref|XP_004490044.1|  PREDICTED: probable methyltransferase PMT2-l...    121   2e-29   Cicer arietinum [garbanzo]
ref|XP_004511207.1|  PREDICTED: probable methyltransferase PMT2-l...    121   3e-29   Cicer arietinum [garbanzo]
ref|XP_009591906.1|  PREDICTED: probable methyltransferase PMT2         119   1e-28   Nicotiana tomentosiformis
emb|CDY40268.1|  BnaA07g09320D                                          119   1e-28   Brassica napus [oilseed rape]
ref|XP_002311593.1|  hypothetical protein POPTR_0008s14720g             119   2e-28   Populus trichocarpa [western balsam poplar]
emb|CAN60192.1|  hypothetical protein VITISV_038569                     119   2e-28   Vitis vinifera
ref|XP_002275852.1|  PREDICTED: probable methyltransferase PMT2         119   2e-28   Vitis vinifera
ref|XP_010275323.1|  PREDICTED: probable methyltransferase PMT14        119   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_011027055.1|  PREDICTED: probable methyltransferase PMT2         119   2e-28   Populus euphratica
ref|XP_011025778.1|  PREDICTED: probable methyltransferase PMT2         119   2e-28   Populus euphratica
ref|XP_009782774.1|  PREDICTED: probable methyltransferase PMT2         118   3e-28   Nicotiana sylvestris
ref|XP_004299370.1|  PREDICTED: probable methyltransferase PMT2         118   4e-28   Fragaria vesca subsp. vesca
ref|XP_010683197.1|  PREDICTED: probable methyltransferase PMT2         117   6e-28   
ref|XP_006660624.1|  PREDICTED: probable methyltransferase PMT2-like    116   1e-27   Oryza brachyantha
gb|EPS60507.1|  hypothetical protein M569_14296                         116   2e-27   Genlisea aurea
ref|XP_010937120.1|  PREDICTED: probable methyltransferase PMT2 i...    116   2e-27   
ref|XP_010937119.1|  PREDICTED: probable methyltransferase PMT2 i...    116   2e-27   Elaeis guineensis
ref|XP_007037318.1|  S-adenosyl-L-methionine-dependent methyltran...    116   2e-27   
ref|XP_009772034.1|  PREDICTED: probable methyltransferase PMT2         115   3e-27   Nicotiana sylvestris
ref|XP_003613748.1|  hypothetical protein MTR_5g040360                  115   3e-27   Medicago truncatula
ref|XP_008356626.1|  PREDICTED: probable methyltransferase PMT2         115   4e-27   
ref|XP_009595709.1|  PREDICTED: probable methyltransferase PMT2         115   5e-27   Nicotiana tomentosiformis
ref|XP_002282093.2|  PREDICTED: probable methyltransferase PMT14        114   9e-27   Vitis vinifera
ref|XP_009369302.1|  PREDICTED: probable methyltransferase PMT2         114   9e-27   Pyrus x bretschneideri [bai li]
ref|XP_010551537.1|  PREDICTED: probable methyltransferase PMT2 i...    114   9e-27   Tarenaya hassleriana [spider flower]
ref|XP_006354784.1|  PREDICTED: probable methyltransferase PMT2-like    114   1e-26   Solanum tuberosum [potatoes]
ref|XP_010551538.1|  PREDICTED: probable methyltransferase PMT2 i...    113   1e-26   Tarenaya hassleriana [spider flower]
ref|XP_004956815.1|  PREDICTED: probable methyltransferase PMT2-l...    113   2e-26   Setaria italica
ref|XP_010919849.1|  PREDICTED: probable methyltransferase PMT2         112   3e-26   
ref|XP_009390921.1|  PREDICTED: probable methyltransferase PMT2         112   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY45006.1|  BnaCnng12360D                                          112   3e-26   Brassica napus [oilseed rape]
emb|CDY46435.1|  BnaA08g19950D                                          112   4e-26   Brassica napus [oilseed rape]
ref|XP_009380165.1|  PREDICTED: probable methyltransferase PMT2         112   5e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003578117.1|  PREDICTED: probable methyltransferase PMT2         111   1e-25   Brachypodium distachyon [annual false brome]
ref|XP_002511570.1|  ATP binding protein, putative                      111   1e-25   Ricinus communis
ref|XP_008651354.1|  PREDICTED: uncharacterized protein LOC100279...    111   1e-25   
ref|NP_001152470.1|  ankyrin protein kinase-like                        111   1e-25   
ref|XP_006827213.1|  hypothetical protein AMTR_s00010p00259630          111   1e-25   
gb|EMS49438.1|  putative methyltransferase PMT2                         111   1e-25   Triticum urartu
ref|XP_009110047.1|  PREDICTED: probable methyltransferase PMT2         109   4e-25   Brassica rapa
ref|XP_002460211.1|  hypothetical protein SORBIDRAFT_02g024670          109   4e-25   Sorghum bicolor [broomcorn]
ref|NP_001146334.1|  uncharacterized protein LOC100279910               107   4e-25   
ref|XP_007039581.1|  S-adenosyl-L-methionine-dependent methyltran...    109   4e-25   
gb|EMT27426.1|  hypothetical protein F775_29617                         109   5e-25   
ref|XP_008784684.1|  PREDICTED: probable methyltransferase PMT2         108   9e-25   Phoenix dactylifera
ref|XP_006364604.1|  PREDICTED: probable methyltransferase PMT2-like    108   9e-25   Solanum tuberosum [potatoes]
ref|XP_004241578.1|  PREDICTED: probable methyltransferase PMT2         108   1e-24   Solanum lycopersicum
gb|EAZ09099.1|  hypothetical protein OsI_31366                          108   2e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001063174.1|  Os09g0415700                                       107   2e-24   
ref|XP_010066916.1|  PREDICTED: probable methyltransferase PMT2         107   2e-24   Eucalyptus grandis [rose gum]
ref|XP_009413462.1|  PREDICTED: probable methyltransferase PMT2         107   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004235979.1|  PREDICTED: probable methyltransferase PMT2         106   9e-24   Solanum lycopersicum
ref|XP_008781841.1|  PREDICTED: probable methyltransferase PMT2         105   1e-23   Phoenix dactylifera
ref|XP_010668105.1|  PREDICTED: probable methyltransferase PMT2         105   2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008393149.1|  PREDICTED: probable methyltransferase PMT2         104   3e-23   
gb|KDP31241.1|  hypothetical protein JCGZ_11617                         104   3e-23   Jatropha curcas
ref|XP_009371899.1|  PREDICTED: probable methyltransferase PMT14 ...    103   4e-23   Pyrus x bretschneideri [bai li]
ref|XP_009371893.1|  PREDICTED: probable methyltransferase PMT14 ...    103   4e-23   
gb|EPS64080.1|  hypothetical protein M569_10695                         103   7e-23   Genlisea aurea
gb|KHN21848.1|  Putative methyltransferase PMT2                         103   7e-23   Glycine soja [wild soybean]
ref|XP_003523024.1|  PREDICTED: probable methyltransferase PMT2-l...    103   8e-23   Glycine max [soybeans]
ref|XP_008351840.1|  PREDICTED: probable methyltransferase PMT2       99.8    8e-23   
ref|XP_010091504.1|  putative methyltransferase PMT2                    103   1e-22   Morus notabilis
emb|CDP12320.1|  unnamed protein product                                103   1e-22   Coffea canephora [robusta coffee]
gb|KJB08229.1|  hypothetical protein B456_001G071800                    102   1e-22   Gossypium raimondii
gb|KJB08228.1|  hypothetical protein B456_001G071800                    102   1e-22   Gossypium raimondii
ref|NP_001065447.2|  Os10g0569300                                       102   2e-22   
ref|XP_004499421.1|  PREDICTED: probable methyltransferase PMT2-l...    102   2e-22   Cicer arietinum [garbanzo]
gb|KJB51712.1|  hypothetical protein B456_008G228900                    101   2e-22   Gossypium raimondii
ref|XP_002528760.1|  ATP binding protein, putative                      102   2e-22   Ricinus communis
ref|XP_006662085.1|  PREDICTED: probable methyltransferase PMT2-like    101   3e-22   Oryza brachyantha
gb|KJB51709.1|  hypothetical protein B456_008G228900                    101   3e-22   Gossypium raimondii
gb|KHG27439.1|  hypothetical protein F383_15139                         101   3e-22   Gossypium arboreum [tree cotton]
ref|XP_008373611.1|  PREDICTED: probable methyltransferase PMT14      99.8    3e-22   
gb|KHN12213.1|  Putative methyltransferase PMT2                         101   4e-22   Glycine soja [wild soybean]
ref|XP_008229546.1|  PREDICTED: probable methyltransferase PMT14        100   5e-22   Prunus mume [ume]
ref|XP_006385609.1|  hypothetical protein POPTR_0003s08590g             100   6e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011032031.1|  PREDICTED: probable methyltransferase PMT14        100   7e-22   Populus euphratica
ref|XP_004986789.1|  PREDICTED: probable methyltransferase PMT2-like    100   8e-22   
emb|CAH18000.1|  Ankyrin protein kinase-like                            100   1e-21   Poa pratensis
ref|XP_010917038.1|  PREDICTED: probable methyltransferase PMT2         100   1e-21   Elaeis guineensis
emb|CDP12957.1|  unnamed protein product                                100   1e-21   Coffea canephora [robusta coffee]
gb|KEH33485.1|  methyltransferase PMT2-like protein                     100   1e-21   Medicago truncatula
ref|XP_007138189.1|  hypothetical protein PHAVU_009G187900g             100   1e-21   Phaseolus vulgaris [French bean]
ref|XP_008362975.1|  PREDICTED: probable methyltransferase PMT14      99.0    2e-21   
ref|XP_002317981.2|  hypothetical protein POPTR_0012s07080g           98.6    5e-21   
ref|XP_010110495.1|  putative methyltransferase PMT14                 98.2    5e-21   Morus notabilis
ref|XP_008229550.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  97.8    6e-21   
ref|XP_010559283.1|  PREDICTED: probable methyltransferase PMT14      97.4    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_007155749.1|  hypothetical protein PHAVU_003G228500g           97.4    1e-20   Phaseolus vulgaris [French bean]
gb|KHN30834.1|  Putative methyltransferase PMT2                       96.7    1e-20   Glycine soja [wild soybean]
gb|KCW77891.1|  hypothetical protein EUGRSUZ_D02155                   97.1    1e-20   Eucalyptus grandis [rose gum]
ref|XP_010053567.1|  PREDICTED: probable methyltransferase PMT14      97.1    2e-20   Eucalyptus grandis [rose gum]
gb|ACB54686.1|  methyltransferase                                     96.7    2e-20   Nicotiana benthamiana
ref|XP_003524439.1|  PREDICTED: probable methyltransferase PMT14-...  96.3    3e-20   Glycine max [soybeans]
ref|XP_007210880.1|  hypothetical protein PRUPE_ppa003016mg           96.3    3e-20   Prunus persica
ref|XP_003574364.1|  PREDICTED: probable methyltransferase PMT2       96.3    3e-20   Brachypodium distachyon [annual false brome]
ref|XP_009793368.1|  PREDICTED: probable methyltransferase PMT14      95.9    4e-20   Nicotiana sylvestris
ref|XP_009587333.1|  PREDICTED: probable methyltransferase PMT14      95.9    4e-20   Nicotiana tomentosiformis
ref|XP_004508998.1|  PREDICTED: probable methyltransferase PMT14-...  95.9    4e-20   Cicer arietinum [garbanzo]
ref|XP_010434585.1|  PREDICTED: probable methyltransferase PMT14      95.9    4e-20   
ref|XP_006368452.1|  hypothetical protein POPTR_0001s02930g           95.9    4e-20   
ref|XP_010029626.1|  PREDICTED: probable methyltransferase PMT2 i...  95.5    4e-20   Eucalyptus grandis [rose gum]
ref|XP_010439911.1|  PREDICTED: probable methyltransferase PMT14      95.9    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009393700.1|  PREDICTED: probable methyltransferase PMT2 i...  95.9    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393699.1|  PREDICTED: probable methyltransferase PMT2 i...  95.9    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010449513.1|  PREDICTED: probable methyltransferase PMT14      95.9    4e-20   
dbj|BAH19630.1|  AT4G18030                                            95.9    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193537.2|  putative methyltransferase PMT14                    95.9    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868016.1|  dehydration-responsive family protein            95.9    4e-20   
emb|CAA17146.1|  putative protein                                     95.9    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283339.1|  hypothetical protein CARUB_v10004377mg           95.5    5e-20   
ref|XP_010029610.1|  PREDICTED: probable methyltransferase PMT2 i...  95.5    5e-20   Eucalyptus grandis [rose gum]
ref|XP_008658538.1|  PREDICTED: probable methyltransferase PMT2       95.5    5e-20   Zea mays [maize]
ref|XP_008448741.1|  PREDICTED: probable methyltransferase PMT14      94.7    8e-20   Cucumis melo [Oriental melon]
ref|XP_004150171.1|  PREDICTED: probable methyltransferase PMT14-...  94.7    9e-20   Cucumis sativus [cucumbers]
gb|KDP22915.1|  hypothetical protein JCGZ_01776                       94.7    1e-19   Jatropha curcas
gb|EYU33038.1|  hypothetical protein MIMGU_mgv1a004747mg              94.0    1e-19   Erythranthe guttata [common monkey flower]
ref|NP_001050233.1|  Os03g0379100                                     94.4    1e-19   
dbj|BAJ85549.1|  predicted protein                                    94.4    1e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011018634.1|  PREDICTED: probable methyltransferase PMT14 ...  92.8    3e-19   Populus euphratica
gb|ACA66248.1|  putative methyltransferase                            93.2    3e-19   Nicotiana benthamiana
ref|XP_006414159.1|  hypothetical protein EUTSA_v10024685mg           93.2    3e-19   Eutrema salsugineum [saltwater cress]
ref|XP_011013091.1|  PREDICTED: probable methyltransferase PMT2       92.8    4e-19   Populus euphratica
ref|XP_011018632.1|  PREDICTED: probable methyltransferase PMT14 ...  92.8    4e-19   Populus euphratica
gb|ACU17089.1|  unknown                                               89.4    5e-19   Glycine max [soybeans]
ref|XP_004300275.1|  PREDICTED: probable methyltransferase PMT14      92.4    7e-19   Fragaria vesca subsp. vesca
ref|XP_006600888.1|  PREDICTED: probable methyltransferase PMT14 ...  91.7    1e-18   Glycine max [soybeans]
ref|XP_006650137.1|  PREDICTED: probable methyltransferase PMT2-like  90.9    2e-18   Oryza brachyantha
ref|XP_010529126.1|  PREDICTED: probable methyltransferase PMT14      90.9    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_009131372.1|  PREDICTED: probable methyltransferase PMT14      90.5    3e-18   Brassica rapa
emb|CDX78823.1|  BnaA01g08900D                                        90.5    3e-18   
gb|KDO43765.1|  hypothetical protein CISIN_1g038698mg                 88.2    3e-18   Citrus sinensis [apfelsine]
ref|XP_006358580.1|  PREDICTED: probable methyltransferase PMT14-...  90.1    4e-18   Solanum tuberosum [potatoes]
ref|XP_006436790.1|  hypothetical protein CICLE_v10030990mg           90.1    4e-18   Citrus clementina [clementine]
ref|XP_004245869.1|  PREDICTED: probable methyltransferase PMT14      90.1    5e-18   Solanum lycopersicum
ref|XP_010695192.1|  PREDICTED: probable methyltransferase PMT14      89.0    1e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|EAY79581.1|  hypothetical protein OsI_34717                        88.6    1e-17   Oryza sativa Indica Group [Indian rice]
gb|EAZ17038.1|  hypothetical protein OsJ_32528                        88.6    1e-17   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA42264.1|  TPA: methyltransferase isoform 1                     86.3    1e-16   
ref|XP_008668148.1|  PREDICTED: methyltransferase isoform X1          86.3    1e-16   
gb|EMT05545.1|  hypothetical protein F775_20122                       85.9    1e-16   
gb|EEC68449.1|  hypothetical protein OsI_36659                        85.5    1e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001068227.1|  Os11g0601600                                     85.5    2e-16   
gb|EYU35839.1|  hypothetical protein MIMGU_mgv1a0064512mg             84.0    2e-16   Erythranthe guttata [common monkey flower]
gb|EEE52366.1|  hypothetical protein OsJ_34430                        84.7    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003557818.1|  PREDICTED: probable methyltransferase PMT2       83.2    1e-15   Brachypodium distachyon [annual false brome]
gb|KEH31563.1|  methyltransferase PMT14-like protein, putative        83.2    2e-15   Medicago truncatula
ref|NP_001152056.1|  methyltransferase                                81.6    3e-15   Zea mays [maize]
gb|EAY81488.1|  hypothetical protein OsI_36661                        81.6    4e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_006280182.1|  hypothetical protein CARUB_v10026086mg           80.9    8e-15   
ref|XP_002449806.1|  hypothetical protein SORBIDRAFT_05g023610        80.5    1e-14   
ref|XP_004984213.1|  PREDICTED: probable methyltransferase PMT2-l...  79.3    2e-14   Setaria italica
ref|XP_004984212.1|  PREDICTED: probable methyltransferase PMT2-l...  79.3    2e-14   
ref|XP_008659999.1|  PREDICTED: probable methyltransferase PMT2 i...  78.2    6e-14   
gb|AFW87980.1|  hypothetical protein ZEAMMB73_653302                  77.8    7e-14   
ref|XP_008656343.1|  PREDICTED: probable methyltransferase PMT2       77.8    9e-14   
ref|XP_010481446.1|  PREDICTED: probable methyltransferase PMT14      77.4    9e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004979626.1|  PREDICTED: probable methyltransferase PMT2-like  76.3    2e-13   Setaria italica
ref|XP_002467784.1|  hypothetical protein SORBIDRAFT_01g034010        75.1    7e-13   Sorghum bicolor [broomcorn]
ref|XP_010494834.1|  PREDICTED: probable methyltransferase PMT14      74.3    1e-12   
emb|CDY35169.1|  BnaA09g18060D                                        73.6    2e-12   Brassica napus [oilseed rape]
emb|CDY03207.1|  BnaC09g19490D                                        73.2    3e-12   
ref|XP_009114343.1|  PREDICTED: probable methyltransferase PMT14      73.2    3e-12   Brassica rapa
gb|KHN29896.1|  Putative methyltransferase PMT2                       69.7    1e-11   Glycine soja [wild soybean]
gb|EMS59423.1|  putative methyltransferase PMT2                       65.1    2e-09   Triticum urartu
gb|AAL86466.1|AC077693_5  hypothetical protein                        63.2    8e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EMT22020.1|  hypothetical protein F775_42781                       59.3    1e-07   



>ref|XP_011075499.1| PREDICTED: probable methyltransferase PMT2 [Sesamum indicum]
Length=613

 Score =   155 bits (392),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MANK  SGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALE+TK+  DCNILP
Sbjct  1    MANKYNSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEMTKSGADCNILP  60

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFETHH+G AG ID+S+SKV
Sbjct  61   NLNFETHHAGEAGIIDDSDSKV  82



>ref|XP_011071001.1| PREDICTED: probable methyltransferase PMT2 [Sesamum indicum]
Length=612

 Score =   154 bits (389),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MANK  SGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALE+TK+  +CNILP
Sbjct  1    MANKFNSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEMTKSGANCNILP  60

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFETHHSG AG ID+S+SKV
Sbjct  61   NLNFETHHSGEAGIIDDSDSKV  82



>gb|EYU28744.1| hypothetical protein MIMGU_mgv1a003087mg [Erythranthe guttata]
 gb|EYU28745.1| hypothetical protein MIMGU_mgv1a003087mg [Erythranthe guttata]
Length=609

 Score =   150 bits (378),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MANK  SGD+RTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALE+TK+ ++CNILP
Sbjct  1    MANKFNSGDNRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEMTKSGENCNILP  60

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFETHH G AG ID+ +SKV
Sbjct  61   NLNFETHHGGEAGIIDDPDSKV  82



>emb|CDP00327.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   144 bits (364),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MANK+ +GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTK    CN++P
Sbjct  1    MANKLNAGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKNGAACNVIP  60

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFETHH G AG I++S+S V
Sbjct  61   NLNFETHHGGGAGMIEDSDSNV  82



>gb|EYU22422.1| hypothetical protein MIMGU_mgv1a003056mg [Erythranthe guttata]
Length=517

 Score =   142 bits (357),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MANK  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIALE+TKTS +CNILP
Sbjct  1    MANKFNSGDNRTRNSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIALEITKTSTNCNILP  60

Query  322  SLNFETHHSGRAGSIDESES  381
            +LNFETHH   AG   +S+S
Sbjct  61   NLNFETHHGNEAGIFSDSDS  80



>gb|EYU22421.1| hypothetical protein MIMGU_mgv1a003056mg [Erythranthe guttata]
Length=611

 Score =   142 bits (358),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MANK  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIALE+TKTS +CNILP
Sbjct  1    MANKFNSGDNRTRNSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIALEITKTSTNCNILP  60

Query  322  SLNFETHHSGRAGSIDESES  381
            +LNFETHH   AG   +S+S
Sbjct  61   NLNFETHHGNEAGIFSDSDS  80



>ref|XP_008221626.1| PREDICTED: probable methyltransferase PMT2 [Prunus mume]
 ref|XP_008221627.1| PREDICTED: probable methyltransferase PMT2 [Prunus mume]
Length=616

 Score =   140 bits (352),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  157  TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFE  336
            T+ D RTRSSV IFIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+PSL+FE
Sbjct  5    TNADGRTRSSVQIFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKNGADCNIIPSLSFE  64

Query  337  THHSGRAGSIDESESK  384
            +HH+G AG IDESESK
Sbjct  65   SHHAGEAGKIDESESK  80



>ref|XP_007222021.1| hypothetical protein PRUPE_ppa002971mg [Prunus persica]
 gb|EMJ23220.1| hypothetical protein PRUPE_ppa002971mg [Prunus persica]
Length=616

 Score =   139 bits (351),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  157  TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFE  336
            T+ D RTRSSV IFIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+PSL+FE
Sbjct  5    TNSDGRTRSSVQIFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKNGADCNIIPSLSFE  64

Query  337  THHSGRAGSIDESESK  384
            +HH+G AG IDESESK
Sbjct  65   SHHAGEAGKIDESESK  80



>ref|XP_007046111.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY01943.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=616

 Score =   139 bits (350),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  S D RTRSS+ IF+V GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNILP
Sbjct  1    MALKPNSADGRTRSSIQIFVVVGLCCFFYILGAWQRSGFGKGDSIALEITKHGADCNILP  60

Query  322  SLNFETHHSGRAGSIDESE  378
            SLNFETHH+G  G++DESE
Sbjct  61   SLNFETHHAGEVGNVDESE  79



>ref|XP_009761475.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=611

 Score =   137 bits (345),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 65/83 (78%), Positives = 75/83 (90%), Gaps = 2/83 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  318
            MANK  +GD+RTR+SVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIAL VTKT+ ++C+IL
Sbjct  1    MANK-NAGDNRTRTSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALAVTKTAGENCDIL  59

Query  319  PSLNFETHHSGRAGSIDESESKV  387
            P+LNFET H+G AG  DESES+V
Sbjct  60   PNLNFETRHAGEAGGTDESESEV  82



>ref|XP_009793104.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=613

 Score =   137 bits (345),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 65/83 (78%), Positives = 76/83 (92%), Gaps = 2/83 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  318
            MANK +SGD+RTR+SVSIFIV GLCCFFYLLGAWQRSGFGKGDSIAL VTKT+ ++CNIL
Sbjct  1    MANK-SSGDNRTRTSVSIFIVTGLCCFFYLLGAWQRSGFGKGDSIALAVTKTAGENCNIL  59

Query  319  PSLNFETHHSGRAGSIDESESKV  387
            P+LNFET H G+AGSID+S ++V
Sbjct  60   PNLNFETRHGGQAGSIDDSGTEV  82



>ref|XP_009626042.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=613

 Score =   137 bits (345),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 65/83 (78%), Positives = 76/83 (92%), Gaps = 2/83 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  318
            MANK +SGD+RTR+SVSIFIV GLCCFFYLLGAWQRSGFGKGDSIAL VTKT+ ++CNIL
Sbjct  1    MANK-SSGDNRTRTSVSIFIVTGLCCFFYLLGAWQRSGFGKGDSIALAVTKTAGENCNIL  59

Query  319  PSLNFETHHSGRAGSIDESESKV  387
            P+LNFET H G+AGSID+S ++V
Sbjct  60   PNLNFETRHGGQAGSIDDSGTEV  82



>ref|XP_009624681.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=611

 Score =   137 bits (344),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 65/83 (78%), Positives = 75/83 (90%), Gaps = 2/83 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  318
            MANK  +GD+RTR+SVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIAL VTKT+ ++C+IL
Sbjct  1    MANK-NAGDNRTRTSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALAVTKTAGENCDIL  59

Query  319  PSLNFETHHSGRAGSIDESESKV  387
            P+LNFET H+G AG  DESES+V
Sbjct  60   PNLNFETRHAGEAGGTDESESEV  82



>ref|XP_006438677.1| hypothetical protein CICLE_v10030989mg [Citrus clementina]
 ref|XP_006483161.1| PREDICTED: probable methyltransferase PMT2-like [Citrus sinensis]
 gb|ESR51917.1| hypothetical protein CICLE_v10030989mg [Citrus clementina]
Length=610

 Score =   137 bits (344),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 61/81 (75%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  S D RTRSS+ IFIV GLCCFFY+LGAWQRSGFGKGDSIALE++K+  DCNI+P
Sbjct  1    MALKSNSSDGRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEISKSGADCNIVP  60

Query  322  SLNFETHHSGRAGSIDESESK  384
            SLNFETHH G   SI+ESESK
Sbjct  61   SLNFETHHGGEVESINESESK  81



>gb|KJB80180.1| hypothetical protein B456_013G084900 [Gossypium raimondii]
 gb|KJB80181.1| hypothetical protein B456_013G084900 [Gossypium raimondii]
Length=616

 Score =   136 bits (343),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  S D+RTRSS+ IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK S DC+I+P
Sbjct  1    MALKPNSTDTRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEMTKHSADCSIVP  60

Query  322  SLNFETHHSGRAGSIDESE  378
            +LNFETHH+G  G++DESE
Sbjct  61   TLNFETHHAGEVGNVDESE  79



>ref|XP_010527898.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   135 bits (339),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  S D+RTRSS+ IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK S DCNI+P
Sbjct  1    MALKSASADNRTRSSMQIFIVFGLCCFFYILGAWQRSGFGKGDSIALEITKNSADCNIIP  60

Query  322  SLNFETHHSGRAGSIDESE  378
            SLNFETHH G   S DES+
Sbjct  61   SLNFETHHGGEVSSTDESK  79



>ref|XP_006366703.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366704.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006366705.1| PREDICTED: probable methyltransferase PMT2-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006366706.1| PREDICTED: probable methyltransferase PMT2-like isoform X4 [Solanum 
tuberosum]
Length=612

 Score =   134 bits (337),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MANK + GD+RTR+SVSIFIVAGLCCFFYLLG+WQRSG GKGDSIAL VTK+ ++CNILP
Sbjct  1    MANK-SLGDNRTRTSVSIFIVAGLCCFFYLLGSWQRSGVGKGDSIALAVTKSGENCNILP  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFET H G+AGSID+S ++V
Sbjct  60   NLNFETRHGGQAGSIDDSGTEV  81



>gb|AFK36214.1| unknown [Lotus japonicus]
Length=86

 Score =   125 bits (313),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K +S DSRTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDS+ALE+TK   DCNI+P+L+
Sbjct  3    KPSSADSRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSVALEITKKGADCNIVPNLS  62

Query  331  FETHHSGRAGSIDESESK  384
            F++HH+G    IDE +SK
Sbjct  63   FDSHHAGEVSKIDEVDSK  80



>ref|XP_002273644.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera]
Length=618

 Score =   134 bits (336),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K+ S DSRTRSS+SIFIV GLCCFFY+LGAWQRSGFGKGDSIA+E+TK+  DC+I+ 
Sbjct  1    MATKIISADSRTRSSISIFIVVGLCCFFYILGAWQRSGFGKGDSIAVEMTKSGADCSIIS  60

Query  322  SLNFETHHSGRAGSIDESESK  384
            +LNFETHH G   + D+SESK
Sbjct  61   NLNFETHHGGEPVTTDDSESK  81



>gb|KJB60758.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=392

 Score =   132 bits (331),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 59/79 (75%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  S D RTRS V IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+P
Sbjct  1    MALKPNSPDGRTRSWVQIFIVFGLCCFFYILGAWQRSGFGKGDSIALEITKHGADCNIIP  60

Query  322  SLNFETHHSGRAGSIDESE  378
            SLNFETHH+G  G++ ESE
Sbjct  61   SLNFETHHAGEVGNVGESE  79



>ref|XP_002522425.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF39917.1| ATP binding protein, putative [Ricinus communis]
Length=612

 Score =   133 bits (335),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  S D+RTRSS+ IFIV GLCCFFY+LGAWQRSGFGK D++A+E+TK + DCN++P
Sbjct  1    MALKTNSADNRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKADNLAMEITKNTGDCNLVP  60

Query  322  SLNFETHHSGRAGSIDESESK  384
            SLNFETHH G  G+I +SESK
Sbjct  61   SLNFETHHGGEIGTIRDSESK  81



>ref|XP_008389474.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=606

 Score =   133 bits (334),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  + D RTRSSV IFIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK   DC+I+P
Sbjct  1    MAPKANA-DGRTRSSVQIFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKNGADCSIIP  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            SL F++HH+G AG+IDES+ KV
Sbjct  60   SLTFDSHHAGEAGNIDESKPKV  81



>gb|KDP41191.1| hypothetical protein JCGZ_15598 [Jatropha curcas]
Length=617

 Score =   133 bits (335),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  S DSRTRSS+ IFIV GLCCFFY+LGAWQRSGFGK D++A+E+TK + DCN++P
Sbjct  1    MALKTNSADSRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKADNLAMEITKNTGDCNLIP  60

Query  322  SLNFETHHSGRAGSIDESESK  384
            SLNFETHH G   SI++SESK
Sbjct  61   SLNFETHHGGEIESINDSESK  81



>ref|XP_010089758.1| putative methyltransferase PMT2 [Morus notabilis]
 gb|EXB38334.1| putative methyltransferase PMT2 [Morus notabilis]
Length=611

 Score =   133 bits (334),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA+K +SGD RTRSS+ IFIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK+  +CN++ 
Sbjct  1    MASKTSSGDGRTRSSIQIFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKSGAECNVVQ  60

Query  322  SLNFETHHSGRAGSIDESE  378
            +L+F+THH G A SIDES+
Sbjct  61   NLSFDTHHGGDARSIDESD  79



>gb|KHG10506.1| hypothetical protein F383_11349 [Gossypium arboreum]
Length=616

 Score =   132 bits (333),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/79 (75%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  S D RTRS V IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+P
Sbjct  1    MALKPNSADGRTRSWVQIFIVFGLCCFFYILGAWQRSGFGKGDSIALEITKHGADCNIIP  60

Query  322  SLNFETHHSGRAGSIDESE  378
            SLNFETHH+G  G++ ESE
Sbjct  61   SLNFETHHAGEVGNVGESE  79



>gb|KHG23981.1| hypothetical protein F383_09020 [Gossypium arboreum]
Length=616

 Score =   132 bits (333),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  S D+RTRSS+ I IV GLCCFFY+LGAWQRSGFGKGDSIALE+TK S DC+I+P
Sbjct  1    MALKPISTDTRTRSSIQISIVVGLCCFFYILGAWQRSGFGKGDSIALEMTKHSADCSIVP  60

Query  322  SLNFETHHSGRAGSIDESE  378
            +LNFETHH+G  G++DESE
Sbjct  61   TLNFETHHAGEVGNVDESE  79



>gb|KJB60755.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=514

 Score =   131 bits (330),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/79 (75%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  S D RTRS V IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+P
Sbjct  1    MALKPNSPDGRTRSWVQIFIVFGLCCFFYILGAWQRSGFGKGDSIALEITKHGADCNIIP  60

Query  322  SLNFETHHSGRAGSIDESE  378
            SLNFETHH+G  G++ ESE
Sbjct  61   SLNFETHHAGEVGNVGESE  79



>gb|KJB60756.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=540

 Score =   131 bits (330),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 59/79 (75%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  S D RTRS V IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+P
Sbjct  1    MALKPNSPDGRTRSWVQIFIVFGLCCFFYILGAWQRSGFGKGDSIALEITKHGADCNIIP  60

Query  322  SLNFETHHSGRAGSIDESE  378
            SLNFETHH+G  G++ ESE
Sbjct  61   SLNFETHHAGEVGNVGESE  79



>ref|XP_009360348.1| PREDICTED: probable methyltransferase PMT2 [Pyrus x bretschneideri]
Length=606

 Score =   132 bits (331),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  + D RTRSSV IFIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK   DC+I+P
Sbjct  1    MAPKANA-DGRTRSSVQIFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKNGADCSIIP  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            SL F++HH+G AG+ID+S+ KV
Sbjct  60   SLTFDSHHAGEAGNIDDSKPKV  81



>gb|KJB60757.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=616

 Score =   132 bits (331),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 59/79 (75%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  S D RTRS V IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+P
Sbjct  1    MALKPNSPDGRTRSWVQIFIVFGLCCFFYILGAWQRSGFGKGDSIALEITKHGADCNIIP  60

Query  322  SLNFETHHSGRAGSIDESE  378
            SLNFETHH+G  G++ ESE
Sbjct  61   SLNFETHHAGEVGNVGESE  79



>gb|EPS59468.1| hypothetical protein M569_15338, partial [Genlisea aurea]
Length=611

 Score =   131 bits (330),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MANK  SGDS+ RS +SIFIVAGLC FF+LLGAWQRSGFGKGD IALE+TK+  +CNILP
Sbjct  3    MANKYNSGDSKARSPLSIFIVAGLCFFFFLLGAWQRSGFGKGDRIALEMTKSGANCNILP  62

Query  322  SLNFETHHSGRAGSIDESES  381
            +LNFETHH G AG I++S+S
Sbjct  63   NLNFETHHGGEAGIIEDSDS  82



>ref|XP_010258374.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
 ref|XP_010258376.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
Length=617

 Score =   131 bits (330),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 60/82 (73%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K+ S D+RTRSSVSIFIV GLCCFFY+LGAWQ+SGFGKGDSIA+E+TK + DC++L 
Sbjct  1    MAMKMNSADNRTRSSVSIFIVVGLCCFFYILGAWQKSGFGKGDSIAVEITKQT-DCSVLS  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFETHHSG AG ID+  SKV
Sbjct  60   NLNFETHHSGEAGVIDDPGSKV  81



>gb|ABO92980.1| putative methyltransferase [Solanum tuberosum]
Length=612

 Score =   130 bits (328),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 2/80 (3%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  318
            MA K  SGD+RTR+SVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIA+ VTKT+ ++C+IL
Sbjct  1    MAGK-NSGDNRTRTSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIAVAVTKTAGENCDIL  59

Query  319  PSLNFETHHSGRAGSIDESE  378
            P+LNFET H+G AG  DESE
Sbjct  60   PNLNFETRHAGEAGGTDESE  79



>gb|AAT38756.2| Putative methyltransferase family protein [Solanum demissum]
Length=828

 Score =   132 bits (331),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 2/83 (2%)
 Frame = +1

Query  133  RDSMANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDC  309
            R +MA K  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIA+ +TKT+ ++C
Sbjct  122  RAAMAAK-NSGDNRTRTSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIAVAITKTAGENC  180

Query  310  NILPSLNFETHHSGRAGSIDESE  378
            +ILP+LNFET H+G AG  DESE
Sbjct  181  DILPNLNFETRHAGEAGGTDESE  203



>gb|AAT38682.2| Methyltransferase family protein, putative [Solanum demissum]
 gb|AAT38802.2| Methyltransferase family protein, putative [Solanum demissum]
Length=666

 Score =   130 bits (327),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 2/80 (3%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  318
            MA K  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIA+ VTKT+ ++C+IL
Sbjct  1    MAGK-NSGDNRTRTSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIAVAVTKTAGENCDIL  59

Query  319  PSLNFETHHSGRAGSIDESE  378
            P+LNFET H+G AG  DESE
Sbjct  60   PNLNFETRHAGEAGGTDESE  79



>ref|XP_004238796.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
 ref|XP_010320682.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=612

 Score =   129 bits (325),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 2/80 (3%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  318
            MA K  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIA+ VTKT+ ++C++L
Sbjct  1    MAGK-NSGDNRTRTSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIAVAVTKTAGENCDVL  59

Query  319  PSLNFETHHSGRAGSIDESE  378
            P+LNFET H+G AG  DESE
Sbjct  60   PNLNFETRHAGEAGGTDESE  79



>ref|XP_004228376.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=612

 Score =   129 bits (325),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/82 (73%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MANK + GD+RTR+SVSIFIVAGLC FFYLLG+WQRSG GKGDSIAL VT++ ++CNILP
Sbjct  1    MANK-SMGDNRTRTSVSIFIVAGLCFFFYLLGSWQRSGVGKGDSIALAVTRSGENCNILP  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFET H G+AGSID+S ++V
Sbjct  60   NLNFETRHGGQAGSIDDSGTEV  81



>ref|XP_007153607.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 ref|XP_007153608.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 gb|ESW25601.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 gb|ESW25602.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
Length=610

 Score =   129 bits (324),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K +S D RTRSSV I IV GLCCFFY+LGAWQRSGFGKGD IALE+TKT+++CNI+P+L+
Sbjct  3    KTSSADGRTRSSVQIIIVVGLCCFFYILGAWQRSGFGKGDGIALEITKTNEECNIVPNLS  62

Query  331  FETHHSGRAGSIDESESK  384
            F++HH G  G IDE++SK
Sbjct  63   FDSHHGGEVGEIDEADSK  80



>ref|NP_001280936.1| uncharacterized protein LOC103402903 [Malus domestica]
 gb|AAF27920.1|AF220204_1 unknown [Malus domestica]
Length=608

 Score =   129 bits (324),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  + D RTRSSV IFI AGLCCFFY+LGAWQRSGFGKGDSIAL +TK   DCNI+P
Sbjct  1    MAPKANA-DGRTRSSVQIFIAAGLCCFFYILGAWQRSGFGKGDSIALAITKNEADCNIIP  59

Query  322  SLNFETHHSGRAGSIDESESK  384
            SL+F++ H+G  G+IDESESK
Sbjct  60   SLSFDSQHAGEVGNIDESESK  80



>ref|XP_006439600.1| hypothetical protein CICLE_v10019341mg [Citrus clementina]
 gb|ESR52840.1| hypothetical protein CICLE_v10019341mg [Citrus clementina]
Length=613

 Score =   129 bits (324),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SG++RTR S+S+FIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MATKGNSGENRTRGSMSLFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKKT-DCSILS  59

Query  322  SLNFETHHSGRAGSIDESES  381
            +LN+ETHH G AG++D+SES
Sbjct  60   NLNYETHHGGDAGTVDDSES  79



>ref|XP_007157631.1| hypothetical protein PHAVU_002G085900g [Phaseolus vulgaris]
 gb|ESW29625.1| hypothetical protein PHAVU_002G085900g [Phaseolus vulgaris]
Length=607

 Score =   129 bits (323),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K +SGD RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI P L+
Sbjct  3    KPSSGDGRTRSSVQIFIVVGLCCFFYMLGAWQRSGFGKGDSIALEITKKGSDCNIRPDLS  62

Query  331  FETHHSGRAGSIDESESK  384
            F++HH G    IDE ESK
Sbjct  63   FDSHHGGEVSRIDEFESK  80



>ref|XP_006476610.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006476611.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Citrus 
sinensis]
Length=613

 Score =   129 bits (323),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SG++RTR S+S+FIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MATKGNSGENRTRGSMSLFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKKT-DCSILS  59

Query  322  SLNFETHHSGRAGSIDESES  381
            +LN+ETHH G AG++D+SES
Sbjct  60   NLNYETHHGGDAGTVDDSES  79



>ref|XP_006602298.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=608

 Score =   128 bits (322),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K +S D RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TKT  +CNI+P+L+
Sbjct  3    KPSSADGRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKTKAECNIVPNLS  62

Query  331  FETHHSGRAGSIDESESK  384
            F++HH G    IDE++SK
Sbjct  63   FDSHHGGEVSEIDEADSK  80



>gb|KHN17371.1| Putative methyltransferase PMT2 [Glycine soja]
Length=608

 Score =   128 bits (322),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K +S D RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TKT  +CNI+P+L+
Sbjct  3    KPSSADGRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKTKAECNIVPNLS  62

Query  331  FETHHSGRAGSIDESESK  384
            F++HH G    IDE++SK
Sbjct  63   FDSHHGGEVSEIDEADSK  80



>ref|XP_006439601.1| hypothetical protein CICLE_v10019341mg [Citrus clementina]
 gb|ESR52841.1| hypothetical protein CICLE_v10019341mg [Citrus clementina]
Length=572

 Score =   128 bits (321),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SG++RTR S+S+FIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MATKGNSGENRTRGSMSLFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKKT-DCSILS  59

Query  322  SLNFETHHSGRAGSIDESES  381
            +LN+ETHH G AG++D+SES
Sbjct  60   NLNYETHHGGDAGTVDDSES  79



>ref|XP_004297305.1| PREDICTED: probable methyltransferase PMT2 [Fragaria vesca subsp. 
vesca]
Length=607

 Score =   128 bits (322),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K T+ D RTR SV IFIVAGLCCFFY+LGAWQRSGFGKGDSIA+E+T+T  DC+++P
Sbjct  1    MATK-TNADGRTRGSVQIFIVAGLCCFFYILGAWQRSGFGKGDSIAVEITRTKADCSVIP  59

Query  322  SLNFETHHSGRAGSIDESESK  384
            +L+FE+HH+G  G IDES S+
Sbjct  60   NLSFESHHAGEVGKIDESGSE  80



>ref|XP_006366112.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366113.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Solanum 
tuberosum]
Length=612

 Score =   128 bits (322),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 2/80 (3%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  318
            MA K  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIA+ VTKT+ ++C+IL
Sbjct  1    MAGK-NSGDNRTRTSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIAVAVTKTAGENCDIL  59

Query  319  PSLNFETHHSGRAGSIDESE  378
            P+LNFET H+G AG  DE E
Sbjct  60   PNLNFETRHAGEAGGTDEPE  79



>gb|AAU90305.2| Methyltransferase, putative [Solanum tuberosum]
Length=718

 Score =   129 bits (323),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 2/80 (3%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  318
            MA K  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIA  VTKT+ ++C+IL
Sbjct  1    MAGK-NSGDNRTRTSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIAEAVTKTAGENCDIL  59

Query  319  PSLNFETHHSGRAGSIDESE  378
            P+LNFET H+G AG  DESE
Sbjct  60   PNLNFETRHAGEAGGTDESE  79



>ref|XP_006586024.1| PREDICTED: probable methyltransferase PMT2-like isoform X3 [Glycine 
max]
Length=534

 Score =   127 bits (318),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K +S D RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TKT+ +CNI+P+L+
Sbjct  3    KPSSADGRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKTNTECNIVPNLS  62

Query  331  FETHHSGRAGSIDESESK  384
            F++HH G     DE++SK
Sbjct  63   FDSHHGGEVNEFDEADSK  80



>ref|XP_003532062.1| PREDICTED: probable methyltransferase PMT2-like isoformX1 [Glycine 
max]
 ref|XP_003532063.1| PREDICTED: probable methyltransferase PMT2-like isoformX2 [Glycine 
max]
Length=608

 Score =   127 bits (319),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K +S D RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TKT+ +CNI+P+L+
Sbjct  3    KPSSADGRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKTNTECNIVPNLS  62

Query  331  FETHHSGRAGSIDESESK  384
            F++HH G     DE++SK
Sbjct  63   FDSHHGGEVNEFDEADSK  80



>gb|KDO76124.1| hypothetical protein CISIN_1g0367251mg, partial [Citrus sinensis]
Length=285

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SG++RTR S+S+FIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MATKGNSGENRTRGSMSLFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKKT-DCSILS  59

Query  322  SLNFETHHSGRAGSIDESES  381
            +LN+ETHH G AG++D+SES
Sbjct  60   NLNYETHHGGDAGTVDDSES  79



>ref|XP_006415973.1| hypothetical protein EUTSA_v10007096mg [Eutrema salsugineum]
 gb|ESQ34326.1| hypothetical protein EUTSA_v10007096mg [Eutrema salsugineum]
Length=616

 Score =   126 bits (317),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +SGD +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MALKSSSGDGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  322  SLNFETHHSGRAGSIDESES  381
            SLNFETHH+G +  +  SE+
Sbjct  61   SLNFETHHAGESSIVGASEA  80



>ref|XP_008339908.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=608

 Score =   126 bits (317),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  + D RTRSSV IFI AGLCCFFY+LGAWQRSGFGKGDSIA  +TK   DCNI+P
Sbjct  1    MAPKANA-DGRTRSSVQIFIXAGLCCFFYILGAWQRSGFGKGDSIAXAITKNEADCNIIP  59

Query  322  SLNFETHHSGRAGSIDESESK  384
            SL+F++ H+G  G+IDESESK
Sbjct  60   SLSFDSQHAGEVGNIDESESK  80



>ref|XP_011015217.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
 ref|XP_011015218.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=617

 Score =   126 bits (316),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SGD RTRSS+ IFIVAGLCCFFY+LGAWQRSGFGK D++A  + K+++DCNI+P
Sbjct  1    MALKSNSGDGRTRSSMQIFIVAGLCCFFYILGAWQRSGFGKADNLAERIIKSTEDCNIIP  60

Query  322  SLNFETHHSGRAGSIDESESK  384
            +L FETHH G  G  D+SESK
Sbjct  61   NLTFETHHGGDVGPNDDSESK  81



>ref|XP_011021619.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
 ref|XP_011021621.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=617

 Score =   126 bits (316),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SGD RTRSS+ IFIVAGLCCFFY+LGAWQRSGFGK D++A  + K+++DCNI+P
Sbjct  1    MALKSNSGDGRTRSSMQIFIVAGLCCFFYILGAWQRSGFGKADNLAERIIKSTEDCNIIP  60

Query  322  SLNFETHHSGRAGSIDESESK  384
            +L FETHH G  G  D+SESK
Sbjct  61   NLTFETHHGGDVGPNDDSESK  81



>ref|XP_010552579.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   125 bits (314),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S DSRTRSS+ IF+V GLCCFFY+LGAWQRSGFGKGDSIALE+TK+  DCN++P
Sbjct  1    MALKSSSVDSRTRSSIQIFVVVGLCCFFYILGAWQRSGFGKGDSIALEMTKSGSDCNMVP  60

Query  322  SLNFETHHSGRAGSIDESESK  384
            SL+FETHH+G     + S++K
Sbjct  61   SLSFETHHTGDLSVEESSKAK  81



>ref|XP_010257294.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
Length=615

 Score =   125 bits (314),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K+ S DSRTRSSVSIFIV GLCCFFY+LGAWQ+SGFGKGDSIA+E+TK + DC++L +LN
Sbjct  3    KINSADSRTRSSVSIFIVVGLCCFFYILGAWQKSGFGKGDSIAVEITKQT-DCSVLANLN  61

Query  331  FETHHSGRAGSIDE  372
            FETHH+G AG ID+
Sbjct  62   FETHHTGEAGVIDD  75



>gb|AAT39937.2| Putative methyltransferase family protein [Solanum demissum]
Length=755

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  318
            MA K  SGD+RTR+SVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIA+ VTKT+ ++C+IL
Sbjct  1    MAGK-NSGDNRTRTSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIAVAVTKTAGENCDIL  59

Query  319  PSLNFETHHSGRAGSIDESES  381
            P+LNFET H+G AG  DESE 
Sbjct  60   PNLNFETRHAGEAGGTDESEE  80



>ref|XP_010460256.1| PREDICTED: probable methyltransferase PMT2 [Camelina sativa]
 ref|XP_010477804.1| PREDICTED: probable methyltransferase PMT2 [Camelina sativa]
Length=616

 Score =   125 bits (313),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MAMKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  322  SLNFETHHSGRAGSIDESES  381
            SLNFETHH+G +  +  SE+
Sbjct  61   SLNFETHHAGESSIVGASEA  80



>ref|XP_010498988.1| PREDICTED: probable methyltransferase PMT2 [Camelina sativa]
Length=616

 Score =   125 bits (313),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MAMKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  322  SLNFETHHSGRAGSIDESES  381
            SLNFETHH+G +  +  SE+
Sbjct  61   SLNFETHHAGESSIVGASEA  80



>emb|CDY16198.1| BnaA09g29320D [Brassica napus]
Length=606

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D++TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MAIKSSSADNKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  322  SLNFETHHSGRAGSIDESESKV  387
            SLNFETHH+G + SI  S +KV
Sbjct  61   SLNFETHHAGES-SISGSSAKV  81



>gb|AAD14491.1| Unknown protein [Arabidopsis thaliana]
Length=590

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MALKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  322  SLNFETHHSGRAGSIDESES  381
            SLNFETHH+G +  +  SE+
Sbjct  61   SLNFETHHAGESSLVGASEA  80



>ref|XP_006303579.1| hypothetical protein CARUB_v10011097mg [Capsella rubella]
 gb|EOA36477.1| hypothetical protein CARUB_v10011097mg [Capsella rubella]
Length=616

 Score =   124 bits (312),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MAMKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  322  SLNFETHHSGRAGSIDESES  381
            SLNFETHH+G +  +  SE+
Sbjct  61   SLNFETHHAGESSIVGASEA  80



>ref|XP_010532828.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   124 bits (312),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 1/78 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D++TRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK+  DCN++P
Sbjct  1    MALKSSSVDNKTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEMTKSGIDCNLVP  60

Query  322  SLNFETHHSGRAGSIDES  375
            SL+FETHHSG   ++DES
Sbjct  61   SLSFETHHSGDL-TVDES  77



>ref|NP_849711.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 gb|AEE30750.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
Length=506

 Score =   123 bits (309),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MALKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  322  SLNFETHHSGRAGSIDESES  381
            SLNFETHH+G +  +  SE+
Sbjct  61   SLNFETHHAGESSLVGASEA  80



>ref|XP_002315803.2| hypothetical protein POPTR_0010s10420g [Populus trichocarpa]
 gb|EEF01974.2| hypothetical protein POPTR_0010s10420g [Populus trichocarpa]
Length=617

 Score =   124 bits (312),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D RTRSS+ IFIVAGLCCFFY+LGAWQRSGFGK D++A  + K+++DCNI+P
Sbjct  1    MALKSSSADGRTRSSMQIFIVAGLCCFFYILGAWQRSGFGKADNLAERIIKSTEDCNIIP  60

Query  322  SLNFETHHSGRAGSIDESESK  384
            +L FETHH G  G  D+SESK
Sbjct  61   NLTFETHHGGDVGPDDDSESK  81



>ref|NP_564265.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 ref|NP_849710.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 sp|B9DFI7.2|PMT2_ARATH RecName: Full=Probable methyltransferase PMT2 [Arabidopsis thaliana]
 gb|AAK59830.1| At1g26850/T2P11_4 [Arabidopsis thaliana]
 gb|AAN18206.1| At1g26850/T2P11_4 [Arabidopsis thaliana]
 gb|AEE30749.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 gb|AEE30751.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
Length=616

 Score =   124 bits (312),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MALKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  322  SLNFETHHSGRAGSIDESES  381
            SLNFETHH+G +  +  SE+
Sbjct  61   SLNFETHHAGESSLVGASEA  80



>dbj|BAH19504.1| AT1G26850 [Arabidopsis thaliana]
Length=616

 Score =   124 bits (312),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MALKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  322  SLNFETHHSGRAGSIDESES  381
            SLNFETHH+G +  +  SE+
Sbjct  61   SLNFETHHAGESSLVGASEA  80



>ref|XP_002893375.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69634.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=616

 Score =   124 bits (311),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MALKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  322  SLNFETHHSGRAGSIDESES  381
            SLNFETHH+G +  +  SE+
Sbjct  61   SLNFETHHAGESSIVGASEA  80



>ref|XP_009115418.1| PREDICTED: probable methyltransferase PMT2 [Brassica rapa]
Length=614

 Score =   124 bits (311),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D++TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MAIKSSSADNKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  322  SLNFETHHSGRAGSIDESESKV  387
            SLNFETHH+G + SI  S +KV
Sbjct  61   SLNFETHHAGES-SISGSSAKV  81



>ref|XP_004138921.1| PREDICTED: probable methyltransferase PMT2-like [Cucumis sativus]
 gb|KGN61383.1| hypothetical protein Csa_2G108610 [Cucumis sativus]
Length=616

 Score =   124 bits (310),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D RTRSSV IFIV GLC FFY+LGAWQRSGFGKGDSIA+E+TK+  DCNI+ 
Sbjct  1    MAPKPSSVDGRTRSSVQIFIVVGLCLFFYILGAWQRSGFGKGDSIAMEITKSGSDCNIVS  60

Query  322  SLNFETHHSGRAGSID-ESESKV  387
            +LNFETHH G A + D ES+SK+
Sbjct  61   NLNFETHHGGEAETNDSESQSKI  83



>ref|XP_008239959.1| PREDICTED: probable methyltransferase PMT2 [Prunus mume]
Length=611

 Score =   124 bits (310),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 5/82 (6%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SGD+R+RSSVS+FIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MATKGNSGDNRSRSSVSVFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKQT-DCSILS  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LN+ETHH G    ID+SE  V
Sbjct  60   NLNYETHHVG----IDDSEGVV  77



>ref|XP_003518725.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=607

 Score =   123 bits (309),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K +S + RTRS V IFIV G+CCFFY+LGAWQRSGFGKGDSIALE+TK   DCN++P+L+
Sbjct  3    KPSSANGRTRSHVQIFIVVGMCCFFYILGAWQRSGFGKGDSIALEITKKGADCNVVPNLS  62

Query  331  FETHHSGRAGSIDESESK  384
            F++HH G    IDE ESK
Sbjct  63   FDSHHGGEVSKIDEFESK  80



>ref|XP_004159999.1| PREDICTED: probable methyltransferase PMT2-like [Cucumis sativus]
Length=328

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D RTRSSV IFIV GLC FFY+LGAWQRSGFGKGDSIA+E+TK+  DCNI+ 
Sbjct  1    MAPKPSSVDGRTRSSVQIFIVVGLCLFFYILGAWQRSGFGKGDSIAMEITKSGSDCNIVS  60

Query  322  SLNFETHHSGRAGSID-ESESKV  387
            +LNFETHH G A + D ES+SK+
Sbjct  61   NLNFETHHGGEAETNDSESQSKI  83



>ref|XP_003517972.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=607

 Score =   122 bits (307),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K +S D RTRS V IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCN++P+L+
Sbjct  3    KPSSADGRTRSHVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKKGADCNVVPNLS  62

Query  331  FETHHSGRAGSIDESESK  384
            F++HH G    I E ESK
Sbjct  63   FDSHHGGEVSKIGEFESK  80



>ref|XP_003628357.1| hypothetical protein MTR_8g055840 [Medicago truncatula]
 gb|AET02833.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=610

 Score =   122 bits (307),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K ++ D+RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + +C+++P+L+
Sbjct  3    KPSAADNRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKNNAECDVVPNLS  62

Query  331  FETHHSGRAGSIDESES  381
            F++HH+G    IDES S
Sbjct  63   FDSHHAGEVSQIDESNS  79



>ref|XP_009103114.1| PREDICTED: probable methyltransferase PMT2 [Brassica rapa]
Length=614

 Score =   122 bits (307),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K TS D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIAL++T +  DCNI+P
Sbjct  1    MALKSTSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALQMTNSGADCNIVP  60

Query  322  SLNFETHHSGRAGSIDESESKV  387
            SLNFETHH+G + SI  S +KV
Sbjct  61   SLNFETHHAGES-SIVGSSTKV  81



>ref|XP_008441700.1| PREDICTED: probable methyltransferase PMT2 [Cucumis melo]
 ref|XP_008441701.1| PREDICTED: probable methyltransferase PMT2 [Cucumis melo]
Length=616

 Score =   122 bits (307),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D RTRSSV IFIV GLC FFY+LGAWQRSGFGKGDSIA+E+TK+  DCNI+ 
Sbjct  1    MAPKPSSADGRTRSSVQIFIVVGLCLFFYILGAWQRSGFGKGDSIAMEITKSGSDCNIVS  60

Query  322  SLNFETHHSGRAGSID-ESESKV  387
            +LNFETHH G A + D ES+ K+
Sbjct  61   NLNFETHHGGEAETNDSESQLKI  83



>gb|ACJ85858.1| unknown [Medicago truncatula]
Length=610

 Score =   122 bits (307),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K ++ D+RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + +C+++P+L+
Sbjct  3    KPSAADNRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKNNAECDVVPNLS  62

Query  331  FETHHSGRAGSIDESES  381
            F++HH+G    IDES S
Sbjct  63   FDSHHAGEVSQIDESNS  79



>ref|XP_007210881.1| hypothetical protein PRUPE_ppa003018mg [Prunus persica]
 gb|EMJ12080.1| hypothetical protein PRUPE_ppa003018mg [Prunus persica]
Length=611

 Score =   122 bits (306),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 5/82 (6%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SGD+R+RSS+S+FIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MATKGNSGDNRSRSSMSVFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKQT-DCSILS  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LN+ETHH G    ID+SE  V
Sbjct  60   NLNYETHHVG----IDDSEGVV  77



>ref|XP_004490044.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004490045.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Cicer 
arietinum]
Length=608

 Score =   121 bits (304),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K  S DSRTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDS+ALE+TK   DC+I+ +L+
Sbjct  3    KPNSADSRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSLALEITKKGADCDIVSNLS  62

Query  331  FETHHSGRAGSIDESESK  384
            F+THH G    ID  +SK
Sbjct  63   FDTHHGGEVSKIDNVDSK  80



>ref|XP_004511207.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004511208.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Cicer 
arietinum]
Length=610

 Score =   121 bits (303),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 50/78 (64%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K +  D+RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + +C+++P+L+
Sbjct  3    KPSHADNRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKHNAECDVVPNLS  62

Query  331  FETHHSGRAGSIDESESK  384
            F++HH+G+   I+E++SK
Sbjct  63   FDSHHAGKVSQINEADSK  80



>ref|XP_009591906.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
 ref|XP_009591908.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=617

 Score =   119 bits (299),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVS-IFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            MA K   GD+R+RS +S +FIVAGLCCFFYLLG WQRSGFGKGDSIALE+TK ++DC IL
Sbjct  1    MATKGNPGDNRSRSPLSSLFIVAGLCCFFYLLGVWQRSGFGKGDSIALEITKKAEDCGIL  60

Query  319  PSLNFETHHSGRAGSIDESESKV  387
            P+L +ETHH  ++ S D+   ++
Sbjct  61   PNLEYETHHGNQSSSFDDPNQEI  83



>emb|CDY40268.1| BnaA07g09320D [Brassica napus]
Length=606

 Score =   119 bits (299),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D +TRSSV IF+V  LCCFFY+LGAWQRSGFGKGDSIAL++T +  DC+I+P
Sbjct  1    MALKSSSADGKTRSSVQIFVVFSLCCFFYILGAWQRSGFGKGDSIALQMTNSGADCDIVP  60

Query  322  SLNFETHHSGRAGSIDESESKV  387
            SLNFETHH+G + SI  S +KV
Sbjct  61   SLNFETHHAGES-SIVGSSTKV  81



>ref|XP_002311593.1| hypothetical protein POPTR_0008s14720g [Populus trichocarpa]
 gb|EEE88960.1| hypothetical protein POPTR_0008s14720g [Populus trichocarpa]
Length=615

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/68 (72%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D RTRSS+ IFIV GLCCFFY+LGAWQRSGFGK D++A+E+TK++ DCNI+P
Sbjct  1    MALKSSSADGRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKADNLAMEITKSTGDCNIIP  60

Query  322  SLNFETHH  345
            +LNFETHH
Sbjct  61   NLNFETHH  68



>emb|CAN60192.1| hypothetical protein VITISV_038569 [Vitis vinifera]
Length=605

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  + +S+TRSS+SIF+V GLCCFFY+LGAWQRSGFGKGDSIA+EVTK + DC+IL 
Sbjct  1    MAKKGNAAESKTRSSISIFVVLGLCCFFYILGAWQRSGFGKGDSIAIEVTKQT-DCSILS  59

Query  322  SLNFETHHSGRAGSIDE  372
            +LNFETHH   AG+I +
Sbjct  60   NLNFETHHKDEAGTIGD  76



>ref|XP_002275852.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera]
 ref|XP_010663379.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera]
Length=610

 Score =   119 bits (297),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  + +S+TRSS+SIF+V GLCCFFY+LGAWQRSGFGKGDSIA+EVTK + DC+IL 
Sbjct  1    MAKKGNAAESKTRSSISIFVVLGLCCFFYILGAWQRSGFGKGDSIAIEVTKQT-DCSILS  59

Query  322  SLNFETHHSGRAGSIDE  372
            +LNFETHH   AG+I +
Sbjct  60   NLNFETHHKDEAGTIGD  76



>ref|XP_010275323.1| PREDICTED: probable methyltransferase PMT14 [Nelumbo nucifera]
Length=613

 Score =   119 bits (297),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K+ SG SRTRS  SIFIV GLCCFFY+LGAWQ+SGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MGSKLNSGSSRTRSPASIFIVVGLCCFFYILGAWQKSGFGKGDSIALEITKQT-DCSILS  59

Query  322  SLNFETHHSGRAGSIDESESK  384
            +LNFETHH+     +D S++K
Sbjct  60   NLNFETHHNDVGEIVDPSDTK  80



>ref|XP_011027055.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=615

 Score =   119 bits (297),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 48/68 (71%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D RTRSS+ IFIV GLCCFFY+LGAWQRSGFGK D++A+E+TK++ DCN++P
Sbjct  1    MALKSSSADGRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKADNLAMEITKSTGDCNVIP  60

Query  322  SLNFETHH  345
            +LNFETHH
Sbjct  61   NLNFETHH  68



>ref|XP_011025778.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
 ref|XP_011025787.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=615

 Score =   119 bits (297),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 48/68 (71%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D RTRSS+ IFIV GLCCFFY+LGAWQRSGFGK D++A+E+TK++ DCN++P
Sbjct  1    MALKSSSADGRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKADNLAMEITKSTGDCNVIP  60

Query  322  SLNFETHH  345
            +LNFETHH
Sbjct  61   NLNFETHH  68



>ref|XP_009782774.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
 ref|XP_009782775.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
 ref|XP_009782776.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=617

 Score =   118 bits (296),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVS-IFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            MA K   GD+R+RS +S +FIVAGLCCFFYLLG WQ+SGFGKGDSIALE+TK ++DC IL
Sbjct  1    MATKGNPGDNRSRSPLSSLFIVAGLCCFFYLLGVWQKSGFGKGDSIALEITKKAEDCGIL  60

Query  319  PSLNFETHHSGRAGSIDESESKV  387
            P+L +ETHH  ++ S D+   ++
Sbjct  61   PNLEYETHHGNQSSSFDDPNQEI  83



>ref|XP_004299370.1| PREDICTED: probable methyltransferase PMT2 [Fragaria vesca subsp. 
vesca]
Length=607

 Score =   118 bits (295),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SGD+R+RSS+S+FIVAGLCCFFY+LGAWQRSGFGKGDSIA+E+T+ + DC+IL 
Sbjct  2    MATKGNSGDNRSRSSMSVFIVAGLCCFFYILGAWQRSGFGKGDSIAVEITRQT-DCSILS  60

Query  322  SLNFETHHSGRAGSIDE  372
            +LN+ETHH    G + E
Sbjct  61   TLNYETHHGIDEGPVKE  77



>ref|XP_010683197.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683199.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683200.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683201.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
Length=610

 Score =   117 bits (294),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MANK T GDSR RSS+SIFI+ GLC FFYLLGAWQRSGFGKGDSIA+E+TK+  DC +L 
Sbjct  1    MANK-THGDSRARSSISIFIIVGLCGFFYLLGAWQRSGFGKGDSIAMEITKSGADCAVLS  59

Query  322  SLNFETHHSGRAGSIDESES  381
            +L+FETHH G   + D + S
Sbjct  60   NLSFETHHGGEIKTGDSAIS  79



>ref|XP_006660624.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=616

 Score =   116 bits (291),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA KV+S D+RTRS+VS+ IV G+CCFFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAVKVSSADNRTRSTVSLCIVIGMCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  322  SLNFETHHSGRAGSID  369
            +L+F+THHS +A S D
Sbjct  60   NLSFDTHHSKKASSGD  75



>gb|EPS60507.1| hypothetical protein M569_14296, partial [Genlisea aurea]
Length=589

 Score =   116 bits (290),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K   G+SRTRSS SIFIV GLCCFFYLLGAWQ+SG+GKGDSIAL VTK+  +CN++ 
Sbjct  1    MAIKFHHGESRTRSSASIFIVGGLCCFFYLLGAWQKSGYGKGDSIALAVTKSRANCNVVK  60

Query  322  SLNFETHHSGRAGSIDESES  381
            +L+FETHH   +G+ +++ S
Sbjct  61   TLDFETHHGDGSGTTEDAAS  80



>ref|XP_010937120.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Elaeis 
guineensis]
Length=616

 Score =   116 bits (290),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 2/81 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  + D+RTRSS+SIFIV G+CCFFY+LGAWQRSGFGKGDSIA+E+TK + DC ILP
Sbjct  1    MAMKGNAADNRTRSSISIFIVIGMCCFFYVLGAWQRSGFGKGDSIAVEITKQT-DCTILP  59

Query  322  SLNFETHHSGRAGSIDESESK  384
            +L+++THH  RA +++E  SK
Sbjct  60   NLSYDTHHD-RASNLEELGSK  79



>ref|XP_010937119.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Elaeis 
guineensis]
Length=617

 Score =   116 bits (290),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 2/81 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  + D+RTRSS+SIFIV G+CCFFY+LGAWQRSGFGKGDSIA+E+TK + DC ILP
Sbjct  1    MAMKGNAADNRTRSSISIFIVIGMCCFFYVLGAWQRSGFGKGDSIAVEITKQT-DCTILP  59

Query  322  SLNFETHHSGRAGSIDESESK  384
            +L+++THH  RA +++E  SK
Sbjct  60   NLSYDTHHD-RASNLEELGSK  79



>ref|XP_007037318.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY21819.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=615

 Score =   116 bits (290),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  +G+ +TRSSVSIFIV GLCCFF++LGAWQRSGFGKGD IA E+T+ + DC+IL 
Sbjct  1    MATKGNTGELKTRSSVSIFIVVGLCCFFFILGAWQRSGFGKGDRIASEITRQT-DCSILS  59

Query  322  SLNFETHHSGRAGSIDESES  381
            +LN+ETHH G   +ID S+S
Sbjct  60   NLNYETHHGGDTATIDGSDS  79



>ref|XP_009772034.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
 ref|XP_009772035.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=615

 Score =   115 bits (289),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K   GD+R+R  + IF+V GLCCFFYLLGAWQRSGFGKGDSIAL++TK ++DC+IL 
Sbjct  1    MAIKGNPGDNRSRGPLPIFVVVGLCCFFYLLGAWQRSGFGKGDSIALQMTKKAEDCSILS  60

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +L +ETHH  ++G +D+ + +V
Sbjct  61   NLEYETHHGDQSGMVDDPKLEV  82



>ref|XP_003613748.1| hypothetical protein MTR_5g040360 [Medicago truncatula]
 gb|AES96706.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=609

 Score =   115 bits (289),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA   +SG SRTRS V IFIV GLCCFFY+LGAWQR+GFGKGD + LEVTK    C+I+P
Sbjct  1    MAKPSSSG-SRTRSFVQIFIVVGLCCFFYILGAWQRTGFGKGDLLQLEVTKKGAGCDIVP  59

Query  322  SLNFETHHSGRAGSIDESESK  384
            +L+F++HH G  G IDE +SK
Sbjct  60   NLSFDSHHGGEVGKIDEVDSK  80



>ref|XP_008356626.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=611

 Score =   115 bits (288),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 5/82 (6%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SGD+R+RSS+SI IVAGLCCFFY+LGAWQRSGFGKGDSIA+E+T+ + DC+IL 
Sbjct  1    MATKGNSGDNRSRSSMSIVIVAGLCCFFYILGAWQRSGFGKGDSIAVEITRQT-DCSILS  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LN+ETH     G ID+SE  V
Sbjct  60   NLNYETHR----GGIDDSEGVV  77



>ref|XP_009595709.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
 ref|XP_009595710.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=615

 Score =   115 bits (287),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K   GD+R+R  + IF+V GLCCFFYLLGAWQRSGFGKGDSIAL++T  ++DC+IL 
Sbjct  1    MAIKGNPGDNRSRGPLPIFVVVGLCCFFYLLGAWQRSGFGKGDSIALQMTNKAEDCSILS  60

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +L +ETHH  ++G++D+ + +V
Sbjct  61   NLEYETHHGDQSGTVDDPKLEV  82



>ref|XP_002282093.2| PREDICTED: probable methyltransferase PMT14 [Vitis vinifera]
 ref|XP_010663982.1| PREDICTED: probable methyltransferase PMT14 [Vitis vinifera]
 ref|XP_010663986.1| PREDICTED: probable methyltransferase PMT14 [Vitis vinifera]
Length=611

 Score =   114 bits (285),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K     +RTRS VSIFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + DCNI+ 
Sbjct  1    MGSKHNPSGNRTRSPVSIFIVIGLCCFFYILGAWQRSGFGKGDSIALEITKQT-DCNIIS  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFETHH+    SI+ S+ KV
Sbjct  60   NLNFETHHN-NVDSIEPSQLKV  80



>ref|XP_009369302.1| PREDICTED: probable methyltransferase PMT2 [Pyrus x bretschneideri]
Length=611

 Score =   114 bits (285),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 5/79 (6%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SGD+R+RSS+SI IVAGLCCFFY+LGAWQRSGFGKGDSIA+E+T+ + DC+IL 
Sbjct  1    MATKGNSGDNRSRSSMSIVIVAGLCCFFYILGAWQRSGFGKGDSIAVEITRQT-DCSILS  59

Query  322  SLNFETHHSGRAGSIDESE  378
            +LN+ETH     G ID SE
Sbjct  60   NLNYETHR----GGIDNSE  74



>ref|XP_010551537.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Tarenaya 
hassleriana]
Length=618

 Score =   114 bits (285),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEV-TKTSKDCNIL  318
            MA K +S D++TRSS+ IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+ TKT  DC ++
Sbjct  1    MALKSSSVDNKTRSSIQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEMTTKTGSDCGVV  60

Query  319  PSLNFETHHSGRAGSIDESESK  384
            PSL+FET HS    SI ES SK
Sbjct  61   PSLSFETRHSSDL-SIGESLSK  81



>ref|XP_006354784.1| PREDICTED: probable methyltransferase PMT2-like [Solanum tuberosum]
Length=615

 Score =   114 bits (284),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSV-SIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            MA K   GD+R++SS+ S+ IVA LCCFFY+LG WQRSGFGKGDSIALE+TK ++DC IL
Sbjct  1    MATKGNPGDNRSKSSLPSLLIVAALCCFFYVLGVWQRSGFGKGDSIALEITKKAEDCGIL  60

Query  319  PSLNFETHHSGRAGSIDESESKV  387
            P+L +ETHH  ++ S D+ +  V
Sbjct  61   PNLEYETHHGNQSTSFDDPKQDV  83



>ref|XP_010551538.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Tarenaya 
hassleriana]
Length=571

 Score =   113 bits (283),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEV-TKTSKDCNIL  318
            MA K +S D++TRSS+ IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+ TKT  DC ++
Sbjct  1    MALKSSSVDNKTRSSIQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEMTTKTGSDCGVV  60

Query  319  PSLNFETHHSGRAGSIDESESK  384
            PSL+FET HS    SI ES SK
Sbjct  61   PSLSFETRHSSDL-SIGESLSK  81



>ref|XP_004956815.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Setaria 
italica]
 ref|XP_004956816.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Setaria 
italica]
Length=615

 Score =   113 bits (283),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/74 (72%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D+RTRS+VSI IV G+CCFFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAVKASSTDNRTRSTVSICIVIGMCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  322  SLNFETHHSGRAGS  363
            +L+F+THHS +AGS
Sbjct  60   NLSFDTHHS-KAGS  72



>ref|XP_010919849.1| PREDICTED: probable methyltransferase PMT2 [Elaeis guineensis]
Length=613

 Score =   112 bits (281),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  + D RTRSS+SI IV GLCCFFY+LGAWQRSG G+GDSIAL VTK + DC  LP
Sbjct  1    MALKGNAADGRTRSSMSIIIVIGLCCFFYVLGAWQRSGIGRGDSIALMVTKET-DCTTLP  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFETHHSG   S++ SE KV
Sbjct  60   NLNFETHHSGGV-SLEPSELKV  80



>ref|XP_009390921.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=617

 Score =   112 bits (281),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +SG+ RTRSS++I IV GLCCFFY+LGAWQRSGFG+GDSIAL+VT+ + +C I P
Sbjct  1    MAIKSSSGEGRTRSSLTIIIVVGLCCFFYVLGAWQRSGFGRGDSIALQVTQQT-ECTISP  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFETHH G     D  +S V
Sbjct  60   NLNFETHHGGSGSLSDLGDSVV  81



>emb|CDY45006.1| BnaCnng12360D [Brassica napus]
Length=605

 Score =   112 bits (281),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/69 (71%), Positives = 60/69 (87%), Gaps = 2/69 (3%)
 Frame = +1

Query  166  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSK--DCNILPSLNFET  339
            D++TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T ++   DCNI+PSLNFET
Sbjct  6    DNKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSASAADCNIVPSLNFET  65

Query  340  HHSGRAGSI  366
            HH+G + ++
Sbjct  66   HHAGESSAL  74



>emb|CDY46435.1| BnaA08g19950D [Brassica napus]
Length=603

 Score =   112 bits (281),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 3/75 (4%)
 Frame = +1

Query  166  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSK--DCNILPSLNFET  339
            D++TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T ++   DCNI+PSLNFET
Sbjct  6    DNKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSASAADCNIVPSLNFET  65

Query  340  HHSGRAGSIDESESK  384
            HH+G + SI  ++ K
Sbjct  66   HHAGES-SISSAKVK  79



>ref|XP_009380165.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=617

 Score =   112 bits (280),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 65/83 (78%), Gaps = 3/83 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SG+ RTRSS+SI IV GLCCFFY+LGAWQ+SGFGKGDSIAL+VTK + +C   P
Sbjct  1    MAIKSNSGEGRTRSSLSIIIVVGLCCFFYILGAWQKSGFGKGDSIALQVTKQT-ECTNSP  59

Query  322  SLNFETHH--SGRAGSIDESESK  384
            +LNFETHH  SG    I +SE+K
Sbjct  60   NLNFETHHGGSGSLKDIGDSEAK  82



>ref|XP_003578117.1| PREDICTED: probable methyltransferase PMT2 [Brachypodium distachyon]
Length=614

 Score =   111 bits (278),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SG++RTR++VSI IV G+CCFFY+LGAWQ+SGFGKGDSIALE+TK + DC +LP
Sbjct  1    MAMKGVSGENRTRTTVSICIVIGMCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTMLP  59

Query  322  SLNFETHHSGRAGSID  369
            +L+F+THHS    S D
Sbjct  60   NLSFDTHHSKEGSSSD  75



>ref|XP_002511570.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF52172.1| ATP binding protein, putative [Ricinus communis]
Length=613

 Score =   111 bits (278),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 3/82 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SGD +TRSS SIFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK +  C+IL 
Sbjct  1    MATKGNSGDHKTRSSFSIFIVVGLCCFFYVLGAWQRSGFGKGDSIALEITKQTH-CSILN  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LN++T  SG AG +D S ++V
Sbjct  60   NLNYQT--SGDAGIVDGSGAEV  79



>ref|XP_008651354.1| PREDICTED: uncharacterized protein LOC100279910 isoform X1 [Zea 
mays]
 tpg|DAA61440.1| TPA: ankyrin protein kinase-like protein [Zea mays]
Length=615

 Score =   111 bits (277),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/74 (66%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D+RTRS+VS+ IV G+CCFFY+LGAWQ+SGFGKGDSIALEVTK + DC ++P
Sbjct  1    MALKASSSDNRTRSTVSLCIVIGMCCFFYILGAWQKSGFGKGDSIALEVTKRT-DCTVVP  59

Query  322  SLNFETHHSGRAGS  363
            +L+F+THHS  +G+
Sbjct  60   NLSFDTHHSKASGN  73



>ref|NP_001152470.1| ankyrin protein kinase-like [Zea mays]
 gb|ACG47777.1| ankyrin protein kinase-like [Zea mays]
Length=615

 Score =   111 bits (277),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/74 (66%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D+RTRS+VS+ IV G+CCFFY+LGAWQ+SGFGKGDSIALEVTK + DC ++P
Sbjct  1    MALKASSSDNRTRSTVSLCIVIGMCCFFYILGAWQKSGFGKGDSIALEVTKRT-DCTVVP  59

Query  322  SLNFETHHSGRAGS  363
            +L+F+THHS  +G+
Sbjct  60   NLSFDTHHSKASGN  73



>ref|XP_006827213.1| hypothetical protein AMTR_s00010p00259630 [Amborella trichopoda]
 gb|ERM94450.1| hypothetical protein AMTR_s00010p00259630 [Amborella trichopoda]
Length=614

 Score =   111 bits (277),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K    +SRTRSS+SIFIV GLCCFFY+LG WQ+SGFGKGDSIA+++T +  +CN++P
Sbjct  1    MGSKFNPSESRTRSSISIFIVVGLCCFFYILGVWQKSGFGKGDSIAMQIT-SQTECNVMP  59

Query  322  SLNFETHHSGRAGSIDESESK  384
            +L+FETHH     + D  ESK
Sbjct  60   NLSFETHHGDAGITKDLFESK  80



>gb|EMS49438.1| putative methyltransferase PMT2 [Triticum urartu]
Length=614

 Score =   111 bits (277),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K    D+RTRS+VSI IV GLCCFFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAVKGGPADNRTRSTVSICIVIGLCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  322  SLNFETHHSGRAGSID  369
            +L+F+THHS +  S D
Sbjct  60   NLSFDTHHSKQGSSGD  75



>ref|XP_009110047.1| PREDICTED: probable methyltransferase PMT2 [Brassica rapa]
Length=611

 Score =   109 bits (273),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 62/75 (83%), Gaps = 3/75 (4%)
 Frame = +1

Query  166  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSK--DCNILPSLNFET  339
            D++TRSSV I IV  LCCFFY+LGAWQRSGFGKGDSIALE+T ++   DCNI+PSLNFET
Sbjct  6    DNKTRSSVQILIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSASAADCNIVPSLNFET  65

Query  340  HHSGRAGSIDESESK  384
            HH+G + SI  ++ K
Sbjct  66   HHAGES-SISSAKVK  79



>ref|XP_002460211.1| hypothetical protein SORBIDRAFT_02g024670 [Sorghum bicolor]
 gb|EER96732.1| hypothetical protein SORBIDRAFT_02g024670 [Sorghum bicolor]
Length=618

 Score =   109 bits (273),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +SG++RTRS+V + IV G+CCFFY+LGAWQ+SGFGKGDSIALEVTK + DC +LP
Sbjct  1    MALKASSGENRTRSTVFLCIVIGMCCFFYILGAWQKSGFGKGDSIALEVTKRT-DCTVLP  59

Query  322  SLNFETHHSGRA  357
            +L+F+THHS  A
Sbjct  60   NLSFDTHHSKPA  71



>ref|NP_001146334.1| uncharacterized protein LOC100279910 [Zea mays]
 gb|ACL53711.1| unknown [Zea mays]
Length=357

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D+RTRS+VS+ IV G+CCFFY+LGAWQ+SGFGKGDSIALEVTK + DC ++P
Sbjct  1    MALKASSSDNRTRSTVSLCIVIGMCCFFYILGAWQKSGFGKGDSIALEVTKRT-DCTVVP  59

Query  322  SLNFETHHSGRAGS  363
            +L+F+THHS  +G+
Sbjct  60   NLSFDTHHSKASGN  73



>ref|XP_007039581.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY24082.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=612

 Score =   109 bits (273),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA+K  +  +RTRS +SIF V GLCCFFY+LGAWQRSGFGKGDSIALEVTK + DCNI  
Sbjct  1    MASKHNTSGNRTRSPLSIFAVIGLCCFFYILGAWQRSGFGKGDSIALEVTKQT-DCNIFT  59

Query  322  SLNFETHHS  348
            +LNFETHH+
Sbjct  60   NLNFETHHN  68



>gb|EMT27426.1| hypothetical protein F775_29617 [Aegilops tauschii]
Length=614

 Score =   109 bits (273),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K    D+RTRS VSI IV GLCCFFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAVKGGPADNRTRSIVSICIVIGLCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  322  SLNFETHHSGRAGSID  369
            +L+F+THHS +  S D
Sbjct  60   NLSFDTHHSKQGSSGD  75



>ref|XP_008784684.1| PREDICTED: probable methyltransferase PMT2 [Phoenix dactylifera]
Length=612

 Score =   108 bits (271),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA  +++ D RTRSS+SI IV GLCCFFY+LGAWQRSG G+GDSIAL VT+ + DC  LP
Sbjct  2    MAPNMSTTDHRTRSSMSIIIVVGLCCFFYVLGAWQRSGIGRGDSIALRVTRET-DCTTLP  60

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +L FETHHSG   S++ SE  V
Sbjct  61   NLKFETHHSGGV-SLEPSELNV  81



>ref|XP_006364604.1| PREDICTED: probable methyltransferase PMT2-like [Solanum tuberosum]
Length=616

 Score =   108 bits (271),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K   GD+R+R   SIFIVAGLCCFFYL+G WQR GF KGDS AL++TK ++DC+IL 
Sbjct  1    MAIKGNPGDNRSRGPASIFIVAGLCCFFYLIGVWQRGGFVKGDSKALQITKRAEDCSILS  60

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +L +ETHH  + G +D+ + K+
Sbjct  61   NLEYETHHGDQHGLVDDPKLKI  82



>ref|XP_004241578.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=615

 Score =   108 bits (270),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 63/83 (76%), Gaps = 1/83 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSV-SIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            MA K   GD+R +S + S+ ++A LCCFFY+LG W+RSGFGKGDSIALE+TK ++DC IL
Sbjct  1    MATKGNPGDNRNKSFLPSLLVIAALCCFFYVLGVWKRSGFGKGDSIALEITKKAEDCGIL  60

Query  319  PSLNFETHHSGRAGSIDESESKV  387
            P+L +ETHH  ++ S D+ +  V
Sbjct  61   PNLEYETHHGNQSTSFDDPKQDV  83



>gb|EAZ09099.1| hypothetical protein OsI_31366 [Oryza sativa Indica Group]
Length=616

 Score =   108 bits (269),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/72 (67%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D+RTRS+VS+ IV G+CCFFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAVKASSADNRTRSTVSLCIVIGMCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  322  SLNFETHHSGRA  357
            +L+F+TH + +A
Sbjct  60   NLSFDTHLAKQA  71



>ref|NP_001063174.1| Os09g0415700 [Oryza sativa Japonica Group]
 dbj|BAD28913.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAD29253.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAF25088.1| Os09g0415700 [Oryza sativa Japonica Group]
 gb|EAZ44732.1| hypothetical protein OsJ_29364 [Oryza sativa Japonica Group]
Length=616

 Score =   107 bits (268),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/72 (67%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D+RTRS+VS+ IV G+CCFFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAVKASSADNRTRSTVSLCIVIGMCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  322  SLNFETHHSGRA  357
            +L+F+TH + +A
Sbjct  60   NLSFDTHLAKQA  71



>ref|XP_010066916.1| PREDICTED: probable methyltransferase PMT2 [Eucalyptus grandis]
 ref|XP_010066917.1| PREDICTED: probable methyltransferase PMT2 [Eucalyptus grandis]
 gb|KCW64965.1| hypothetical protein EUGRSUZ_G02508 [Eucalyptus grandis]
Length=615

 Score =   107 bits (268),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +1

Query  160  SGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFET  339
            S D RTR+S+ I IVAGLC FFY LGAWQRSGFGKGDSIAL +T +  DC++  +LNFET
Sbjct  6    SADGRTRTSIQILIVAGLCLFFYALGAWQRSGFGKGDSIALAITNSGADCDVASNLNFET  65

Query  340  HHSGRAGSIDESE  378
            HH G + +  ESE
Sbjct  66   HHGGESETSGESE  78



>ref|XP_009413462.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=615

 Score =   107 bits (268),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 64/83 (77%), Gaps = 3/83 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K+  G+ RTR+S+S+ +V GLCCFFY+LGAWQRSGFGKGDSIAL++TK +  C  + 
Sbjct  1    MAPKINHGEGRTRNSLSLIVVIGLCCFFYVLGAWQRSGFGKGDSIALQITKQTA-CTDIQ  59

Query  322  SLNFETHHSGRAGSID--ESESK  384
            +LNFETHHSG     D  +SE+K
Sbjct  60   NLNFETHHSGLGSLSDLGDSETK  82



>ref|XP_004235979.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=616

 Score =   106 bits (264),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K   GD R+R   SIFIVAGLCCFFY++G WQR GF KGD  +L++TK ++DC+IL 
Sbjct  1    MAIKGNPGDKRSRGPASIFIVAGLCCFFYVIGVWQRGGFAKGDGKSLQITKKAEDCSILS  60

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +L +ETHH  + G +D+ + K+
Sbjct  61   NLEYETHHGDQHGLVDDPKLKI  82



>ref|XP_008781841.1| PREDICTED: probable methyltransferase PMT2 [Phoenix dactylifera]
Length=616

 Score =   105 bits (263),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  + D RTRSS+SI IV GLCCFFY+LG WQRSGFGKGD IA ++T+ + +C I P
Sbjct  1    MALKGNAADGRTRSSMSIIIVVGLCCFFYVLGVWQRSGFGKGDRIAAQITEQT-ECAISP  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFETHHSG  G  ++ +S+V
Sbjct  60   NLNFETHHSG-GGVPNDDDSEV  80



>ref|XP_010668105.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
Length=605

 Score =   105 bits (261),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M  K ++GD +TRS +SIFIV GLCCFF+LLG+WQRSGFGKGD IA ++TK + DC+IL 
Sbjct  1    MGTKGSNGDYKTRSPLSIFIVIGLCCFFFLLGSWQRSGFGKGDRIAAQITKQT-DCSILT  59

Query  322  SLNFETHH  345
             LNFETHH
Sbjct  60   DLNFETHH  67



>ref|XP_008393149.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=609

 Score =   104 bits (259),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 3/74 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SGD+R+RSS+SI +VAGLCCFFY+LG WQRSGFGKGDSIA+++T +  DC+IL 
Sbjct  1    MATKGNSGDNRSRSSMSIVVVAGLCCFFYILGVWQRSGFGKGDSIAMDIT-SHTDCSILS  59

Query  322  SLNFETHHSGRAGS  363
            SL   THHSG  GS
Sbjct  60   SL--VTHHSGTDGS  71



>gb|KDP31241.1| hypothetical protein JCGZ_11617 [Jatropha curcas]
Length=613

 Score =   104 bits (259),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 3/82 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SGD +TRSSVSIFIV GLC FFY+LGAWQRSGFGKGDSIA  +TK +  C+IL 
Sbjct  1    MATKGNSGDHKTRSSVSIFIVVGLCGFFYILGAWQRSGFGKGDSIAWVITKQTH-CSILN  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LN++T  SG AG +D S  +V
Sbjct  60   NLNYQT--SGDAGIVDSSGEEV  79



>ref|XP_009371899.1| PREDICTED: probable methyltransferase PMT14 isoform X2 [Pyrus 
x bretschneideri]
Length=615

 Score =   103 bits (258),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 5/73 (7%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K  S  +RTRS++S+F+V  LCCFFYLLGAWQRSGFGKGD IA +VTK  KDCN+ P
Sbjct  1    MGSKHNSSGNRTRSTLSVFVVISLCCFFYLLGAWQRSGFGKGDKIAFQVTK-QKDCNVFP  59

Query  322  ----SLNFETHHS  348
                 LNFE+HHS
Sbjct  60   DLNSDLNFESHHS  72



>ref|XP_009371893.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371894.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371895.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371896.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371897.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371898.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
Length=616

 Score =   103 bits (258),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 5/73 (7%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K  S  +RTRS++S+F+V  LCCFFYLLGAWQRSGFGKGD IA +VTK  KDCN+ P
Sbjct  1    MGSKHNSSGNRTRSTLSVFVVISLCCFFYLLGAWQRSGFGKGDKIAFQVTK-QKDCNVFP  59

Query  322  ----SLNFETHHS  348
                 LNFE+HHS
Sbjct  60   DLNSDLNFESHHS  72



>gb|EPS64080.1| hypothetical protein M569_10695, partial [Genlisea aurea]
Length=606

 Score =   103 bits (257),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +1

Query  151  KVTSGDSRTRSS-VSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSL  327
            K   G+SR RSS VSIFIV GLCCFFYLLGAWQ+SG+GKGD+IAL VTK+  DC +L + 
Sbjct  3    KFHHGESRARSSSVSIFIVGGLCCFFYLLGAWQKSGYGKGDAIALAVTKSETDCILLQNH  62

Query  328  NFETHHSGRAGSIDE  372
            N ET HSG  G +++
Sbjct  63   NLETQHSGEGGIVED  77



>gb|KHN21848.1| Putative methyltransferase PMT2 [Glycine soja]
Length=606

 Score =   103 bits (257),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = +1

Query  142  MANKVTSGDSRT-RSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            M  K   GD+R  RSS+SIFI+ GLC FFY+LG WQRSGFGKGDSIA+E+TK + DC++L
Sbjct  1    MVTKGNPGDNRNNRSSLSIFIIVGLCGFFYILGLWQRSGFGKGDSIAVEITKHT-DCSVL  59

Query  319  PSLNFETHHSGRAGSIDESESKV  387
              LN+ETHH   +G+ + S+++V
Sbjct  60   SDLNYETHHDDDSGTPNSSDTQV  82



>ref|XP_003523024.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Glycine 
max]
Length=606

 Score =   103 bits (257),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = +1

Query  142  MANKVTSGDSRT-RSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            M  K   GD+R  RSS+SIFI+ GLC FFY+LG WQRSGFGKGDSIA+E+TK + DC++L
Sbjct  1    MVTKGNPGDNRNNRSSLSIFIIVGLCGFFYILGLWQRSGFGKGDSIAVEITKHT-DCSVL  59

Query  319  PSLNFETHHSGRAGSIDESESKV  387
              LN+ETHH   +G+ + S+++V
Sbjct  60   SDLNYETHHDDDSGTPNSSDTQV  82



>ref|XP_008351840.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=221

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 3/74 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SGD+R+RSS+SI +VAGLCCFFY+LG WQRSGFGKGDSIA+++T +  DC+IL 
Sbjct  1    MATKGNSGDNRSRSSMSIVVVAGLCCFFYILGVWQRSGFGKGDSIAMDIT-SHTDCSILS  59

Query  322  SLNFETHHSGRAGS  363
            SL   THHSG  GS
Sbjct  60   SL--VTHHSGTDGS  71



>ref|XP_010091504.1| putative methyltransferase PMT2 [Morus notabilis]
 gb|EXB44674.1| putative methyltransferase PMT2 [Morus notabilis]
Length=613

 Score =   103 bits (256),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K +S D+R R+S+SIFI+AGLCCFFY+LGAWQRSG GKGD IA ++     DC++L 
Sbjct  1    MAKKGSSIDNRRRNSMSIFIIAGLCCFFYILGAWQRSGSGKGDRIA-DLVNRQTDCSVLS  59

Query  322  SLNFETHHSGRAGSIDESE  378
            +LN+ETHH    GS D  E
Sbjct  60   NLNYETHHGNDVGSDDSEE  78



>emb|CDP12320.1| unnamed protein product [Coffea canephora]
Length=1044

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M  K   GDSR + SVS+FIVAGLCC F+LLGAWQRSG GKGD+IA E+TK +K C+IL 
Sbjct  1    MVTKGNPGDSRNKRSVSMFIVAGLCCVFFLLGAWQRSGSGKGDNIAYEITKKAKACSILG  60

Query  322  SLNFETHHSGRA  357
            +L FETHH  +A
Sbjct  61   NLEFETHHGNKA  72



>gb|KJB08229.1| hypothetical protein B456_001G071800 [Gossypium raimondii]
Length=655

 Score =   102 bits (255),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SG+ ++RSS SIFIV GLCCFFY+LGAWQRSGFGKGD IA  +TK + DC+++ 
Sbjct  1    MAIKGNSGELKSRSSASIFIVIGLCCFFYILGAWQRSGFGKGDKIASAITKQT-DCSVIS  59

Query  322  SLNFETHHSGRAGSIDESE  378
            +LN+ETHH     + D S+
Sbjct  60   NLNYETHHGDDVVTADGSD  78



>gb|KJB08228.1| hypothetical protein B456_001G071800 [Gossypium raimondii]
Length=617

 Score =   102 bits (255),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  SG+ ++RSS SIFIV GLCCFFY+LGAWQRSGFGKGD IA  +TK + DC+++ 
Sbjct  1    MAIKGNSGELKSRSSASIFIVIGLCCFFYILGAWQRSGFGKGDKIASAITKQT-DCSVIS  59

Query  322  SLNFETHHSGRAGSIDESE  378
            +LN+ETHH     + D S+
Sbjct  60   NLNYETHHGDDVVTADGSD  78



>ref|NP_001065447.2| Os10g0569300 [Oryza sativa Japonica Group]
 gb|ABB48009.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG92980.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF27284.2| Os10g0569300 [Oryza sativa Japonica Group]
Length=605

 Score =   102 bits (254),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +1

Query  145  ANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPS  324
             +++  GD RTRS++SI IV  LCCFFY+LGAWQ+SG G+GDSIAL VTK + DC ILP+
Sbjct  3    GSRMNPGDRRTRSTMSIVIVMSLCCFFYILGAWQKSGTGRGDSIALRVTKET-DCTILPN  61

Query  325  LNFETHHS  348
            L+FETHHS
Sbjct  62   LHFETHHS  69



>ref|XP_004499421.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
Length=606

 Score =   102 bits (254),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +1

Query  142  MANKVTSGDSRT-RSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            MA K   GD+R  +  +SIFIV GLC FFY+LG WQRSGFGKGDSIA+E+TK + DC++L
Sbjct  1    MATKGNPGDNRNNKGPMSIFIVVGLCGFFYILGLWQRSGFGKGDSIAVEITKHT-DCSVL  59

Query  319  PSLNFETHHSGRAGSIDESESKV  387
              LN+ETHH   AG+ D+ + +V
Sbjct  60   SDLNYETHHDSDAGTPDDLDEQV  82



>gb|KJB51712.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
Length=529

 Score =   101 bits (252),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K     ++ RS +SIF V GLCCFFY+LGAWQRSGFGKGDSIALEVTK + DC+I  
Sbjct  1    MVSKHNPSGNKKRSPLSIFAVIGLCCFFYILGAWQRSGFGKGDSIALEVTKQA-DCSIFT  59

Query  322  SLNFETHHS  348
            +LNFETHH+
Sbjct  60   NLNFETHHN  68



>ref|XP_002528760.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33582.1| ATP binding protein, putative [Ricinus communis]
Length=612

 Score =   102 bits (253),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K+    +RTRS +SIFIV  LCCFFY+LGAWQ+SGFGKGDSIA EVTK + DCNI P
Sbjct  1    MGSKLNPTGNRTRSPLSIFIVFCLCCFFYVLGAWQKSGFGKGDSIAFEVTKQT-DCNIFP  59

Query  322  SLNFETHHS  348
             LNFE  H+
Sbjct  60   ELNFEPRHN  68



>ref|XP_006662085.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=605

 Score =   101 bits (252),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +1

Query  145  ANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPS  324
             +++  GD RTRS+++I IV  LCCFFY+LGAWQ+SG G+GDSIAL VTK + DC ILP+
Sbjct  3    GSRMNPGDRRTRSTMTIVIVMSLCCFFYILGAWQKSGTGRGDSIALRVTKET-DCTILPN  61

Query  325  LNFETHHS  348
            L+FETHHS
Sbjct  62   LHFETHHS  69



>gb|KJB51709.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
 gb|KJB51710.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
 gb|KJB51711.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
Length=613

 Score =   101 bits (252),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K     ++ RS +SIF V GLCCFFY+LGAWQRSGFGKGDSIALEVTK + DC+I  
Sbjct  1    MVSKHNPSGNKKRSPLSIFAVIGLCCFFYILGAWQRSGFGKGDSIALEVTKQA-DCSIFT  59

Query  322  SLNFETHHS  348
            +LNFETHH+
Sbjct  60   NLNFETHHN  68



>gb|KHG27439.1| hypothetical protein F383_15139 [Gossypium arboreum]
Length=643

 Score =   101 bits (252),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K     ++ RS +SIF V GLCCFFY+LGAWQRSGFGKGDSIALEVTK + DC+I  
Sbjct  1    MVSKHNPSGNKKRSPLSIFAVIGLCCFFYILGAWQRSGFGKGDSIALEVTKQA-DCSIFT  59

Query  322  SLNFETHHS  348
            +LNFETHH+
Sbjct  60   NLNFETHHN  68



>ref|XP_008373611.1| PREDICTED: probable methyltransferase PMT14 [Malus domestica]
Length=383

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 5/73 (7%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K  S  +RTRS++S+F+V  LCCFFYLLGAWQ+SGFGKGD IA +VTK  KDCN+ P
Sbjct  1    MGSKHNSSGNRTRSTLSVFVVISLCCFFYLLGAWQKSGFGKGDKIAFQVTK-QKDCNVFP  59

Query  322  ----SLNFETHHS  348
                 LNFE+HHS
Sbjct  60   DLNSDLNFESHHS  72



>gb|KHN12213.1| Putative methyltransferase PMT2 [Glycine soja]
Length=585

 Score =   101 bits (251),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  211  LCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHHSGRAGSIDESESK  384
            +CCFFY+LGAWQRSGFGKGDSIALE+TK   DCN++P+L+F++HH G    IDE ESK
Sbjct  1    MCCFFYILGAWQRSGFGKGDSIALEITKKGADCNVVPNLSFDSHHGGEVSKIDEFESK  58



>ref|XP_008229546.1| PREDICTED: probable methyltransferase PMT14 [Prunus mume]
 ref|XP_008229547.1| PREDICTED: probable methyltransferase PMT14 [Prunus mume]
 ref|XP_008229548.1| PREDICTED: probable methyltransferase PMT14 [Prunus mume]
Length=612

 Score =   100 bits (250),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K  S  +RTRS++SIF+V  LCCFFYLLGAWQ+SGFGKGDSIA  VTK +   N+  
Sbjct  1    MKSKHNSSGNRTRSTISIFVVIALCCFFYLLGAWQKSGFGKGDSIAFPVTKQTDCSNVFT  60

Query  322  SLNFETHHS  348
             LNFETHH+
Sbjct  61   DLNFETHHN  69



>ref|XP_006385609.1| hypothetical protein POPTR_0003s08590g [Populus trichocarpa]
 gb|ERP63406.1| hypothetical protein POPTR_0003s08590g [Populus trichocarpa]
Length=612

 Score =   100 bits (250),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M NK  S   +TRS +SIFIV  LCCFFY+LGAWQ+SGFGKGD IA++++K + DC I P
Sbjct  1    MGNKHNSAGFKTRSPLSIFIVICLCCFFYILGAWQKSGFGKGDGIAVQMSKQT-DCQIFP  59

Query  322  SLNFETHHS  348
             LNFETHH+
Sbjct  60   DLNFETHHN  68



>ref|XP_011032031.1| PREDICTED: probable methyltransferase PMT14 [Populus euphratica]
 ref|XP_011032032.1| PREDICTED: probable methyltransferase PMT14 [Populus euphratica]
Length=612

 Score =   100 bits (249),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M NK  S   +TRS +SIFIV  LCCFFY+LGAWQ+SGFGKGD IA++++K + DC I P
Sbjct  1    MGNKHNSAGFKTRSPLSIFIVICLCCFFYILGAWQKSGFGKGDGIAVQMSKQT-DCQIFP  59

Query  322  SLNFETHHS  348
             LNFETHH+
Sbjct  60   DLNFETHHN  68



>ref|XP_004986789.1| PREDICTED: probable methyltransferase PMT2-like [Setaria italica]
Length=606

 Score =   100 bits (249),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +1

Query  145  ANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPS  324
             +++  GD RTRS+++I IV GLCCFFY+LGAWQ+SG G+GDSIAL V + + DC ILP+
Sbjct  3    GSRMNPGDRRTRSTMTIVIVMGLCCFFYILGAWQKSGTGRGDSIALRVNQET-DCTILPN  61

Query  325  LNFETHHS  348
            L+FETHHS
Sbjct  62   LHFETHHS  69



>emb|CAH18000.1| Ankyrin protein kinase-like [Poa pratensis]
Length=613

 Score =   100 bits (249),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K    +SRTRS+VSI IV G+C FFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAMKGGPAESRTRSTVSICIVVGMCVFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  322  SLNFETHHSGRAGSID  369
             ++++THHS +  S D
Sbjct  60   -ISYDTHHSKKGSSGD  74



>ref|XP_010917038.1| PREDICTED: probable methyltransferase PMT2 [Elaeis guineensis]
Length=616

 Score =   100 bits (248),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 6/84 (7%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  + D RTRS++SI IV GLCCFFY+LG WQRSGFGKGD IA ++T+ + +C I  
Sbjct  1    MALKGNATDGRTRSTMSIIIVVGLCCFFYVLGVWQRSGFGKGDRIAAQITEQT-ECAIPS  59

Query  322  SLNFETHHSGRAGSI---DESESK  384
            +LNFETHHSG  G +   D+SE K
Sbjct  60   NLNFETHHSG--GGVPNGDDSEVK  81



>emb|CDP12957.1| unnamed protein product [Coffea canephora]
Length=612

 Score =   100 bits (248),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA+K     SR RS VSIF+V GLCCFFYLLG WQ+SGFGKGD +A+E+TK + DC + P
Sbjct  1    MASKHHLLGSRGRSPVSIFVVLGLCCFFYLLGTWQKSGFGKGDRLAMEITKRT-DCTVFP  59

Query  322  SLNFETHHSGRAGSIDESESK  384
            +L+FE+HH  +   ++ SE K
Sbjct  60   ALDFESHHK-QEPPVESSEPK  79



>gb|KEH33485.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=606

 Score =   100 bits (248),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +1

Query  142  MANKVTSGDSRT-RSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            MA K   GD+R  +  +SIFIV  LC FFY+LG WQRSGFGKGDSIA+E+TK + DC++L
Sbjct  1    MATKGNPGDNRNNKGPLSIFIVVALCGFFYILGLWQRSGFGKGDSIAVEITKHT-DCSVL  59

Query  319  PSLNFETHHSGRAGSIDESESKV  387
              LN+ETHH   AG+ D+ + +V
Sbjct  60   SDLNYETHHDNDAGTPDDVDEQV  82



>ref|XP_007138189.1| hypothetical protein PHAVU_009G187900g [Phaseolus vulgaris]
 gb|ESW10183.1| hypothetical protein PHAVU_009G187900g [Phaseolus vulgaris]
Length=607

 Score =   100 bits (248),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +1

Query  142  MANKVTSGDSRT-RSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            M  K   GD+R  RS +SIFIV GLC FFY+LG WQRSGFGKGDSIA+E+TK + DC++L
Sbjct  1    MVTKGNPGDNRNNRSPLSIFIVVGLCGFFYILGLWQRSGFGKGDSIAVEITKHT-DCSVL  59

Query  319  PSLNFETHHSGRAGSIDESESKV  387
              LN+ETHH     + D S+++V
Sbjct  60   SDLNYETHHDDDVETSDGSDTQV  82



>ref|XP_008362975.1| PREDICTED: probable methyltransferase PMT14 [Malus domestica]
Length=537

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 5/73 (7%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M  K  S  +RTRS++SIF+V  LCCFFYLLGAWQ+SGFGKGD IA +VTK  KDCN+  
Sbjct  1    MGPKHNSSGNRTRSTLSIFVVISLCCFFYLLGAWQKSGFGKGDKIAFQVTK-QKDCNVFA  59

Query  322  S----LNFETHHS  348
                 LNFETHH+
Sbjct  60   ELNSDLNFETHHN  72



>ref|XP_002317981.2| hypothetical protein POPTR_0012s07080g [Populus trichocarpa]
 gb|EEE96201.2| hypothetical protein POPTR_0012s07080g [Populus trichocarpa]
Length=610

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 63/78 (81%), Gaps = 4/78 (5%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSV-SIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            MA K  SGD ++ +S+ SIF++AGLCCFFY+LGAWQRSGFGKGD+IALE++K + DC++ 
Sbjct  1    MATKGNSGDRKSNNSLFSIFVIAGLCCFFYILGAWQRSGFGKGDNIALEISKQT-DCSVF  59

Query  319  PSLNFETHHSGRAGSIDE  372
             +LN++   SG AG ID+
Sbjct  60   NNLNYQK--SGDAGMIDD  75



>ref|XP_010110495.1| putative methyltransferase PMT14 [Morus notabilis]
 gb|EXC26713.1| putative methyltransferase PMT14 [Morus notabilis]
Length=612

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 61/81 (75%), Gaps = 3/81 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K  S  S+ RS +SIF+V GLCC FYLLGAWQ+SGFGKGDSIALE+TK + DCNI+ 
Sbjct  1    MGSKHASPGSK-RSPLSIFVVLGLCCLFYLLGAWQKSGFGKGDSIALEITKQT-DCNIVN  58

Query  322  SLNFETHHSGRAGSIDESESK  384
             L+FE+HH+   G I  SE K
Sbjct  59   DLDFESHHND-VGIIAPSEPK  78



>ref|XP_008229550.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT14 
[Prunus mume]
Length=519

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K  S  +RTRS++SIF+V  LCCFFYLLG W++SGFGKGDSIA  VTK +   N+  
Sbjct  1    MESKHNSSGNRTRSTISIFVVIALCCFFYLLGTWKKSGFGKGDSIAFPVTKQTDCSNVFT  60

Query  322  SLNFETHHS  348
            +LNFETHH+
Sbjct  61   NLNFETHHN  69



>ref|XP_010559283.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
 ref|XP_010559284.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
Length=614

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K     +R+RSS+SI +V GLCCFFYLLGAWQRSGFGKGDSIA+E+TK ++  +I+ 
Sbjct  1    MGSKHNQPGNRSRSSLSIIVVIGLCCFFYLLGAWQRSGFGKGDSIAMEITKQAQCTDIVT  60

Query  322  SLNFETHHS  348
             L+FE HH+
Sbjct  61   DLDFEPHHN  69



>ref|XP_007155749.1| hypothetical protein PHAVU_003G228500g [Phaseolus vulgaris]
 gb|ESW27743.1| hypothetical protein PHAVU_003G228500g [Phaseolus vulgaris]
Length=613

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K      R R  +SIF V GLCCFFYLLGAWQRSG GKGD++AL+V K   DC +LP
Sbjct  1    MGSKTNPSGHRARRPLSIFAVLGLCCFFYLLGAWQRSGSGKGDNLALKVNKLMTDCTVLP  60

Query  322  SLNFETHHS  348
            +L+FE+HH+
Sbjct  61   NLSFESHHN  69



>gb|KHN30834.1| Putative methyltransferase PMT2 [Glycine soja]
Length=526

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = +1

Query  142  MANKVTSGDSRT-RSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            M  K   GD++  RSS+SIFI+ GLC FFY+LG WQRSGFGKGDSIA+E+TK + DC +L
Sbjct  1    MVTKGNPGDNKNNRSSLSIFIIVGLCGFFYILGLWQRSGFGKGDSIAVEITKRT-DCIVL  59

Query  319  PSLNFETHHSGRAGS  363
              LN+ETHH   +G+
Sbjct  60   SDLNYETHHDDNSGT  74



>gb|KCW77891.1| hypothetical protein EUGRSUZ_D02155 [Eucalyptus grandis]
Length=535

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 2/70 (3%)
 Frame = +1

Query  139  SMANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            ++ N   SG+ RTR  VS+F+  GLCCFFYL G WQ+SGFGKGDSIALE+TK + DCN+ 
Sbjct  2    AIKNNNPSGN-RTRKPVSVFVAIGLCCFFYLFGTWQKSGFGKGDSIALEITKHT-DCNVF  59

Query  319  PSLNFETHHS  348
              L+FE+HH+
Sbjct  60   TKLDFESHHN  69



>ref|XP_010053567.1| PREDICTED: probable methyltransferase PMT14 [Eucalyptus grandis]
 ref|XP_010053568.1| PREDICTED: probable methyltransferase PMT14 [Eucalyptus grandis]
 gb|KCW77890.1| hypothetical protein EUGRSUZ_D02155 [Eucalyptus grandis]
Length=613

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 2/70 (3%)
 Frame = +1

Query  139  SMANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            ++ N   SG+ RTR  VS+F+  GLCCFFYL G WQ+SGFGKGDSIALE+TK + DCN+ 
Sbjct  2    AIKNNNPSGN-RTRKPVSVFVAIGLCCFFYLFGTWQKSGFGKGDSIALEITKHT-DCNVF  59

Query  319  PSLNFETHHS  348
              L+FE+HH+
Sbjct  60   TKLDFESHHN  69



>gb|ACB54686.1| methyltransferase [Nicotiana benthamiana]
Length=617

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 59/83 (71%), Gaps = 3/83 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA+K  +  +RTR  +SI IV GLCCFFYL+G WQ+SG GKGD +AL VT+ + DCNI P
Sbjct  1    MASKYHASSNRTRRPISILIVIGLCCFFYLIGVWQKSGSGKGDKLALAVTEQTADCNIFP  60

Query  322  --SLNFETHHSGRAGSIDESESK  384
              +L+FE+HH+     I+ SE K
Sbjct  61   PSTLDFESHHN-YVEMIESSEPK  82



>ref|XP_003524439.1| PREDICTED: probable methyltransferase PMT14-like isoform X1 [Glycine 
max]
 ref|XP_006579671.1| PREDICTED: probable methyltransferase PMT14-like isoform X2 [Glycine 
max]
Length=613

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K  +   R R  +SIF V GLCCFFYLLGAWQRSG GKGD++AL+V     DC +LP
Sbjct  1    MGSKTNASGHRARRPLSIFAVLGLCCFFYLLGAWQRSGSGKGDNLALKVNNLMTDCTVLP  60

Query  322  SLNFETHHS  348
            +L+FE+HH+
Sbjct  61   NLSFESHHN  69



>ref|XP_007210880.1| hypothetical protein PRUPE_ppa003016mg [Prunus persica]
 gb|EMJ12079.1| hypothetical protein PRUPE_ppa003016mg [Prunus persica]
Length=612

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K  S  +RTRS++SIF+V  LCCFFYLLGAW++SGFGK DSIA  VTK +   N+  
Sbjct  1    MKSKHNSPGNRTRSTISIFVVIALCCFFYLLGAWEKSGFGKRDSIAFPVTKQTDCSNVFT  60

Query  322  SLNFETHHS  348
            +LNFETHH+
Sbjct  61   NLNFETHHN  69



>ref|XP_003574364.1| PREDICTED: probable methyltransferase PMT2 [Brachypodium distachyon]
Length=604

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +1

Query  145  ANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPS  324
             +++  GD RTRS +S+ IV  LC FFY+LGAWQ+SG G+GDSIAL VTK + DC ILP+
Sbjct  3    GSRMNPGDHRTRSVMSVLIVMSLCGFFYILGAWQKSGTGRGDSIALRVTKET-DCTILPN  61

Query  325  LNFETHHSGRAG  360
            L+FETHHS R G
Sbjct  62   LHFETHHS-RGG  72



>ref|XP_009793368.1| PREDICTED: probable methyltransferase PMT14 [Nicotiana sylvestris]
Length=617

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 59/83 (71%), Gaps = 3/83 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA+K  +  +RTR  +SI IV GLCCFFYL+G WQ+SG GKGD +AL VT+ + DCNI P
Sbjct  1    MASKYHAPSNRTRRPISILIVIGLCCFFYLIGVWQKSGSGKGDKLALAVTEQTADCNIFP  60

Query  322  --SLNFETHHSGRAGSIDESESK  384
              +L+FE+HH+     I+ SE K
Sbjct  61   PSTLDFESHHN-YVEMIESSEPK  82



>ref|XP_009587333.1| PREDICTED: probable methyltransferase PMT14 [Nicotiana tomentosiformis]
Length=617

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 59/83 (71%), Gaps = 3/83 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA+K  +  +RTR  +SI IV GLCCFFYL+G WQ+SG GKGD +AL VT+ + DCNI P
Sbjct  1    MASKYHAPSNRTRRPISILIVIGLCCFFYLIGVWQKSGSGKGDKLALAVTEQTADCNIFP  60

Query  322  --SLNFETHHSGRAGSIDESESK  384
              +L+FE+HH+     I+ SE K
Sbjct  61   PSTLDFESHHN-YVEMIESSEPK  82



>ref|XP_004508998.1| PREDICTED: probable methyltransferase PMT14-like [Cicer arietinum]
Length=611

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K  +  ++TR  +SIF V  LCC FYLLGAWQRSG GKGDS+AL+V K   DCN++P
Sbjct  1    MGSKSAALGNKTRRPLSIFAVIALCCLFYLLGAWQRSGSGKGDSLALKVNKLQTDCNVVP  60

Query  322  SLNFETHHSGRAGSIDESESK  384
            +L+FE HH+    +++ SE K
Sbjct  61   NLSFEPHHN-YVETVESSEPK  80



>ref|XP_010434585.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=625

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  163  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  342
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTELDFEPH  68

Query  343  HS  348
            H+
Sbjct  69   HN  70



>ref|XP_006368452.1| hypothetical protein POPTR_0001s02930g [Populus trichocarpa]
 gb|ERP65021.1| hypothetical protein POPTR_0001s02930g [Populus trichocarpa]
Length=612

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M  K +S   +TR+S+SIF+V  LCC FY+LGAWQ+SGFGKGD IA+++TK + DCNI  
Sbjct  1    MGTKHSSMGFKTRNSLSIFVVICLCCLFYILGAWQKSGFGKGDGIAVQMTKKT-DCNIFT  59

Query  322  SLNFETHHS  348
             LNFETHH+
Sbjct  60   ELNFETHHN  68



>ref|XP_010029626.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Eucalyptus 
grandis]
Length=538

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K    + R+RSS+ IF++  LCC FY+LGAWQRSGFGKGDSIALEVTK + DC++L 
Sbjct  1    MAYKGIPNERRSRSSMPIFVIVALCCAFYILGAWQRSGFGKGDSIALEVTKQA-DCSVLS  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +L +ET     A   D+S++ +
Sbjct  60   NLQYETQEIRDARVTDDSDTDI  81



>ref|XP_010439911.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=625

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  163  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  342
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTELDFEPH  68

Query  343  HS  348
            H+
Sbjct  69   HN  70



>ref|XP_009393700.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=616

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 49/69 (71%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  + D+RTRSSVSIFI+  +CCFFY+LGAWQ+SGFGKGDSIA+E+TK + DC ILP
Sbjct  1    MAVKGNAADNRTRSSVSIFIIISMCCFFYILGAWQKSGFGKGDSIAIEITKQT-DCTILP  59

Query  322  SLNFETHHS  348
            +L+FETHHS
Sbjct  60   NLSFETHHS  68



>ref|XP_009393699.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=617

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 49/69 (71%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K  + D+RTRSSVSIFI+  +CCFFY+LGAWQ+SGFGKGDSIA+E+TK + DC ILP
Sbjct  1    MAVKGNAADNRTRSSVSIFIIISMCCFFYILGAWQKSGFGKGDSIAIEITKQT-DCTILP  59

Query  322  SLNFETHHS  348
            +L+FETHHS
Sbjct  60   NLSFETHHS  68



>ref|XP_010449513.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=625

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  163  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  342
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTELDFEPH  68

Query  343  HS  348
            H+
Sbjct  69   HN  70



>dbj|BAH19630.1| AT4G18030 [Arabidopsis thaliana]
Length=621

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  163  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  342
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTDLDFEPH  68

Query  343  HS  348
            H+
Sbjct  69   HN  70



>ref|NP_193537.2| putative methyltransferase PMT14 [Arabidopsis thaliana]
 sp|Q94EJ6.1|PMTE_ARATH RecName: Full=Probable methyltransferase PMT14 [Arabidopsis thaliana]
 gb|AAK95250.1|AF410264_1 AT4g18030/T6K21_210 [Arabidopsis thaliana]
 gb|AAN64540.1| At4g18030/T6K21_210 [Arabidopsis thaliana]
 gb|AEE83986.1| putative methyltransferase PMT14 [Arabidopsis thaliana]
Length=621

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  163  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  342
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTDLDFEPH  68

Query  343  HS  348
            H+
Sbjct  69   HN  70



>ref|XP_002868016.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44275.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=624

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  163  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  342
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTDLDFEPH  68

Query  343  HS  348
            H+
Sbjct  69   HN  70



>emb|CAA17146.1| putative protein [Arabidopsis thaliana]
 emb|CAB78805.1| putative protein [Arabidopsis thaliana]
Length=629

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  163  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  342
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTDLDFEPH  68

Query  343  HS  348
            H+
Sbjct  69   HN  70



>ref|XP_006283339.1| hypothetical protein CARUB_v10004377mg [Capsella rubella]
 gb|EOA16237.1| hypothetical protein CARUB_v10004377mg [Capsella rubella]
Length=626

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  163  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  342
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTELDFEPH  68

Query  343  HS  348
            H+
Sbjct  69   HN  70



>ref|XP_010029610.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010029618.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW83590.1| hypothetical protein EUGRSUZ_B00481 [Eucalyptus grandis]
Length=614

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K    + R+RSS+ IF++  LCC FY+LGAWQRSGFGKGDSIALEVTK + DC++L 
Sbjct  1    MAYKGIPNERRSRSSMPIFVIVALCCAFYILGAWQRSGFGKGDSIALEVTKQA-DCSVLS  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +L +ET     A   D+S++ +
Sbjct  60   NLQYETQEIRDARVTDDSDTDI  81



>ref|XP_008658538.1| PREDICTED: probable methyltransferase PMT2 [Zea mays]
 ref|XP_008658539.1| PREDICTED: probable methyltransferase PMT2 [Zea mays]
Length=604

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +1

Query  145  ANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPS  324
             +++  GD RTRS+++I IV GL CFFY+LGAWQ+SG G+GDSIAL V + + DC ILP+
Sbjct  3    GSRMNPGDRRTRSTMTIVIVMGLSCFFYILGAWQKSGTGRGDSIALRVNQET-DCTILPN  61

Query  325  LNFETHHS  348
            L+FETHH+
Sbjct  62   LHFETHHT  69



>ref|XP_008448741.1| PREDICTED: probable methyltransferase PMT14 [Cucumis melo]
Length=613

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K     +R R  +S+F V GLC FFY+LGAWQRSGFGKGDSIA+E+T+ S +CN + 
Sbjct  1    MGSKHNLPANRNRGPISLFAVIGLCLFFYILGAWQRSGFGKGDSIAMEITRLS-NCNTVK  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
             LNFETHHS       E ++KV
Sbjct  60   DLNFETHHSIEIVESTEPKTKV  81



>ref|XP_004150171.1| PREDICTED: probable methyltransferase PMT14-like [Cucumis sativus]
 ref|XP_004164359.1| PREDICTED: probable methyltransferase PMT14-like [Cucumis sativus]
 gb|KGN55796.1| hypothetical protein Csa_3G016410 [Cucumis sativus]
Length=614

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K     +R R  +S+F V GLC FFY+LGAWQRSGFGKGDSIA+E+T+ S +CN + 
Sbjct  1    MGSKHNLPANRNRGPISLFAVIGLCLFFYILGAWQRSGFGKGDSIAMEITRLS-NCNTVK  59

Query  322  SLNFETHHSGRAGSIDESESKV  387
             LNFETHHS       E ++KV
Sbjct  60   DLNFETHHSIEIVESTEPKAKV  81



>gb|KDP22915.1| hypothetical protein JCGZ_01776 [Jatropha curcas]
Length=612

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/69 (62%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K     SR+R  +SIFIV  LCCFFY+LGAWQ+SGFGKGDSIA +VTK + DC I P
Sbjct  1    MGSKHNPPGSRSRGPLSIFIVFCLCCFFYVLGAWQKSGFGKGDSIAFQVTKQT-DCKIFP  59

Query  322  SLNFETHHS  348
             LNFE  H+
Sbjct  60   DLNFEPRHN  68



>gb|EYU33038.1| hypothetical protein MIMGU_mgv1a004747mg [Erythranthe guttata]
Length=512

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 4/86 (5%)
 Frame = +1

Query  142  MANKV-TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCN-I  315
            MA+K+  S   + RS +S+F+V GLCCFFYLLG WQRSGFGKGD+ A+E+ K   +CN +
Sbjct  1    MASKIHASSGIKGRSRLSLFVVIGLCCFFYLLGVWQRSGFGKGDNYAIEINKQQANCNEV  60

Query  316  LPSLNFETHHSGRA--GSIDESESKV  387
             PSL+FE+HH+  A   S +E +SKV
Sbjct  61   SPSLDFESHHNYVAPVHSSEEPKSKV  86



>ref|NP_001050233.1| Os03g0379100 [Oryza sativa Japonica Group]
 gb|AAL58254.1|AC084762_28 hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96247.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12147.1| Os03g0379100 [Oryza sativa Japonica Group]
 gb|EAZ27118.1| hypothetical protein OsJ_11050 [Oryza sativa Japonica Group]
 gb|EEC75363.1| hypothetical protein OsI_11805 [Oryza sativa Indica Group]
Length=611

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = +1

Query  157  TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFE  336
            +S +SRTR++VS+ ++ GLC FFYLLG WQRSGFG+GDSIA  V + +K C +LP+LNFE
Sbjct  4    SSTESRTRTTVSVVVLFGLCSFFYLLGVWQRSGFGRGDSIAAVVNEQTK-CVVLPNLNFE  62

Query  337  THHSGRAGSIDESESKV  387
            THHS      D   ++V
Sbjct  63   THHSASDLPNDTGSTEV  79



>dbj|BAJ85549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=670

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 1/61 (2%)
 Frame = +1

Query  166  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHH  345
            D RTRS +S+ IV GLC FFY+LGAWQ+SG G+GDSIAL VTK + DC ILP+L+FETHH
Sbjct  74   DRRTRSIMSVVIVMGLCGFFYILGAWQKSGTGRGDSIALRVTKET-DCTILPNLHFETHH  132

Query  346  S  348
            S
Sbjct  133  S  133



>ref|XP_011018634.1| PREDICTED: probable methyltransferase PMT14 isoform X2 [Populus 
euphratica]
Length=513

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M  K +S   +T+S +SIFIV  LCC FY+LGAWQ+SGFGKGD +A+++TK + DCNI  
Sbjct  1    MGTKHSSMGFKTQSPLSIFIVICLCCLFYILGAWQKSGFGKGDGLAVQMTKKT-DCNIFT  59

Query  322  SLNFETHHS  348
             LNFETHH+
Sbjct  60   ELNFETHHN  68



>gb|ACA66248.1| putative methyltransferase [Nicotiana benthamiana]
Length=617

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA+K  +  +RTR  +SI IV GLCCFFYL+  WQ+SG GKGD +AL VT+ + DCNI P
Sbjct  1    MASKYHASSNRTRRPISILIVIGLCCFFYLIMVWQKSGSGKGDKLALAVTEQTADCNIFP  60

Query  322  --SLNFETHHSGRAGSIDESESK  384
              +L+FE+HH+     I+ SE K
Sbjct  61   PSTLDFESHHN-YVEMIESSEPK  82



>ref|XP_006414159.1| hypothetical protein EUTSA_v10024685mg [Eutrema salsugineum]
 gb|ESQ55612.1| hypothetical protein EUTSA_v10024685mg [Eutrema salsugineum]
Length=623

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  163  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  342
            G++R+RSS+S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +++  L+F+ H
Sbjct  9    GNNRSRSSLSLIVVIGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDVVTELDFKPH  68

Query  343  HS  348
            H+
Sbjct  69   HN  70



>ref|XP_011013091.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=610

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 62/78 (79%), Gaps = 4/78 (5%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSV-SIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  318
            MA K  SGD ++ +S+ SIF++AGLCCFFY+LGAW+RSG GKGD+IALE++K + DC++ 
Sbjct  1    MATKGNSGDRKSNNSLFSIFMIAGLCCFFYILGAWRRSGVGKGDNIALEISKQT-DCSVF  59

Query  319  PSLNFETHHSGRAGSIDE  372
             +LN++   SG AG ID+
Sbjct  60   NNLNYQK--SGDAGMIDD  75



>ref|XP_011018632.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Populus 
euphratica]
 ref|XP_011018633.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Populus 
euphratica]
Length=612

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M  K +S   +T+S +SIFIV  LCC FY+LGAWQ+SGFGKGD +A+++TK + DCNI  
Sbjct  1    MGTKHSSMGFKTQSPLSIFIVICLCCLFYILGAWQKSGFGKGDGLAVQMTKKT-DCNIFT  59

Query  322  SLNFETHHS  348
             LNFETHH+
Sbjct  60   ELNFETHHN  68



>gb|ACU17089.1| unknown [Glycine max]
Length=213

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K  +   R R  +SIF V GLCCFFYLLGAWQRSG GK D +AL+V      C +LP
Sbjct  1    MGSKTNASGYRARRPLSIFAVLGLCCFFYLLGAWQRSGSGKADKLALKVNNLMTGCTVLP  60

Query  322  SLNFETHHS  348
            +L+FE+HHS
Sbjct  61   NLSFESHHS  69



>ref|XP_004300275.1| PREDICTED: probable methyltransferase PMT14 [Fragaria vesca subsp. 
vesca]
Length=608

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K     +RTR ++S+F+V  LCCFFYLLGAWQ+SGFGKGD IA EV + + DCN+  
Sbjct  1    MGSKQNPPGNRTRRTLSMFVVIALCCFFYLLGAWQKSGFGKGDKIAFEVPRHT-DCNVFG  59

Query  322  S-LNFETHHSGRAGSIDESESKV  387
            S LNFE HH+     I+ SE KV
Sbjct  60   SNLNFEPHHND-VEIIEHSEPKV  81



>ref|XP_006600888.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Glycine 
max]
 ref|XP_006600889.1| PREDICTED: probable methyltransferase PMT14 isoform X2 [Glycine 
max]
 gb|KHN01668.1| Putative methyltransferase PMT14 [Glycine soja]
Length=613

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K  +   R R  +SIF V GLCCFFYLLGAWQRSG GK D +AL+V      C +LP
Sbjct  1    MGSKTNASGYRARRPLSIFAVLGLCCFFYLLGAWQRSGSGKADKLALKVNNLMTGCTVLP  60

Query  322  SLNFETHHS  348
            +L+FE+HHS
Sbjct  61   NLSFESHHS  69



>ref|XP_006650137.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=611

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +1

Query  157  TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFE  336
            +S +SRTR++  + +V GLC FFYLLG WQRSGFG+GDSIA  V + +K C +LP+LNFE
Sbjct  4    SSTESRTRTTAFVVVVFGLCSFFYLLGVWQRSGFGRGDSIAAVVNEQTK-CVVLPNLNFE  62

Query  337  THHSG  351
            THHS 
Sbjct  63   THHSA  67



>ref|XP_010529126.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
 ref|XP_010529127.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
Length=614

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K     +R+RS +S+  V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+ 
Sbjct  1    MGSKHNPPGNRSRSPLSLIAVIGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVT  60

Query  322  SLNFETHHS  348
             L+FE HH+
Sbjct  61   DLDFEPHHN  69



>ref|XP_009131372.1| PREDICTED: probable methyltransferase PMT14 [Brassica rapa]
Length=620

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  172  RTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHHS  348
            R+RSS+S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +++  L+F+ HH+
Sbjct  9    RSRSSLSLILVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDVVTDLDFKPHHN  67



>emb|CDX78823.1| BnaA01g08900D [Brassica napus]
Length=620

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  172  RTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHHS  348
            R+RSS+S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +++  L+F+ HH+
Sbjct  9    RSRSSLSLILVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDVVTDLDFKPHHN  67



>gb|KDO43765.1| hypothetical protein CISIN_1g038698mg, partial [Citrus sinensis]
Length=283

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K  S  SRTRS +SI IV  LC FFY+LGAWQ+SGFGKGD+IA ++TK + DCNI   L+
Sbjct  3    KHNSSGSRTRSPLSILIVIVLCGFFYMLGAWQKSGFGKGDTIASQITKQA-DCNIFTDLS  61

Query  331  FETHHSGRAGSIDESESK  384
            FETHH+     ++ SE K
Sbjct  62   FETHHND-VEIVEPSEPK  78



>ref|XP_006358580.1| PREDICTED: probable methyltransferase PMT14-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006358581.1| PREDICTED: probable methyltransferase PMT14-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA+K     +RTR  +SI IV GLCCF YL+G WQ+SG GKGD +AL+VT+ + DCN+ P
Sbjct  1    MASKYHGPINRTRRPISILIVIGLCCFCYLIGIWQKSGSGKGDKLALQVTEQTADCNVFP  60

Query  322  --SLNFETHHS  348
              +L+FE+HH+
Sbjct  61   QTTLDFESHHN  71



>ref|XP_006436790.1| hypothetical protein CICLE_v10030990mg [Citrus clementina]
 ref|XP_006485402.1| PREDICTED: probable methyltransferase PMT14-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485403.1| PREDICTED: probable methyltransferase PMT14-like isoform X2 [Citrus 
sinensis]
 gb|ESR50030.1| hypothetical protein CICLE_v10030990mg [Citrus clementina]
Length=609

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +1

Query  151  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  330
            K  S  SRTRS +SI IV  LC FFY+LGAWQ+SGFGKGD+IA ++TK + DCNI   L+
Sbjct  3    KHNSSGSRTRSPLSILIVIVLCGFFYMLGAWQKSGFGKGDTIASQITKQA-DCNIFTDLS  61

Query  331  FETHHS  348
            FETHH+
Sbjct  62   FETHHN  67



>ref|XP_004245869.1| PREDICTED: probable methyltransferase PMT14 [Solanum lycopersicum]
Length=616

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA+K     +RTR  +SI IV GLCCF YL+G WQ+SG GKGD +AL+VT+ + DCN+ P
Sbjct  1    MASKYHGPINRTRRPISILIVIGLCCFCYLIGIWQKSGSGKGDKLALQVTEQTADCNVFP  60

Query  322  --SLNFETHHS  348
              +L+FE+HH+
Sbjct  61   QTTLDFESHHN  71



>ref|XP_010695192.1| PREDICTED: probable methyltransferase PMT14 [Beta vulgaris subsp. 
vulgaris]
Length=612

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = +1

Query  172  RTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSK--DCNILPSLNFETHH  345
            R+R S+SIFIV GLCCF YLLG+WQ+SGFGKGDSIA+ V+K ++  DC++   L+FE HH
Sbjct  8    RSRGSMSIFIVLGLCCFCYLLGSWQKSGFGKGDSIAMRVSKVAELADCDVKTDLDFEPHH  67



>gb|EAY79581.1| hypothetical protein OsI_34717 [Oryza sativa Indica Group]
Length=589

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = +1

Query  187  VSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHHS  348
            +SI IV  LCCFFY+LGAWQ+SG G+GDSIAL VTK + DC ILP+L+FETHHS
Sbjct  1    MSIVIVMSLCCFFYILGAWQKSGTGRGDSIALRVTKET-DCTILPNLHFETHHS  53



>gb|EAZ17038.1| hypothetical protein OsJ_32528 [Oryza sativa Japonica Group]
Length=589

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = +1

Query  187  VSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHHS  348
            +SI IV  LCCFFY+LGAWQ+SG G+GDSIAL VTK + DC ILP+L+FETHHS
Sbjct  1    MSIVIVMSLCCFFYILGAWQKSGTGRGDSIALRVTKET-DCTILPNLHFETHHS  53



>tpg|DAA42264.1| TPA: methyltransferase isoform 1 [Zea mays]
 tpg|DAA42265.1| TPA: methyltransferase isoform 2 [Zea mays]
Length=628

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 4/80 (5%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MANK  SG    RS +++ +   LCCFFY+LGAWQRSG+GKGD IA  V++ +   ++  
Sbjct  1    MANKAVSG---ARSPLNLVVAMALCCFFYVLGAWQRSGYGKGDRIAAAVSRQTACGDVAA  57

Query  322  SLNFETHHSGRAGSIDESES  381
             L+FETHH G AG+I+ S S
Sbjct  58   GLSFETHHGG-AGAINASSS  76



>ref|XP_008668148.1| PREDICTED: methyltransferase isoform X1 [Zea mays]
Length=658

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 4/80 (5%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MANK  SG    RS +++ +   LCCFFY+LGAWQRSG+GKGD IA  V++ +   ++  
Sbjct  1    MANKAVSG---ARSPLNLVVAMALCCFFYVLGAWQRSGYGKGDRIAAAVSRQTACGDVAA  57

Query  322  SLNFETHHSGRAGSIDESES  381
             L+FETHH G AG+I+ S S
Sbjct  58   GLSFETHHGG-AGAINASSS  76



>gb|EMT05545.1| hypothetical protein F775_20122 [Aegilops tauschii]
Length=612

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA  +T  + +TR+++ + +V GLC FFYLLG WQRSGFG+GDSIA  V + +K C  LP
Sbjct  1    MARSLT--EKKTRTALFVLVVFGLCSFFYLLGVWQRSGFGRGDSIAAVVNEQTK-CLKLP  57

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFETHHS      D   S+V
Sbjct  58   NLNFETHHSASDLPNDTFSSQV  79



>gb|EEC68449.1| hypothetical protein OsI_36659 [Oryza sativa Indica Group]
Length=596

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = +1

Query  160  SGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFET  339
            S ++R RS +++ +  GLCCFFYLLGAWQRSG+GKGDSIA+ V + +  C  +  L+FET
Sbjct  9    SAENRGRSPLAMVVAVGLCCFFYLLGAWQRSGYGKGDSIAMAVNRQTAACGGV-GLSFET  67

Query  340  HHSGRAGSIDES  375
            HH G AG  +E+
Sbjct  68   HHGG-AGVENET  78



>ref|NP_001068227.1| Os11g0601600 [Oryza sativa Japonica Group]
 gb|ABA94590.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28590.1| Os11g0601600 [Oryza sativa Japonica Group]
Length=652

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = +1

Query  160  SGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFET  339
            S ++R RS +++ +  GLCCFFYLLGAWQRSG+GKGDSIA+ V + +  C  +  L+FET
Sbjct  9    SAENRGRSPLAMVVAVGLCCFFYLLGAWQRSGYGKGDSIAMAVNRQTAACGGV-GLSFET  67

Query  340  HHSGRAGSIDES  375
            HH G AG  +E+
Sbjct  68   HHGG-AGVENET  78



>gb|EYU35839.1| hypothetical protein MIMGU_mgv1a0064512mg, partial [Erythranthe 
guttata]
Length=400

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA K   GD + R S+S+ I+A LC F YLLG WQ+SG GKGDSIALEV   +++CNIL 
Sbjct  1    MAIKRYRGDRKNRRSISLLIIAALCGFLYLLGVWQKSGSGKGDSIALEVMNNAENCNILS  60

Query  322  SLNFETHHS  348
             L  + H S
Sbjct  61   HLQIKIHQS  69



>gb|EEE52366.1| hypothetical protein OsJ_34430 [Oryza sativa Japonica Group]
Length=624

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = +1

Query  160  SGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFET  339
            S ++R RS +++ +  GLCCFFYLLGAWQRSG+GKGDSIA+ V + +  C  +  L+FET
Sbjct  9    SAENRGRSPLAMVVAVGLCCFFYLLGAWQRSGYGKGDSIAMAVNRQTAACGGV-GLSFET  67

Query  340  HHSGRAGSIDES  375
            HH G AG  +E+
Sbjct  68   HHGG-AGVENET  78



>ref|XP_003557818.1| PREDICTED: probable methyltransferase PMT2 [Brachypodium distachyon]
Length=611

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +1

Query  166  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHH  345
            +++TR+ + + +V GLC FFYLLG WQRSGFG+GDSIA  V + +K C  LP+LNFETHH
Sbjct  7    ENKTRTILFVVVVFGLCSFFYLLGVWQRSGFGRGDSIAAVVNEQTK-CVRLPNLNFETHH  65

Query  346  SG  351
            S 
Sbjct  66   SA  67



>gb|KEH31563.1| methyltransferase PMT14-like protein, putative [Medicago truncatula]
Length=1599

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTK--TSKDCNI  315
            M +K     +R R  +SIF V  LCC FYLLG WQ SG GKGDS+AL+V K   + DCNI
Sbjct  1    MGSKNALPGNRARRPLSIFAVLALCCLFYLLGTWQSSGSGKGDSLALKVNKMQATTDCNI  60

Query  316  LPSLNFETHHSGRAGSIDESESK  384
            +P+LNFE  H      +++SE K
Sbjct  61   VPNLNFEPQHK-YVEIVEQSEPK  82



>ref|NP_001152056.1| methyltransferase [Zea mays]
 gb|ACG45571.1| methyltransferase [Zea mays]
Length=628

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 4/80 (5%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MANK  SG    RS ++  +   LCCF Y+LGAWQRSG+GKGD IA  V++ +   ++  
Sbjct  1    MANKAVSG---ARSPLNXVVAMALCCFXYVLGAWQRSGYGKGDRIAAAVSRQTACGDVAA  57

Query  322  SLNFETHHSGRAGSIDESES  381
             L+FETHH G AG+I+ S S
Sbjct  58   GLSFETHHGG-AGAINASSS  76



>gb|EAY81488.1| hypothetical protein OsI_36661 [Oryza sativa Indica Group]
Length=638

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 2/72 (3%)
 Frame = +1

Query  160  SGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFET  339
            S ++R RS +++    GLCCFFYLLGAWQRSG+GKGDSIA+ V + +  C  +  L+FET
Sbjct  9    SPENRGRSPLAMVFAVGLCCFFYLLGAWQRSGYGKGDSIAMPVNRQTAACGGV-GLSFET  67

Query  340  HHSGRAGSIDES  375
            HH G AG  +E+
Sbjct  68   HHGG-AGVENET  78



>ref|XP_006280182.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
 ref|XP_006280183.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
 gb|EOA13080.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
 gb|EOA13081.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
Length=622

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 5/65 (8%)
 Frame = +1

Query  166  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCN-----ILPSLN  330
            ++ TR+  ++ IV GLCCFFYLLGAWQ+SGFGKGD I +EVTK ++  N     I+  L+
Sbjct  10   NNSTRTLFTLIIVTGLCCFFYLLGAWQKSGFGKGDGIVMEVTKQAQCTNVTVTDIVKDLD  69

Query  331  FETHH  345
            FE HH
Sbjct  70   FEPHH  74



>ref|XP_002449806.1| hypothetical protein SORBIDRAFT_05g023610 [Sorghum bicolor]
 gb|EES08794.1| hypothetical protein SORBIDRAFT_05g023610 [Sorghum bicolor]
Length=609

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 8/84 (10%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSK----DC  309
            MANK +SG    RS +S+ +   LCCFFY+LGAWQRSG+GKGD IA  VT+ +       
Sbjct  1    MANKASSG---ARSPLSLVVAMALCCFFYVLGAWQRSGYGKGDRIAAAVTRQTACGDGSA  57

Query  310  NILPSLNFETHHSGRAGSIDESES  381
             +    +FETHH G AG I+ S S
Sbjct  58   AVAAEHSFETHHGGAAG-INASTS  80



>ref|XP_004984213.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Setaria 
italica]
Length=611

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA  +T  ++RTR+++ + +V GLC FFYLLGAWQRSG G GD I   V + +K C  LP
Sbjct  1    MARSLT--ENRTRNTLIVVVVFGLCSFFYLLGAWQRSGSGGGDRIQNWVNEQTK-CAQLP  57

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFETHH       D   SK+
Sbjct  58   NLNFETHHRASDLPNDTGSSKI  79



>ref|XP_004984212.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Setaria 
italica]
Length=619

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA  +T  ++RTR+++ + +V GLC FFYLLGAWQRSG G GD I   V + +K C  LP
Sbjct  9    MARSLT--ENRTRNTLIVVVVFGLCSFFYLLGAWQRSGSGGGDRIQNWVNEQTK-CAQLP  65

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +LNFETHH       D   SK+
Sbjct  66   NLNFETHHRASDLPNDTGSSKI  87



>ref|XP_008659999.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Zea mays]
Length=611

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA  +T  ++RTR+++ + +V GLC FFYLLGAWQ+SG G GD I   V + +K C  LP
Sbjct  1    MARNLT--ENRTRNTLIVIVVFGLCSFFYLLGAWQKSGSGGGDRIQNWVNEQTK-CAQLP  57

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +L+FETHHS      D   SK+
Sbjct  58   NLSFETHHSASNLPNDTGSSKI  79



>gb|AFW87980.1| hypothetical protein ZEAMMB73_653302 [Zea mays]
Length=594

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA  +T  ++RTR+++ + +V GLC FFYLLGAWQ+SG G GD I   V + +K C  LP
Sbjct  1    MARNLT--ENRTRNTLIVIVVFGLCSFFYLLGAWQKSGSGGGDRIQNWVNEQTK-CAQLP  57

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +L+FETHHS      D   SK+
Sbjct  58   NLSFETHHSASNLPNDTGSSKI  79



>ref|XP_008656343.1| PREDICTED: probable methyltransferase PMT2 [Zea mays]
Length=613

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA  +T  D+RTR+++ + ++ GLC FFYLLG WQ+SG G GD I   V + +K C  LP
Sbjct  1    MARNLT--DNRTRNTLVMIVIFGLCSFFYLLGVWQKSGSGGGDGIQTWVNEQTK-CAQLP  57

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +L+FETHHS      D   SK+
Sbjct  58   NLSFETHHSASNLLNDTDNSKI  79



>ref|XP_010481446.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=618

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = +1

Query  166  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCN---ILPSLNFE  336
            ++ TR+  ++ IV GLCCFFYLLG+WQRSGFGKG  I +EVTK  +  N   I+  L+FE
Sbjct  10   NNSTRTLFTLIIVIGLCCFFYLLGSWQRSGFGKGRGIVMEVTKQEQCTNVTDIVTKLDFE  69

Query  337  THH  345
             HH
Sbjct  70   PHH  72



>ref|XP_004979626.1| PREDICTED: probable methyltransferase PMT2-like [Setaria italica]
Length=626

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTK--TSKDCNI  315
            MANK +SG    RS +S+ +   LCCFFY+LGAWQRSG+GKGDSIA  V +         
Sbjct  1    MANKGSSG---ARSPLSLVVAMALCCFFYVLGAWQRSGYGKGDSIAAAVNRQAACGGDAA  57

Query  316  LPSLNFETHHSGRAGSIDESES  381
               L+FETH SG A +ID + S
Sbjct  58   AAGLSFETHRSGDA-AIDTNAS  78



>ref|XP_002467784.1| hypothetical protein SORBIDRAFT_01g034010 [Sorghum bicolor]
 gb|EER94782.1| hypothetical protein SORBIDRAFT_01g034010 [Sorghum bicolor]
Length=610

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            MA  +T  ++RTR+++ + ++ GLC FFYLLGAWQ+SG G GD     V +  K C  LP
Sbjct  1    MARNLT--ENRTRNTLIVIVILGLCSFFYLLGAWQKSGSGGGDKTHQWVIEQMK-CAQLP  57

Query  322  SLNFETHHSGRAGSIDESESKV  387
            +L+FETHHS      D   SK+
Sbjct  58   NLSFETHHSASNLPNDTGSSKI  79



>ref|XP_010494834.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=621

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 3/63 (5%)
 Frame = +1

Query  166  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCN---ILPSLNFE  336
            ++ TR+  ++ IV GLCCFFYLLG+WQRSGFGKG  + +EV K  +  N   I+  L+FE
Sbjct  10   NNSTRTLFTLIIVIGLCCFFYLLGSWQRSGFGKGGGVVMEVAKQVQCTNVTHIVTKLDFE  69

Query  337  THH  345
             HH
Sbjct  70   PHH  72



>emb|CDY35169.1| BnaA09g18060D [Brassica napus]
Length=725

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDS-IALEVTKTSKDC---  309
            MA+   +     R+ +SI IV GLCCFFYLLGAWQR+GFGKG   I LE       C   
Sbjct  102  MASSKNTPPVNNRTRISITIVTGLCCFFYLLGAWQRNGFGKGGGVITLEAVTKQAQCTNT  161

Query  310  -NILPSLNFETHH  345
             +I+ +L+FE HH
Sbjct  162  TDIVANLDFEPHH  174



>emb|CDY03207.1| BnaC09g19490D [Brassica napus]
Length=622

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDS-IALEVTKTSKDC---  309
            MA+   +     R+ +SI IV GLCCFFYLLGAWQR+GFGKG   I LE       C   
Sbjct  3    MASSKNTPPVNNRTRISITIVTGLCCFFYLLGAWQRNGFGKGGGVITLEAVTKQAQCTNT  62

Query  310  -NILPSLNFETHH  345
             +I+ +L+FE HH
Sbjct  63   TDIVTNLDFEPHH  75



>ref|XP_009114343.1| PREDICTED: probable methyltransferase PMT14 [Brassica rapa]
Length=624

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDS-IALEVTKTSKDC---  309
            MA+   +     R+ +SI IV GLCCFFYLLGAWQR+GFGKG   I LE       C   
Sbjct  3    MASSKNTPPVNNRTRISITIVTGLCCFFYLLGAWQRNGFGKGGGVITLEAVTKQAQCTNT  62

Query  310  -NILPSLNFETHH  345
             +I+ +L+FE HH
Sbjct  63   TDIVTNLDFEPHH  75



>gb|KHN29896.1| Putative methyltransferase PMT2 [Glycine soja]
Length=308

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  321
            M +K  +   R R  +SIF V  L CFFYLLGAWQ +G GKGD++ L+V     D  +LP
Sbjct  1    MGSKTNASSYRGRRPLSIFSVLSLRCFFYLLGAWQGNGSGKGDNLTLKVNNLMTDRTVLP  60

Query  322  SLNFETHHS  348
            +L+FE+H S
Sbjct  61   NLSFESHGS  69



>gb|EMS59423.1| putative methyltransferase PMT2 [Triticum urartu]
Length=659

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIAL  282
            MA K  SG+ + RS + + I   LCCFFY+LGAWQRSG+GKGD IA+
Sbjct  1    MAIKDNSGEYKARSPLGMVIAVLLCCFFYVLGAWQRSGYGKGDRIAV  47



>gb|AAL86466.1|AC077693_5 hypothetical protein [Oryza sativa Japonica Group]
Length=686

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 1/38 (3%)
 Frame = +1

Query  235  GAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHHS  348
            GAWQ+SG G+GDSIAL VTK + DC ILP+L+FETHHS
Sbjct  114  GAWQKSGTGRGDSIALRVTKET-DCTILPNLHFETHHS  150



>gb|EMT22020.1| hypothetical protein F775_42781 [Aegilops tauschii]
Length=558

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  142  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKG  267
            MA K  SG+ + RS + + I   LCCFFY+LGAWQRSG+GKG
Sbjct  1    MAIKGNSGEYKARSPLGMVIAVLLCCFFYVLGAWQRSGYGKG  42



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563429479010