BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF011L04

Length=312
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004243582.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    137   4e-36   
ref|XP_006357655.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    134   3e-35   
ref|XP_009761997.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    133   5e-35   Nicotiana sylvestris
ref|XP_009761996.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    133   7e-35   Nicotiana sylvestris
gb|ABC74567.1|  acetoacetyl-CoA thiolase                                134   7e-35   Picrorhiza kurrooa
ref|XP_009761989.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    133   1e-34   Nicotiana sylvestris
ref|XP_009590926.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    133   1e-34   Nicotiana tomentosiformis
ref|XP_006353096.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    131   4e-34   Solanum tuberosum [potatoes]
gb|KDP29950.1|  hypothetical protein JCGZ_18519                         131   7e-34   Jatropha curcas
dbj|BAF98276.1|  acetyl-CoA C-acetyltransferase                         130   1e-33   Hevea brasiliensis [jebe]
ref|XP_009759542.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    130   1e-33   Nicotiana sylvestris
ref|XP_004491616.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    130   1e-33   Cicer arietinum [garbanzo]
gb|KDO50952.1|  hypothetical protein CISIN_1g0154952mg                  127   2e-33   Citrus sinensis [apfelsine]
ref|XP_004139514.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    130   2e-33   Cucumis sativus [cucumbers]
ref|XP_010547202.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    130   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_004491615.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    130   2e-33   
gb|KGN64993.1|  hypothetical protein Csa_1G173130                       130   2e-33   Cucumis sativus [cucumbers]
ref|XP_004239258.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    129   3e-33   
gb|AEC13714.1|  acetoacetyl-CoA thiolase                                128   6e-33   Catharanthus roseus [chatas]
ref|XP_003545555.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    128   6e-33   Glycine max [soybeans]
ref|XP_003519682.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    128   6e-33   Glycine max [soybeans]
ref|XP_010252788.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    128   6e-33   Nelumbo nucifera [Indian lotus]
gb|EYU42778.1|  hypothetical protein MIMGU_mgv1a007511mg                128   6e-33   Erythranthe guttata [common monkey flower]
gb|EYU42777.1|  hypothetical protein MIMGU_mgv1a007511mg                128   7e-33   Erythranthe guttata [common monkey flower]
ref|XP_002265690.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    128   8e-33   Vitis vinifera
gb|ABV08820.1|  acetoacetyl-coenzyme A thiolase                         128   9e-33   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006447819.1|  hypothetical protein CICLE_v10015452mg             128   9e-33   Citrus clementina [clementine]
ref|XP_006469436.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    128   9e-33   Citrus sinensis [apfelsine]
gb|KDP35512.1|  hypothetical protein JCGZ_08950                         128   9e-33   Jatropha curcas
ref|XP_008365553.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    128   1e-32   
ref|XP_009361536.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    127   1e-32   Pyrus x bretschneideri [bai li]
gb|AIK21787.1|  acetyl-CoA C-acetyltransferase                          127   1e-32   Panax notoginseng [san-qi]
gb|ADX07532.1|  acetyl-CoA C-acetyltransferase                          119   2e-32   Bacopa monnieri
gb|AFI23434.1|  thiolase II                                             127   2e-32   Betula platyphylla [Asian white birch]
emb|CDY05692.1|  BnaC02g38450D                                          123   3e-32   
ref|XP_004159110.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    127   3e-32   
ref|XP_010497269.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    121   3e-32   
gb|KCW58126.1|  hypothetical protein EUGRSUZ_H00849                     126   3e-32   Eucalyptus grandis [rose gum]
gb|AGH32909.1|  acetyl-CoA C-acetyltransferase                          126   3e-32   Camellia chekiangoleosa
ref|XP_010069705.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    126   3e-32   Eucalyptus grandis [rose gum]
ref|XP_008464274.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    126   4e-32   
ref|XP_011100512.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    126   4e-32   Sesamum indicum [beniseed]
ref|XP_008464272.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    126   4e-32   
ref|XP_008464273.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    126   4e-32   
gb|KHN46894.1|  Acetyl-CoA acetyltransferase, cytosolic 1               126   5e-32   Glycine soja [wild soybean]
gb|ACU19591.1|  unknown                                                 126   5e-32   Glycine max [soybeans]
ref|XP_006395207.1|  hypothetical protein EUTSA_v10004340mg             126   5e-32   Eutrema salsugineum [saltwater cress]
emb|CDX86320.1|  BnaA06g30370D                                          126   6e-32   
ref|XP_007215468.1|  hypothetical protein PRUPE_ppa006513mg             125   6e-32   Prunus persica
gb|AAL18924.1|AF429383_1  acetyl Co-A acetyltransferase                 125   7e-32   Hevea brasiliensis [jebe]
ref|XP_008229933.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    125   7e-32   Prunus mume [ume]
gb|KJB42687.1|  hypothetical protein B456_007G165600                    125   7e-32   Gossypium raimondii
ref|XP_004293407.2|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    125   8e-32   Fragaria vesca subsp. vesca
gb|KHG30083.1|  Acetyl-CoA acetyltransferase, cytosolic 1 -like p...    125   8e-32   Gossypium arboreum [tree cotton]
gb|KJB42688.1|  hypothetical protein B456_007G165600                    125   8e-32   Gossypium raimondii
ref|XP_010689228.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    125   9e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009111830.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    125   9e-32   Brassica rapa
gb|ADD10719.1|  acetyl-CoA C-acetyltransferase protein                  125   9e-32   Camellia oleifera [abura-tsubaki]
emb|CDY48742.1|  BnaA02g30030D                                          125   1e-31   Brassica napus [oilseed rape]
gb|ACU87560.2|  acetyl-CoA C-acetyltransferase                          125   1e-31   Bacopa monnieri
emb|CDY19963.1|  BnaA09g02880D                                          125   1e-31   Brassica napus [oilseed rape]
ref|XP_009129715.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    125   1e-31   
gb|KJB42689.1|  hypothetical protein B456_007G165600                    125   1e-31   Gossypium raimondii
emb|CDY00071.1|  BnaC09g02300D                                          125   1e-31   
ref|XP_009151624.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    125   1e-31   Brassica rapa
gb|KJB42690.1|  hypothetical protein B456_007G165600                    125   1e-31   Gossypium raimondii
ref|NP_568694.2|  acetoacetyl-CoA thiolase 2                            125   1e-31   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA97003.1|  acetyl-CoA C-acetyltransferase                         125   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31312.1|  hypothetical protein AALP_AA6G096400                    124   1e-31   Arabis alpina [alpine rockcress]
ref|XP_010482068.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    124   2e-31   Camelina sativa [gold-of-pleasure]
gb|EPS67778.1|  hypothetical protein M569_06996                         124   2e-31   Genlisea aurea
ref|XP_009129716.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    124   2e-31   Brassica rapa
ref|XP_010481278.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    124   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010481277.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    124   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_007211795.1|  hypothetical protein PRUPE_ppa006371mg             124   2e-31   Prunus persica
gb|EYU27653.1|  hypothetical protein MIMGU_mgv1a007243mg                124   2e-31   Erythranthe guttata [common monkey flower]
emb|CDX85319.1|  BnaC07g26300D                                          124   2e-31   
emb|CDP04540.1|  unnamed protein product                                124   3e-31   Coffea canephora [robusta coffee]
gb|AAL18928.1|AF429387_1  truncated acetyl Co-A acetyltransferase...    120   3e-31   Hevea brasiliensis [jebe]
ref|XP_002532204.1|  acetyl-CoA acetyltransferase, mitochondrial,...    120   3e-31   
ref|XP_007049379.1|  Acetoacetyl-CoA thiolase 2 isoform 2               124   3e-31   
ref|XP_007049378.1|  Acetoacetyl-CoA thiolase 2 isoform 1               124   4e-31   Theobroma cacao [chocolate]
gb|AEM42969.1|  acetyl-CoA C-acetyltransferase                          123   4e-31   Siraitia grosvenorii [arhat fruit]
emb|CDP18953.1|  unnamed protein product                                123   4e-31   Coffea canephora [robusta coffee]
ref|XP_006280568.1|  hypothetical protein CARUB_v10026521mg             123   4e-31   Capsella rubella
ref|XP_010442239.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    123   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_002320528.1|  truncated acetyl Co-A acetyltransferase-like...    123   5e-31   
ref|XP_008462041.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    123   5e-31   Cucumis melo [Oriental melon]
gb|ACX47470.1|  acetoacetyl-CoA thiolase                                122   7e-31   Medicago sativa [alfalfa]
gb|ACX46381.1|  acetoacetyl-CoA thiolase                                123   7e-31   Helianthus annuus
ref|XP_008224638.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    122   7e-31   Prunus mume [ume]
ref|XP_003580738.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    122   8e-31   Brachypodium distachyon [annual false brome]
ref|XP_002865618.1|  acetoacetyl-CoA thiolase 2, embryo defective...    122   8e-31   
ref|XP_009608453.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    122   1e-30   Nicotiana tomentosiformis
gb|AAU95619.1|  peroxisomal acetoacetyl-coenzyme A thiolase             122   1e-30   Nicotiana tabacum [American tobacco]
ref|XP_007142529.1|  hypothetical protein PHAVU_008G288400g             122   1e-30   Phaseolus vulgaris [French bean]
ref|XP_004144550.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    122   1e-30   Cucumis sativus [cucumbers]
ref|XP_009787709.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    122   1e-30   Nicotiana sylvestris
gb|KEH15899.1|  peroxisomal acetoacetyl-coenzyme A thiolase             121   1e-30   Medicago truncatula
ref|XP_010495012.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    122   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010495013.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    122   1e-30   
ref|XP_004303573.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    122   1e-30   Fragaria vesca subsp. vesca
ref|XP_011002352.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    122   2e-30   Populus euphratica
ref|XP_002308755.1|  truncated acetyl Co-A acetyltransferase-like...    122   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006398472.1|  hypothetical protein EUTSA_v10000897mg             122   2e-30   
ref|XP_011002351.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    122   2e-30   Populus euphratica
ref|XP_011085410.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    121   2e-30   Sesamum indicum [beniseed]
ref|XP_010267979.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    121   2e-30   Nelumbo nucifera [Indian lotus]
gb|KDO78589.1|  hypothetical protein CISIN_1g015003mg                   120   2e-30   Citrus sinensis [apfelsine]
ref|XP_006398474.1|  hypothetical protein EUTSA_v10000897mg             121   2e-30   
ref|NP_001062685.1|  Os09g0252100                                       121   2e-30   
ref|XP_002522876.1|  acetyl-CoA acetyltransferase, mitochondrial,...    121   2e-30   Ricinus communis
ref|XP_010267976.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    121   2e-30   Nelumbo nucifera [Indian lotus]
gb|EMT20974.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      121   2e-30   
ref|XP_004977186.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    121   3e-30   Setaria italica
gb|ACJ84564.1|  unknown                                                 121   3e-30   Medicago truncatula
ref|XP_003618039.1|  Acetyl-CoA acetyltransferase, cytosolic            121   3e-30   Medicago truncatula
ref|XP_006398473.1|  hypothetical protein EUTSA_v10000897mg             121   3e-30   
gb|AFK39138.1|  unknown                                                 121   3e-30   Medicago truncatula
ref|XP_011008068.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    121   3e-30   Populus euphratica
dbj|BAD22334.1|  putative acetyl-CoA C-acyltransferase                  121   3e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010493636.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    121   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006857772.1|  hypothetical protein AMTR_s00061p00203040          121   3e-30   
ref|XP_006660462.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    121   3e-30   Oryza brachyantha
ref|XP_004969865.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    121   3e-30   Setaria italica
ref|XP_011095902.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    121   3e-30   Sesamum indicum [beniseed]
ref|XP_010538441.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    120   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_006449942.1|  hypothetical protein CICLE_v10015403mg             121   3e-30   
ref|XP_010538440.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    120   4e-30   Tarenaya hassleriana [spider flower]
ref|XP_006449941.1|  hypothetical protein CICLE_v10015403mg             120   4e-30   Citrus clementina [clementine]
ref|XP_011095903.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    120   4e-30   Sesamum indicum [beniseed]
gb|KDO78587.1|  hypothetical protein CISIN_1g015003mg                   120   4e-30   Citrus sinensis [apfelsine]
ref|XP_006467262.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    120   4e-30   Citrus sinensis [apfelsine]
ref|XP_006449940.1|  hypothetical protein CICLE_v10015403mg             120   4e-30   Citrus clementina [clementine]
gb|KDO78588.1|  hypothetical protein CISIN_1g015003mg                   120   4e-30   Citrus sinensis [apfelsine]
ref|XP_006279490.1|  hypothetical protein CARUB_v10026490mg             120   4e-30   Capsella rubella
dbj|BAF98277.1|  acetyl-CoA C-acetyltransferase                         120   5e-30   Hevea brasiliensis [jebe]
tpg|DAA47710.1|  TPA: hypothetical protein ZEAMMB73_220204              120   7e-30   
ref|XP_008342241.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    120   7e-30   
ref|NP_001266315.1|  acetyl-CoA acetyltransferase, cytosolic 1          120   8e-30   
gb|ACF85124.1|  unknown                                                 120   8e-30   Zea mays [maize]
ref|XP_004507588.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    119   9e-30   Cicer arietinum [garbanzo]
gb|AEI27246.1|  putative acetyl-CoA-C-acetyltransferase                 119   1e-29   Vanda hybrid cultivar
ref|XP_004507587.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    119   1e-29   
ref|XP_010647164.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    119   1e-29   Vitis vinifera
ref|XP_010647165.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    119   1e-29   Vitis vinifera
ref|XP_002865105.1|  hypothetical protein ARALYDRAFT_494196             119   1e-29   
ref|XP_003635396.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    119   1e-29   Vitis vinifera
ref|XP_010647163.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    119   1e-29   Vitis vinifera
ref|XP_006350251.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    119   1e-29   Solanum tuberosum [potatoes]
ref|XP_006600286.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    119   2e-29   
ref|XP_006600285.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    119   2e-29   Glycine max [soybeans]
ref|XP_004236650.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    119   2e-29   Solanum lycopersicum
gb|AFI57868.1|  acetoacetyl-CoA thiolase                                117   2e-29   Elaeis guineensis
gb|ABD57973.1|  acetoacetyl-coenzyme A thiolase                         119   2e-29   Arnebia euchroma
gb|ACU18264.1|  unknown                                                 115   2e-29   Glycine max [soybeans]
gb|ABM66459.1|  acetyl CoA C-acetyltranseferase                         114   3e-29   Brassica juncea [brown mustard]
ref|XP_010675964.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    118   4e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008782420.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    117   7e-29   Phoenix dactylifera
gb|ACU15722.1|  unknown                                                 113   8e-29   Glycine max [soybeans]
ref|NP_199583.1|  acetoacetyl-CoA thiolase 1                            117   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936771.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    117   1e-28   Elaeis guineensis
ref|NP_851150.1|  acetoacetyl-CoA thiolase 1                            117   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010039422.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    117   1e-28   Eucalyptus grandis [rose gum]
gb|KEH32696.1|  peroxisomal acetoacetyl-coenzyme A thiolase             115   1e-28   Medicago truncatula
gb|AEZ55671.1|  acetyl-CoA C-acetyltransferase 2                        116   1e-28   Salvia miltiorrhiza [Chinese salvia]
ref|XP_008384190.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    116   2e-28   Malus domestica [apple tree]
ref|XP_008384188.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    116   2e-28   Malus domestica [apple tree]
ref|XP_009396114.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    115   2e-28   
ref|XP_003637597.1|  Acetyl-CoA acetyltransferase cytosolic             115   2e-28   
ref|XP_009374846.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    115   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_009374845.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    115   3e-28   Pyrus x bretschneideri [bai li]
ref|NP_851154.1|  acetoacetyl-CoA thiolase 2                            115   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003565785.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    115   3e-28   Brachypodium distachyon [annual false brome]
ref|XP_008811276.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    115   3e-28   Phoenix dactylifera
ref|XP_007026385.1|  Thiolase family protein isoform 1                  115   4e-28   
ref|NP_001148667.1|  acetyl-CoA acetyltransferase, cytosolic 1          115   4e-28   Zea mays [maize]
ref|XP_009412114.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    115   5e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412128.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    114   5e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942603.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    114   6e-28   Elaeis guineensis
ref|XP_003551110.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    114   6e-28   Glycine max [soybeans]
ref|XP_010087672.1|  putative acetyl-CoA acetyltransferase, cytos...    114   1e-27   
ref|XP_009399870.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    114   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399886.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    113   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001141874.1|  acetyl-CoA acetyltransferase, cytosolic 2 is...    113   2e-27   Zea mays [maize]
ref|XP_003529679.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    113   2e-27   
ref|XP_004967971.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    113   2e-27   Setaria italica
ref|XP_004967970.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    113   2e-27   Setaria italica
ref|XP_010088359.1|  Acetyl-CoA acetyltransferase, cytosolic 1          113   2e-27   
ref|XP_006584106.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    113   2e-27   Glycine max [soybeans]
ref|XP_008654616.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    113   2e-27   
ref|XP_010092017.1|  putative acetyl-CoA acetyltransferase, cytos...    113   2e-27   
gb|KHN42262.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      113   2e-27   Glycine soja [wild soybean]
ref|XP_008654615.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    113   3e-27   Zea mays [maize]
gb|KEH32695.1|  peroxisomal acetoacetyl-coenzyme A thiolase             112   4e-27   Medicago truncatula
gb|AHZ96597.1|  acetyl-CoA C-acetyl transferase                         112   5e-27   Aquilaria sinensis
dbj|BAH57117.1|  AT5G47720                                              111   7e-27   Arabidopsis thaliana [mouse-ear cress]
gb|EEC69797.1|  hypothetical protein OsI_00091                          111   9e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001041797.1|  Os01g0110400                                       111   9e-27   
emb|CDM80037.1|  unnamed protein product                                111   1e-26   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001032028.1|  acetoacetyl-CoA thiolase 1                         111   1e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25950.1|  BnaC09g20370D                                          111   1e-26   Brassica napus [oilseed rape]
gb|KHN03551.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      111   1e-26   Glycine soja [wild soybean]
ref|XP_002968816.1|  hypothetical protein SELMODRAFT_146037             110   2e-26   Selaginella moellendorffii
gb|EMS66391.1|  putative acetyl-CoA acetyltransferase, cytosolic 2      111   2e-26   Triticum urartu
ref|XP_002974156.1|  hypothetical protein SELMODRAFT_173909             110   2e-26   
gb|EMT15552.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      110   2e-26   
ref|XP_009114253.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    108   1e-25   
ref|XP_009114255.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    108   1e-25   Brassica rapa
gb|ACN40771.1|  unknown                                                 106   5e-25   Picea sitchensis
emb|CAA55006.1|  Acetoacetyl-coenzyme A thiolase                        105   1e-24   Raphanus sativus
gb|ACN41149.1|  unknown                                                 103   9e-24   Picea sitchensis
gb|EPS62555.1|  hypothetical protein M569_12233                       99.8    1e-22   Genlisea aurea
ref|XP_001773218.1|  predicted protein                                96.7    2e-21   
ref|WP_020082106.1|  acetyl-CoA acetyltransferase                     95.9    3e-21   
ref|XP_003618040.1|  Acetyl-CoA acetyltransferase, cytosolic          94.4    1e-20   
ref|XP_007154060.1|  hypothetical protein PHAVU_003G087600g           94.0    2e-20   Phaseolus vulgaris [French bean]
ref|XP_010441408.1|  PREDICTED: probable acetyl-CoA acetyltransfe...  93.6    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010441409.1|  PREDICTED: probable acetyl-CoA acetyltransfe...  93.2    3e-20   Camelina sativa [gold-of-pleasure]
gb|KJB68526.1|  hypothetical protein B456_010G248300                  92.4    6e-20   Gossypium raimondii
gb|KJB68525.1|  hypothetical protein B456_010G248300                  92.0    6e-20   Gossypium raimondii
gb|KHG07894.1|  hypothetical protein F383_03812                       92.4    7e-20   Gossypium arboreum [tree cotton]
gb|KJB68524.1|  hypothetical protein B456_010G248300                  92.4    7e-20   Gossypium raimondii
gb|KJB68523.1|  hypothetical protein B456_010G248300                  92.4    8e-20   Gossypium raimondii
gb|ESA20734.1|  hypothetical protein GLOINDRAFT_43599                 90.1    2e-19   
gb|EXX68470.1|  acetyl-CoA C-acetyltransferase                        91.3    2e-19   Rhizophagus irregularis DAOM 197198w
gb|KGN43403.1|  hypothetical protein Csa_7G031640                     90.1    3e-19   Cucumis sativus [cucumbers]
ref|WP_026777333.1|  acetyl-CoA acetyltransferase                     89.7    6e-19   Polaribacter sp. Hel_I_88
ref|WP_004570201.1|  acetyl-CoA acetyltransferase                     89.7    6e-19   Polaribacter irgensii
gb|EAQ42003.1|  acetyl-CoA acetyltransferase                          89.4    1e-18   Polaribacter sp. MED152
ref|WP_041383877.1|  acetyl-CoA acetyltransferase                     89.0    1e-18   Polaribacter sp. MED152
ref|XP_008811278.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...  88.6    1e-18   
ref|WP_036784849.1|  acetyl-CoA acetyltransferase                     88.6    1e-18   Polaribacter
ref|WP_027391341.1|  acetyl-CoA acetyltransferase                     88.6    1e-18   Aquimarina
ref|XP_001619139.1|  hypothetical protein NEMVEDRAFT_v1g46486         86.3    2e-18   Nematostella vectensis
ref|WP_028298670.1|  acetyl-CoA acetyltransferase                     87.4    5e-18   Olivibacter sitiensis
ref|WP_036822109.1|  acetyl-CoA acetyltransferase                     87.0    6e-18   Polaribacter sp. Hel1_85
ref|WP_013688178.1|  acetyl-CoA acetyltransferase                     86.7    7e-18   Fluviicola taffensis
ref|XP_009412135.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...  86.7    7e-18   
ref|WP_027378013.1|  acetyl-CoA acetyltransferase                     86.7    8e-18   Chryseobacterium palustre
gb|EHK39793.1|  putative acetyl-CoA acetyltransferase                 86.3    1e-17   Trichoderma atroviride IMI 206040
ref|WP_028890799.1|  acetyl-CoA acetyltransferase                     86.3    1e-17   Tenacibaculum sp. 47A_GOM-205m
ref|WP_039347783.1|  acetyl-CoA acetyltransferase                     85.9    1e-17   Chryseobacterium jeonii
ref|WP_026812948.1|  acetyl-CoA acetyltransferase                     85.9    2e-17   Arenibacter certesii
ref|WP_028887593.1|  acetyl-CoA acetyltransferase                     85.9    2e-17   Tenacibaculum ovolyticum
gb|EPB83074.1|  acetyl-CoA C-acetyltransferase                        85.9    2e-17   Mucor circinelloides f. circinelloides 1006PhL
gb|EPX71259.1|  acetyl-CoA C-acetyltransferase Erg10                  85.9    2e-17   Schizosaccharomyces octosporus yFS286
ref|WP_024740986.1|  acetyl-CoA acetyltransferase                     85.5    2e-17   
ref|NP_596686.1|  acetyl-CoA C-acetyltransferase Erg10 (predicted)    85.1    3e-17   Schizosaccharomyces pombe
dbj|BAA13846.1|  unnamed protein product                              85.1    3e-17   Schizosaccharomyces pombe
ref|WP_034974590.1|  acetyl-CoA acetyltransferase                     85.1    3e-17   Chryseobacterium halperniae
ref|WP_011709392.1|  acetyl-CoA acetyltransferase                     85.1    3e-17   Gramella forsetii
ref|WP_027419593.1|  acetyl-CoA acetyltransferase                     84.7    4e-17   Crocinitomix catalasitica
ref|WP_028122868.1|  acetyl-CoA acetyltransferase                     84.7    4e-17   Chryseobacterium tenax
ref|WP_042279346.1|  acetyl-CoA acetyltransferase                     84.7    4e-17   Nonlabens sediminis
gb|EMT07958.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2    84.7    6e-17   
ref|WP_019387161.1|  acetyl-CoA acetyltransferase                     84.0    7e-17   Arenitalea lutea
ref|WP_002663851.1|  acetyl-CoA acetyltransferase                     84.0    7e-17   Bergeyella zoohelcum
ref|WP_017843017.1|  hypothetical protein                             84.0    9e-17   
ref|WP_039372367.1|  acetyl-CoA acetyltransferase                     83.6    1e-16   Chryseobacterium taiwanense
ref|WP_027381559.1|  acetyl-CoA acetyltransferase                     83.6    1e-16   Chryseobacterium daeguense
ref|WP_027382585.1|  acetyl-CoA acetyltransferase                     83.6    1e-16   Chryseobacterium caeni
ref|XP_008725301.1|  hypothetical protein G647_02733                  84.0    1e-16   Cladophialophora carrionii CBS 160.54
gb|KIW03890.1|  hypothetical protein PV09_04735                       83.6    1e-16   Verruconis gallopava
ref|WP_002697210.1|  acetyl-CoA acetyltransferase                     84.0    1e-16   Microscilla marina
ref|WP_019039328.1|  acetyl-CoA acetyltransferase                     83.6    1e-16   Psychroflexus tropicus
ref|WP_026916136.1|  acetyl-CoA acetyltransferase                     83.6    1e-16   Gramella portivictoriae
ref|XP_007677374.1|  hypothetical protein BAUCODRAFT_34953            83.6    1e-16   Baudoinia panamericana UAMH 10762
ref|WP_034044886.1|  acetyl-CoA acetyltransferase                     83.6    1e-16   Flaviramulus ichthyoenteri
ref|WP_029293462.1|  acetyl-CoA acetyltransferase                     83.2    1e-16   Chryseobacterium hispalense
gb|EPY53539.1|  acetyl-CoA C-acetyltransferase Erg10                  83.2    1e-16   Schizosaccharomyces cryophilus OY26
ref|WP_034258137.1|  acetyl-CoA acetyltransferase                     83.2    1e-16   Altibacter lentus
ref|XP_001220611.1|  hypothetical protein CHGG_01390                  83.2    1e-16   Chaetomium globosum CBS 148.51
emb|CCO27308.1|  acetyl-CoA C-acetyltransferase                       80.5    1e-16   Rhizoctonia solani AG-1 IB
gb|KEY68336.1|  hypothetical protein S7711_01115                      83.2    2e-16   Stachybotrys chartarum IBT 7711
ref|WP_015363227.1|  acetoacetyl-CoA thiolase                         83.2    2e-16   Nonlabens dokdonensis
ref|WP_034892482.1|  acetyl-CoA acetyltransferase                     83.2    2e-16   Gillisia sp. Hel_I_29
ref|XP_008551732.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  83.2    2e-16   
ref|XP_011401582.1|  putative acetyl-CoA acetyltransferase, cytos...  83.6    2e-16   Auxenochlorella protothecoides
ref|WP_029414831.1|  acetyl-CoA acetyltransferase                     82.8    2e-16   
ref|WP_011985817.1|  acetyl-CoA acetyltransferase                     82.8    2e-16   
ref|XP_002171694.1|  acetyl-CoA C-acetyltransferase Erg10             82.8    2e-16   
ref|XP_007759544.1|  acetyl-CoA C-acetyltransferase                   82.8    3e-16   
ref|WP_034968706.1|  acetyl-CoA acetyltransferase                     82.4    3e-16   
gb|KFA60838.1|  hypothetical protein S40285_06173                     82.4    3e-16   
ref|XP_003054621.1|  predicted protein                                82.4    3e-16   
ref|WP_026810850.1|  acetyl-CoA acetyltransferase                     82.4    3e-16   
ref|WP_008238601.1|  acetyl-CoA acetyltransferase                     82.0    4e-16   
ref|WP_002665020.1|  acetyl-CoA acetyltransferase                     82.0    4e-16   
ref|XP_011498265.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  82.0    4e-16   
gb|ABA27006.1|  TO50-2rc                                              77.8    4e-16   
gb|KIX01474.1|  hypothetical protein Z518_09200                       82.4    4e-16   
ref|WP_013752222.1|  acetyl-CoA acetyltransferase                     82.0    4e-16   
ref|XP_007737475.1|  acetyl-CoA C-acetyltransferase                   82.4    4e-16   
ref|WP_015349686.1|  acetyl-CoA acetyltransferase                     82.0    4e-16   
gb|KEQ76920.1|  acetyl-CoA acetyltransferase IB                       82.0    4e-16   
ref|XP_007914536.1|  putative acetyl- acetyltransferase protein       82.0    4e-16   
gb|AID51434.1|  acetoacetyl-coenzyme A thiolase                       81.6    5e-16   
emb|CEG70625.1|  Putative Acetyl-CoA C-acetyltransferase              81.6    5e-16   
gb|EMD94321.1|  hypothetical protein COCHEDRAFT_1192441               81.6    6e-16   
gb|EIE90233.1|  hypothetical protein RO3G_14944                       81.6    6e-16   
ref|WP_037438375.1|  acetyl-CoA acetyltransferase                     81.6    6e-16   
gb|EUN23234.1|  hypothetical protein COCVIDRAFT_109321                81.6    6e-16   
ref|WP_007846683.1|  MULTISPECIES: acetyl-CoA acetyltransferase       81.6    6e-16   
ref|XP_007689032.1|  hypothetical protein COCMIDRAFT_37719            81.6    6e-16   
ref|WP_034716040.1|  acetyl-CoA acetyltransferase                     81.6    6e-16   
ref|WP_027385494.1|  acetyl-CoA acetyltransferase                     81.6    6e-16   
gb|KEQ82191.1|  thiolase                                              81.6    7e-16   
ref|WP_031504331.1|  acetyl-CoA acetyltransferase                     81.6    7e-16   
ref|WP_005894076.1|  acetyl-CoA acetyltransferase                     80.1    7e-16   
ref|WP_012632869.1|  acetyl-CoA acetyltransferase                     81.3    7e-16   
ref|WP_003436677.1|  acetyl-CoA acetyltransferase                     81.3    7e-16   
ref|WP_011421417.1|  acetyl-CoA acetyltransferase                     81.3    7e-16   
ref|XP_007709670.1|  hypothetical protein COCCADRAFT_2853             81.3    7e-16   
ref|XP_007701100.1|  hypothetical protein COCSADRAFT_38201            81.3    7e-16   
gb|KFF74448.1|  acetyl-CoA acetyltransferase                          81.3    7e-16   
ref|WP_012525550.1|  acetyl-CoA acetyltransferase                     81.3    7e-16   
ref|XP_011156240.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  79.0    8e-16   
ref|WP_008612817.1|  acetyl-CoA acetyltransferase                     81.3    8e-16   
ref|WP_010227649.1|  acetyl-CoA acetyltransferase                     81.3    8e-16   
ref|WP_018474789.1|  acetyl-CoA acetyltransferase                     81.3    9e-16   
ref|WP_028873447.1|  acetyl-CoA acetyltransferase                     81.3    9e-16   
ref|WP_039344220.1|  acetyl-CoA acetyltransferase                     81.3    9e-16   
gb|KIW51366.1|  hypothetical protein PV05_10096                       81.3    9e-16   
gb|ABW74130.1|  acetyl coA acetyl transferase                         79.7    1e-15   
gb|EFZ20262.1|  hypothetical protein SINV_14231                       79.0    1e-15   
ref|WP_034711398.1|  acetyl-CoA acetyltransferase                     80.9    1e-15   
ref|XP_001607694.2|  PREDICTED: acetyl-CoA acetyltransferase, mit...  81.3    1e-15   
gb|KIW65562.1|  hypothetical protein PV04_07812                       81.3    1e-15   
ref|WP_026934443.1|  acetyl-CoA acetyltransferase                     80.9    1e-15   
ref|WP_013072016.1|  acetyl-CoA acetyltransferase                     80.9    1e-15   
ref|WP_029034877.1|  acetyl-CoA acetyltransferase                     80.9    1e-15   
ref|WP_035337039.1|  acetyl-CoA acetyltransferase                     80.9    1e-15   
emb|CDS14271.1|  Putative Acetyl-CoA C-acetyltransferase              80.9    1e-15   
ref|WP_027883870.1|  acetyl-CoA acetyltransferase                     80.5    1e-15   
ref|WP_036171230.1|  acetyl-CoA acetyltransferase                     80.9    1e-15   
ref|WP_014397003.1|  acetyl-CoA acetyltransferase                     80.5    1e-15   
gb|EKN47019.1|  acetyl-CoA acetyltransferase                          77.8    1e-15   
ref|WP_042723301.1|  acetyl-CoA acetyltransferase                     80.5    1e-15   
ref|WP_034685179.1|  acetyl-CoA acetyltransferase                     80.5    2e-15   
ref|WP_025663617.1|  acetyl-CoA acetyltransferase                     80.5    2e-15   
ref|WP_027067692.1|  acetyl-CoA acetyltransferase                     80.5    2e-15   
gb|KFP55180.1|  hypothetical protein N322_03776                       79.0    2e-15   
ref|WP_043067554.1|  acetyl-CoA acetyltransferase                     80.5    2e-15   
ref|XP_001938292.1|  acetyl-CoA acetyltransferase IB                  80.5    2e-15   
ref|XP_008604730.1|  acetyl-CoA C-acetyltransferase                   80.5    2e-15   
ref|XP_003301654.1|  hypothetical protein PTT_13196                   80.5    2e-15   
ref|WP_013270633.1|  acetyl-CoA acetyltransferase                     80.1    2e-15   
ref|WP_014783533.1|  acetyl-CoA acetyltransferase                     80.1    2e-15   
gb|KEQ65331.1|  thiolase                                              80.5    2e-15   
ref|WP_042248191.1|  acetyl-CoA acetyltransferase                     80.1    2e-15   
ref|WP_006987456.1|  acetyl-CoA acetyltransferase                     80.1    2e-15   
gb|KDO35408.1|  hypothetical protein SPRG_00258                       80.5    2e-15   
ref|XP_001908558.1|  hypothetical protein                             80.1    2e-15   
ref|XP_009707658.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  78.6    2e-15   
gb|KFH73378.1|  acetyl-CoA C-acetyltransferase                        80.1    2e-15   
ref|WP_010522422.1|  acetyl-CoA acetyltransferase                     80.1    2e-15   
emb|CCH01373.1|  acetyl-CoA acetyltransferase                         80.5    2e-15   
ref|XP_006695822.1|  acetyl-CoA acetyltransferase-like protein        80.1    2e-15   
ref|WP_034917416.1|  acetyl-CoA acetyltransferase                     80.1    2e-15   
ref|WP_041497179.1|  acetyl-CoA acetyltransferase                     80.1    2e-15   
ref|WP_024691183.1|  acetyl-CoA acetyltransferase                     80.1    2e-15   
ref|WP_026838433.1|  acetyl-CoA acetyltransferase                     80.1    2e-15   
ref|WP_043541302.1|  acetyl-CoA acetyltransferase                     80.1    2e-15   
ref|WP_034675913.1|  acetyl-CoA acetyltransferase                     80.1    2e-15   
ref|WP_026994755.1|  acetyl-CoA acetyltransferase                     79.7    3e-15   
ref|WP_024669381.1|  acetyl-CoA acetyltransferase                     80.1    3e-15   
gb|EDM44119.1|  acetyl-CoA acetyltransferase                          79.7    3e-15   
ref|WP_012239713.1|  acetyl-CoA acetyltransferase                     79.7    3e-15   
gb|KIW83871.1|  hypothetical protein Z517_03117                       80.1    3e-15   
ref|XP_005844265.1|  hypothetical protein CHLNCDRAFT_27161            79.7    3e-15   
gb|EPB89923.1|  acetyl-CoA C-acetyltransferase                        79.7    3e-15   
emb|CEL58121.1|  acetyl-CoA C-acetyltransferase                       80.5    3e-15   
ref|WP_029036843.1|  acetyl-CoA acetyltransferase                     79.7    3e-15   
ref|WP_015022798.1|  acetyl-CoA acetyltransferase                     79.7    3e-15   
ref|WP_028525776.1|  acetyl-CoA acetyltransferase                     79.7    3e-15   
ref|WP_024769215.1|  acetyl-CoA acetyltransferase                     79.7    3e-15   
ref|WP_038527996.1|  acetyl-CoA acetyltransferase                     79.7    3e-15   
ref|WP_028290392.1|  acetyl-CoA acetyltransferase                     79.7    3e-15   
ref|WP_014773656.1|  acetyl-CoA acetyltransferase                     79.7    3e-15   
gb|EFA78071.1|  acetyl-CoA C-acetyltransferase                        79.7    3e-15   
emb|CCG85020.1|  protein of unknown function                          79.7    3e-15   
dbj|GAD92647.1|  acetyl-CoA acetyltransferase, putative               79.7    3e-15   
ref|WP_028608122.1|  acetyl-CoA acetyltransferase                     79.7    3e-15   
ref|WP_025739829.1|  acetyl-CoA acetyltransferase                     79.7    3e-15   
ref|WP_017732195.1|  acetyl-CoA acetyltransferase                     79.7    3e-15   
ref|WP_013599011.1|  acetyl-CoA acetyltransferase                     79.7    3e-15   
ref|XP_001694888.1|  predicted protein                                79.7    3e-15   
gb|EGE01205.1|  acetyl-CoA acetyltransferase                          79.7    3e-15   
gb|KEQ98968.1|  hypothetical protein AUEXF2481DRAFT_45917             79.7    3e-15   
ref|WP_041258018.1|  acetyl-CoA acetyltransferase                     79.3    4e-15   
gb|EGD95948.1|  acetyl-CoA acetyltransferase                          79.7    4e-15   
emb|CCX30791.1|  Similar to Acetyl-CoA acetyltransferase; acc. no...  79.3    4e-15   
ref|WP_028282246.1|  acetyl-CoA acetyltransferase                     79.3    4e-15   
ref|XP_009160237.1|  acetyl-CoA C-acetyltransferase                   79.7    4e-15   
ref|XP_002959312.1|  hypothetical protein VOLCADRAFT_84843            77.4    4e-15   
ref|XP_003024790.1|  hypothetical protein TRV_01072                   79.3    4e-15   
gb|EZF35979.1|  hypothetical protein H101_00494                       79.3    4e-15   
ref|WP_007649376.1|  Acetyl-CoA acetyltransferase                     79.3    4e-15   
ref|WP_034697648.1|  acetyl-CoA acetyltransferase                     79.3    4e-15   
ref|XP_003237150.1|  acetyl-CoA acetyltransferase                     79.3    4e-15   
gb|EZG03697.1|  hypothetical protein H106_06361                       79.3    4e-15   
dbj|GAM82703.1|  hypothetical protein ANO11243_006870                 79.3    4e-15   
ref|XP_002844004.1|  acetyl-CoA acetyltransferase                     79.3    4e-15   
ref|XP_010151612.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  77.0    4e-15   
ref|XP_008330468.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  79.7    4e-15   
ref|WP_012247086.1|  acetyl-CoA acetyltransferase                     79.3    4e-15   
ref|XP_009834114.1|  hypothetical protein H257_09568                  79.3    4e-15   
ref|XP_002630504.1|  C. briggsae CBR-KAT-1 protein                    79.3    4e-15   
gb|KEZ42356.1|  Acetyl-CoA acetyltransferase                          79.3    5e-15   
gb|KEP55148.1|  3-ketoacyl-CoA-thiolase, peroxisomal protein          79.3    5e-15   
ref|WP_027372497.1|  MULTISPECIES: acetyl-CoA acetyltransferase       79.0    5e-15   
gb|EUC65369.1|  3-ketoacyl-CoA-thiolase, peroxisomal protein          79.3    5e-15   
ref|XP_003113781.1|  CRE-KAT-1 protein                                79.3    5e-15   
ref|XP_010727396.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  80.9    5e-15   
ref|WP_008623621.1|  Acetyl-CoA acetyltransferase                     79.0    5e-15   
gb|KHJ98630.1|  acetyl-CoA C-acetyltransferase                        79.3    5e-15   
ref|WP_026369433.1|  acetyl-CoA acetyltransferase                     79.0    5e-15   
gb|EPR68685.1|  Acetyl-CoA acetyltransferase                          77.4    5e-15   
ref|XP_009216982.1|  acetyl-CoA acetyltransferase                     79.0    5e-15   
ref|WP_025140008.1|  acetyl-CoA acetyltransferase                     79.0    6e-15   
gb|ELU43151.1|  3-ketoacyl-CoA-thiolase, peroxisomal                  79.0    6e-15   
ref|WP_013307633.1|  acetyl-CoA acetyltransferase                     79.0    6e-15   
gb|KIY03573.1|  hypothetical protein Z520_00264                       79.0    6e-15   
ref|WP_006392254.1|  acetyl-CoA acetyltransferase                     79.0    6e-15   
ref|WP_035679327.1|  acetyl-CoA acetyltransferase                     79.0    6e-15   
ref|WP_040136419.1|  acetyl-CoA acetyltransferase                     79.0    6e-15   
ref|WP_034237830.1|  acetyl-CoA acetyltransferase                     79.0    6e-15   
ref|WP_002979154.1|  acetyl-CoA acetyltransferase                     79.0    6e-15   
gb|KFV05818.1|  hypothetical protein N340_13307                       79.0    6e-15   
gb|KIW23519.1|  hypothetical protein PV07_11711                       79.0    7e-15   
ref|WP_019987186.1|  acetyl-CoA acetyltransferase                     78.6    7e-15   
ref|XP_009572413.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  75.5    7e-15   
gb|KIW97610.1|  hypothetical protein Z519_01194                       79.0    7e-15   
gb|KGL74467.1|  hypothetical protein N309_11091                       79.0    7e-15   
ref|WP_032130967.1|  acetyl-CoA acetyltransferase                     78.6    7e-15   
ref|WP_007657939.1|  acetyl-CoA acetyltransferase                     78.6    7e-15   
dbj|GAN11206.1|  hypothetical protein MAM1_0504c10765                 75.1    7e-15   
emb|CEI93812.1|  Putative Acetyl-CoA C-acyltransferase                79.0    7e-15   
gb|KIV77183.1|  hypothetical protein PV11_09005                       79.0    7e-15   
ref|XP_007748144.1|  acetyl-CoA C-acetyltransferase                   79.0    7e-15   
gb|ACU07416.1|  Acetyl-CoA acetyltransferase                          78.6    7e-15   
ref|XP_011057781.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  79.0    8e-15   
gb|KDE05692.1|  acetyl-CoA acetyltransferase                          79.0    8e-15   
gb|ETI54682.1|  hypothetical protein F443_02538                       79.0    8e-15   
gb|EGI63455.1|  Acetyl-CoA acetyltransferase, mitochondrial           79.0    8e-15   
gb|KFQ34297.1|  hypothetical protein N331_02629                       78.6    8e-15   
ref|WP_013621977.1|  MULTISPECIES: acetyl-CoA acetyltransferase       78.6    8e-15   
ref|XP_008943436.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  78.6    8e-15   
ref|WP_041252540.1|  acetyl-CoA acetyltransferase                     78.6    8e-15   
ref|XP_008899768.1|  hypothetical protein PPTG_07347                  79.0    8e-15   
gb|ESZ89704.1|  acetyl-CoA acetyltransferase                          78.6    8e-15   
gb|KFV85909.1|  hypothetical protein N308_03234                       78.6    8e-15   
ref|WP_002639618.1|  acetyl-CoA acetyltransferase                     78.6    8e-15   
gb|EPE10669.1|  acetyl- acetyltransferase                             78.6    8e-15   
gb|EER40753.1|  acetyl-CoA acetyltransferase                          78.6    8e-15   
gb|KIL93171.1|  hypothetical protein FAVG1_03148                      78.6    8e-15   
ref|XP_011328435.1|  acetyl-CoA acetyltransferase IB                  78.6    8e-15   
ref|XP_009261111.1|  hypothetical protein FPSE_09719                  78.6    8e-15   
ref|XP_007903814.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  79.0    8e-15   
emb|CEG79331.1|  Putative Acetyl-CoA C-acetyltransferase              78.6    8e-15   
ref|WP_042795769.1|  acetyl-CoA acetyltransferase                     78.6    8e-15   
dbj|GAN09574.1|  acetyl-CoA acetyltransferase                         78.6    9e-15   
ref|WP_031304708.1|  acetyl-CoA acetyltransferase                     75.1    9e-15   
emb|CEP17093.1|  hypothetical protein                                 78.6    9e-15   
ref|WP_013390877.1|  acetyl-CoA acetyltransferase                     78.6    9e-15   
ref|WP_011553804.1|  acetyl-CoA acetyltransferase                     78.6    9e-15   
ref|WP_040279763.1|  acetyl-CoA acetyltransferase                     78.6    9e-15   
ref|WP_009583742.1|  Acetyl-CoA acetyltransferase                     78.2    1e-14   
emb|CEI94313.1|  Putative Acetyl-CoA C-acetyltransferase              78.6    1e-14   
ref|XP_003172381.1|  acetyl-CoA acetyltransferase                     78.2    1e-14   
ref|WP_020740158.1|  acetyl-CoA acetyltransferase                     78.2    1e-14   
ref|WP_025978665.1|  acetyl-CoA acetyltransferase                     78.2    1e-14   
ref|WP_021779053.1|  probable acetyl-CoA acetyltransferase            78.2    1e-14   
gb|KEF63337.1|  acetyl-CoA C-acetyltransferase                        78.6    1e-14   
emb|CEG66962.1|  Putative Acetyl-CoA C-acetyltransferase              78.2    1e-14   
ref|XP_007779511.1|  acetyl-CoA C-acetyltransferase                   78.2    1e-14   
ref|XP_006262532.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  78.6    1e-14   
ref|WP_025994583.1|  acetyl-CoA acetyltransferase                     78.2    1e-14   
ref|WP_026640608.1|  acetyl-CoA acetyltransferase                     78.2    1e-14   
ref|WP_026964097.1|  acetyl-CoA acetyltransferase                     78.2    1e-14   
ref|WP_034745126.1|  acetyl-CoA acetyltransferase                     78.2    1e-14   
ref|XP_006036867.1|  PREDICTED: acetyl-CoA acetyltransferase A, m...  78.6    1e-14   
ref|WP_034725410.1|  acetyl-CoA acetyltransferase                     78.2    1e-14   
ref|XP_010226809.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  78.6    1e-14   
ref|WP_037484603.1|  acetyl-CoA acetyltransferase                     73.9    1e-14   
ref|XP_002790487.1|  acetyl-CoA acetyltransferase                     78.2    1e-14   
ref|WP_033466957.1|  acetyl-CoA acetyltransferase                     78.2    1e-14   
ref|WP_011962929.1|  acetyl-CoA acetyltransferase                     77.8    1e-14   
ref|WP_013940419.1|  acetyl-CoA acetyltransferase                     77.8    1e-14   
ref|XP_011057782.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...  78.6    1e-14   
ref|WP_014797750.1|  acetyl-CoA acetyltransferase                     77.8    1e-14   
ref|WP_034098055.1|  acetyl-CoA acetyltransferase                     77.8    1e-14   
ref|XP_002959306.1|  hypothetical protein VOLCADRAFT_84837            78.2    1e-14   
ref|WP_028375928.1|  acetyl-CoA acetyltransferase                     77.8    1e-14   
ref|XP_005229770.1|  PREDICTED: acetyl-CoA acetyltransferase A, m...  78.6    1e-14   
ref|WP_026963618.1|  acetyl-CoA acetyltransferase                     77.8    1e-14   
gb|AII54220.1|  acetyl-CoA acetyltransferase                          77.8    1e-14   
ref|WP_029434513.1|  acetyl-CoA acetyltransferase                     77.8    1e-14   
ref|XP_002951943.1|  hypothetical protein VOLCADRAFT_75176            78.2    1e-14   



>ref|XP_004243582.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
 ref|XP_010323906.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
 ref|XP_010323907.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
 ref|XP_010323908.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
Length=404

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPA A+TI  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIE ALK+ +VDPSLVEE
Sbjct  1    MAPAAADTIKPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIEGALKKANVDPSLVEE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_006357655.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Solanum 
tuberosum]
Length=404

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPA A+TI  RDVCIVGVARTPMG FLGSLSSLPATKLGSIAIE ALK+ +VDPSLVEE
Sbjct  1    MAPAAADTIKPRDVCIVGVARTPMGSFLGSLSSLPATKLGSIAIEGALKKANVDPSLVEE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_009761997.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X3 [Nicotiana sylvestris]
 ref|XP_009761998.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X3 [Nicotiana sylvestris]
Length=332

 Score =   133 bits (334),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPATAE+I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAI  AL+R +VDPSLVEE
Sbjct  1    MAPATAESIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIAGALQRANVDPSLVEE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_009761996.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Nicotiana sylvestris]
Length=348

 Score =   133 bits (334),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPATAE+I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAI  AL+R +VDPSLVEE
Sbjct  1    MAPATAESIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIAGALQRANVDPSLVEE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>gb|ABC74567.1| acetoacetyl-CoA thiolase [Picrorhiza kurrooa]
Length=404

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPA A++I  RDVCIVGV+RTPMGGFLGS+SSLPATKLGSIAIESALKR +VDPS V+E
Sbjct  1    MAPAAADSIKPRDVCIVGVSRTPMGGFLGSISSLPATKLGSIAIESALKRANVDPSHVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_009761989.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761990.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761991.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761992.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761993.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761994.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761995.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
Length=404

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPATAE+I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAI  AL+R +VDPSLVEE
Sbjct  1    MAPATAESIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIAGALQRANVDPSLVEE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_009590926.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Nicotiana 
tomentosiformis]
 gb|AAU95618.1| cytosolic acetoacetyl-coenzyme A thiolase [Nicotiana tabacum]
Length=404

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPA A++I  RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAIE ALK+ +VDPSLVEE
Sbjct  1    MAPAAADSIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIEGALKKANVDPSLVEE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_006353096.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Solanum 
tuberosum]
Length=404

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPATAE+I  RDVC+VGVARTPMGGFLGSLSS+ ATKLGSIAI  A+KR +VDPSLVEE
Sbjct  1    MAPATAESIKPRDVCVVGVARTPMGGFLGSLSSVSATKLGSIAIAGAIKRANVDPSLVEE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>gb|KDP29950.1| hypothetical protein JCGZ_18519 [Jatropha curcas]
Length=403

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPA AE +  RDVCIVGVARTPMGGFLG+LSSLPATKLGSIAIE+ALKR  VDPSLV+E
Sbjct  1    MAPAAAE-VKPRDVCIVGVARTPMGGFLGTLSSLPATKLGSIAIEAALKRAHVDPSLVQE  59

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  60   VFFGNVLSANLGQAPA  75



>dbj|BAF98276.1| acetyl-CoA C-acetyltransferase [Hevea brasiliensis]
Length=404

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP  A  I  RDVCIVGVARTPMGGFLG LS+LPATKLGSIAIE+ALKR SVDPSLV+E
Sbjct  1    MAPVAAAEIKPRDVCIVGVARTPMGGFLGLLSTLPATKLGSIAIEAALKRASVDPSLVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_009759542.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Nicotiana 
sylvestris]
Length=404

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPA A++I  RDVCIVGVARTPMG FLGSLSSL ATKLGSIAIE ALK+ +VDPSLVEE
Sbjct  1    MAPAAADSIKPRDVCIVGVARTPMGAFLGSLSSLSATKLGSIAIEGALKKANVDPSLVEE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_004491616.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Cicer arietinum]
Length=406

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 2/78 (3%)
 Frame = +2

Query  83   MAPATA--ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLV  256
            MAPA A  ++I  RDVCIVGVARTPMGGFLG+LSS+PATKLGSIAIE+ALKR +VDPSLV
Sbjct  1    MAPAAAASDSIQPRDVCIVGVARTPMGGFLGTLSSVPATKLGSIAIEAALKRANVDPSLV  60

Query  257  EEVFFGNVLSANLGQAPA  310
            EEV+FGNVLSANLGQAPA
Sbjct  61   EEVYFGNVLSANLGQAPA  78



>gb|KDO50952.1| hypothetical protein CISIN_1g0154952mg, partial [Citrus sinensis]
Length=262

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAPA A ++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDPSLV+
Sbjct  1    MAPAAASDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQ  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  61   EVFFGNVLSANLGQAPA  77



>ref|XP_004139514.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
[Cucumis sativus]
Length=404

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP ++++IN RDVCIVGVARTPMGGFLGSLSS  AT+LGSIAIE ALKR +VDPSLV+E
Sbjct  1    MAPLSSDSINPRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSLVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_010547202.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Tarenaya 
hassleriana]
Length=403

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 1/76 (1%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPA A+++ +RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIE+ALKR +VDPSLV+E
Sbjct  1    MAPA-ADSVKSRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIEAALKRANVDPSLVQE  59

Query  263  VFFGNVLSANLGQAPA  310
            V FGNVLSANLGQAPA
Sbjct  60   VIFGNVLSANLGQAPA  75



>ref|XP_004491615.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Cicer arietinum]
Length=423

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 2/78 (3%)
 Frame = +2

Query  83   MAPATA--ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLV  256
            MAPA A  ++I  RDVCIVGVARTPMGGFLG+LSS+PATKLGSIAIE+ALKR +VDPSLV
Sbjct  1    MAPAAAASDSIQPRDVCIVGVARTPMGGFLGTLSSVPATKLGSIAIEAALKRANVDPSLV  60

Query  257  EEVFFGNVLSANLGQAPA  310
            EEV+FGNVLSANLGQAPA
Sbjct  61   EEVYFGNVLSANLGQAPA  78



>gb|KGN64993.1| hypothetical protein Csa_1G173130 [Cucumis sativus]
Length=414

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP ++++IN RDVCIVGVARTPMGGFLGSLSS  AT+LGSIAIE ALKR +VDPSLV+E
Sbjct  1    MAPLSSDSINPRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSLVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_004239258.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
Length=404

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPATAE+I  RD+C+VGVARTPMGGFLGSLSS+ ATKLGSIAI  A+KR ++DP+LVEE
Sbjct  1    MAPATAESIKPRDICVVGVARTPMGGFLGSLSSVSATKLGSIAIAGAIKRANIDPALVEE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>gb|AEC13714.1| acetoacetyl-CoA thiolase [Catharanthus roseus]
Length=405

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAPA A+ +I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIESALKR  VDPSLV+
Sbjct  1    MAPAAAKNSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIESALKRAKVDPSLVQ  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  61   EVFFGNVLSANLGQAPA  77



>ref|XP_003545555.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Glycine 
max]
Length=407

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            +A A++++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDPSLVEE
Sbjct  4    VAAASSDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVEE  63

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  64   VFFGNVLSANLGQAPA  79



>ref|XP_003519682.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Glycine max]
 ref|XP_006575748.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Glycine max]
 gb|KHN43976.1| Acetyl-CoA acetyltransferase, cytosolic 1 [Glycine soja]
Length=407

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            +A A++++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDPSLVEE
Sbjct  4    VAAASSDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVEE  63

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  64   VFFGNVLSANLGQAPA  79



>ref|XP_010252788.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Nelumbo 
nucifera]
 ref|XP_010252789.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Nelumbo 
nucifera]
Length=406

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  77   LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLV  256
            +A A A A++I  RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAIE ALKR +VDPSLV
Sbjct  1    MAPAAAVADSIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIECALKRANVDPSLV  60

Query  257  EEVFFGNVLSANLGQAPA  310
            +EVFFGNVLSANLGQAPA
Sbjct  61   QEVFFGNVLSANLGQAPA  78



>gb|EYU42778.1| hypothetical protein MIMGU_mgv1a007511mg [Erythranthe guttata]
Length=401

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAPA A ++I  RDVCIVGVARTPMG FLGSLSS+PATKLGS+AIE ALKR ++DPSLVE
Sbjct  1    MAPAAANDSIKPRDVCIVGVARTPMGAFLGSLSSVPATKLGSVAIEGALKRANIDPSLVE  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  61   EVFFGNVLSANLGQAPA  77



>gb|EYU42777.1| hypothetical protein MIMGU_mgv1a007511mg [Erythranthe guttata]
Length=405

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAPA A ++I  RDVCIVGVARTPMG FLGSLSS+PATKLGS+AIE ALKR ++DPSLVE
Sbjct  1    MAPAAANDSIKPRDVCIVGVARTPMGAFLGSLSSVPATKLGSVAIEGALKRANIDPSLVE  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  61   EVFFGNVLSANLGQAPA  77



>ref|XP_002265690.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Vitis vinifera]
 ref|XP_010657485.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Vitis vinifera]
 emb|CBI28461.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPA A +I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VD SLV+E
Sbjct  1    MAPAAAASIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDASLVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>gb|ABV08820.1| acetoacetyl-coenzyme A thiolase [Salvia miltiorrhiza]
Length=399

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP  A +IN +DVCIVGVARTPMGGFLGSLSS+PATKLGS+AI+SALKR ++DPSLV+E
Sbjct  1    MAPEAA-SINPKDVCIVGVARTPMGGFLGSLSSVPATKLGSVAIQSALKRANIDPSLVQE  59

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  60   VFFGNVLSANLGQAPA  75



>ref|XP_006447819.1| hypothetical protein CICLE_v10015452mg [Citrus clementina]
 ref|XP_006447820.1| hypothetical protein CICLE_v10015452mg [Citrus clementina]
 gb|ESR61059.1| hypothetical protein CICLE_v10015452mg [Citrus clementina]
 gb|ESR61060.1| hypothetical protein CICLE_v10015452mg [Citrus clementina]
Length=405

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAPA A ++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDPSLV+
Sbjct  1    MAPAAASDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQ  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  61   EVFFGNVLSANLGQAPA  77



>ref|XP_006469436.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Citrus 
sinensis]
Length=405

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAPA A ++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDPSLV+
Sbjct  1    MAPAAASDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQ  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  61   EVFFGNVLSANLGQAPA  77



>gb|KDP35512.1| hypothetical protein JCGZ_08950 [Jatropha curcas]
Length=412

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +2

Query  92   ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  271
            A++++IN RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAI+SALKR +VDPSLV+EVFF
Sbjct  3    ASSDSINPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIQSALKRANVDPSLVQEVFF  62

Query  272  GNVLSANLGQAPA  310
            GNVLSANLGQAPA
Sbjct  63   GNVLSANLGQAPA  75



>ref|XP_008365553.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Malus domestica]
Length=408

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 4/80 (5%)
 Frame = +2

Query  83   MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  250
            MAP +AE    +IN RDVCIVG+ARTPMG FLG+LSS+PATKLGSIAIE+ALKR +VDP+
Sbjct  1    MAPVSAEACSDSINPRDVCIVGIARTPMGAFLGALSSVPATKLGSIAIEAALKRANVDPA  60

Query  251  LVEEVFFGNVLSANLGQAPA  310
            LVEEVFFGNVLSANLGQAPA
Sbjct  61   LVEEVFFGNVLSANLGQAPA  80



>ref|XP_009361536.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Pyrus x 
bretschneideri]
Length=408

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 4/80 (5%)
 Frame = +2

Query  83   MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  250
            MAP  AE    +I  RDVCIVGVARTPMGGFLG+LSS+PATKLGSIAIE+ALKR +VDP+
Sbjct  1    MAPVAAEACSDSIKPRDVCIVGVARTPMGGFLGALSSVPATKLGSIAIEAALKRANVDPA  60

Query  251  LVEEVFFGNVLSANLGQAPA  310
            LVEEVFFGNVLSANLGQAPA
Sbjct  61   LVEEVFFGNVLSANLGQAPA  80



>gb|AIK21787.1| acetyl-CoA C-acetyltransferase [Panax notoginseng]
Length=408

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 4/80 (5%)
 Frame = +2

Query  83   MAPATA----ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  250
            MAPA A    E+I ARDVCIVG ARTPMGGFLG+LSSL ATKLGSIAI+SALKR +VDP+
Sbjct  1    MAPAAATDCSESIKARDVCIVGAARTPMGGFLGTLSSLSATKLGSIAIQSALKRANVDPA  60

Query  251  LVEEVFFGNVLSANLGQAPA  310
            LV+EVFFGNVLSANLGQAPA
Sbjct  61   LVQEVFFGNVLSANLGQAPA  80



>gb|ADX07532.1| acetyl-CoA C-acetyltransferase [Bacopa monnieri]
Length=74

 Score =   119 bits (298),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 1/74 (1%)
 Frame = +2

Query  83   MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAPA A ++I  ++VCIVGVARTPMGGFLGSLSSL ATKLGS+AIESALKR ++DPSLV+
Sbjct  1    MAPAAAADSIQPKNVCIVGVARTPMGGFLGSLSSLSATKLGSVAIESALKRANLDPSLVQ  60

Query  260  EVFFGNVLSANLGQ  301
            EVFFGNVLSANLGQ
Sbjct  61   EVFFGNVLSANLGQ  74



>gb|AFI23434.1| thiolase II [Betula platyphylla]
Length=400

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  92   ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  271
            A +++I  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIE ALKR +VDPSLV+EVFF
Sbjct  2    AASDSIKPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIECALKRANVDPSLVQEVFF  61

Query  272  GNVLSANLGQAPA  310
            GNVL ANLGQAPA
Sbjct  62   GNVLCANLGQAPA  74



>emb|CDY05692.1| BnaC02g38450D [Brassica napus]
Length=219

 Score =   123 bits (309),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+A  +ALKR +VDPSLV+EV FG
Sbjct  4    SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVATAAALKRANVDPSLVQEVVFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>ref|XP_004159110.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
[Cucumis sativus]
Length=404

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP ++++IN RDVCIVGVARTPMGGFLGSLSS  AT+LGSIAIE ALKR +VD SLV+E
Sbjct  1    MAPLSSDSINPRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDSSLVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_010497269.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2, 
partial [Camelina sativa]
Length=160

 Score =   121 bits (304),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP+ ++ ++  RDVC+VGVARTPMGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVE
Sbjct  1    MAPSVSDDSVKPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVL+ANLGQAPA
Sbjct  61   EVFFGNVLTANLGQAPA  77



>gb|KCW58126.1| hypothetical protein EUGRSUZ_H00849 [Eucalyptus grandis]
Length=388

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAPA +  +I  RDVCIVGVARTPMGGFLG+LSSLPATKLGSIAIE+ALKR +VDPSLV+
Sbjct  1    MAPAASTASIKPRDVCIVGVARTPMGGFLGTLSSLPATKLGSIAIEAALKRANVDPSLVQ  60

Query  260  EVFFGNVLSANLGQAPA  310
            EV FGNVLSANLGQAPA
Sbjct  61   EVLFGNVLSANLGQAPA  77



>gb|AGH32909.1| acetyl-CoA C-acetyltransferase [Camellia chekiangoleosa]
Length=408

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            +++ +RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAI SALKR  VDPSLV+EVFFGNV
Sbjct  11   DSVKSRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIGSALKRAHVDPSLVQEVFFGNV  70

Query  281  LSANLGQAPA  310
            LSANLGQAPA
Sbjct  71   LSANLGQAPA  80



>ref|XP_010069705.1| PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA acetyltransferase, 
cytosolic 1-like [Eucalyptus grandis]
Length=405

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAPA +  +I  RDVCIVGVARTPMGGFLG+LSSLPATKLGSIAIE+ALKR +VDPSLV+
Sbjct  1    MAPAASTASIKPRDVCIVGVARTPMGGFLGTLSSLPATKLGSIAIEAALKRANVDPSLVQ  60

Query  260  EVFFGNVLSANLGQAPA  310
            EV FGNVLSANLGQAPA
Sbjct  61   EVLFGNVLSANLGQAPA  77



>ref|XP_008464274.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X3 [Cucumis melo]
Length=439

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP +++++N RDVCIVGVARTPMGGFLGSLSS  AT+LGSIAIE ALKR +VDPS+V+E
Sbjct  48   MAPISSDSVNLRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSIVQE  107

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVL ANLGQAPA
Sbjct  108  VFFGNVLGANLGQAPA  123



>ref|XP_011100512.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Sesamum 
indicum]
Length=403

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAPA  ++I  RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAIESALKR +VDPS V+E
Sbjct  1    MAPA-GDSIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIESALKRANVDPSSVQE  59

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  60   VFFGNVLSANLGQAPA  75



>ref|XP_008464272.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Cucumis melo]
Length=461

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP +++++N RDVCIVGVARTPMGGFLGSLSS  AT+LGSIAIE ALKR +VDPS+V+E
Sbjct  48   MAPISSDSVNLRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSIVQE  107

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVL ANLGQAPA
Sbjct  108  VFFGNVLGANLGQAPA  123



>ref|XP_008464273.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Cucumis melo]
Length=451

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP +++++N RDVCIVGVARTPMGGFLGSLSS  AT+LGSIAIE ALKR +VDPS+V+E
Sbjct  48   MAPISSDSVNLRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSIVQE  107

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVL ANLGQAPA
Sbjct  108  VFFGNVLGANLGQAPA  123



>gb|KHN46894.1| Acetyl-CoA acetyltransferase, cytosolic 1 [Glycine soja]
Length=407

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            +A A++++I  RDVCIVGVARTPMGGFLG+L SL ATKLGSIAIE+ALKR +VDPSLVEE
Sbjct  4    VAAASSDSIKPRDVCIVGVARTPMGGFLGTLPSLSATKLGSIAIEAALKRANVDPSLVEE  63

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  64   VFFGNVLSANLGQAPA  79



>gb|ACU19591.1| unknown [Glycine max]
Length=407

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            +A A++++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+AL R +VDPSLVEE
Sbjct  4    VAAASSDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALTRANVDPSLVEE  63

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  64   VFFGNVLSANLGQAPA  79



>ref|XP_006395207.1| hypothetical protein EUTSA_v10004340mg [Eutrema salsugineum]
 gb|ESQ32493.1| hypothetical protein EUTSA_v10004340mg [Eutrema salsugineum]
Length=403

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            TA+ +N RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAI +ALKR +VDPSLV+EV FG
Sbjct  4    TADFVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIAAALKRANVDPSLVQEVIFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>emb|CDX86320.1| BnaA06g30370D [Brassica napus]
Length=425

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            TA+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  26   TADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVAIAAALKRANVDPSLVQEVVFG  85

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  86   NVLSANLGQAPA  97



>ref|XP_007215468.1| hypothetical protein PRUPE_ppa006513mg [Prunus persica]
 gb|EMJ16667.1| hypothetical protein PRUPE_ppa006513mg [Prunus persica]
Length=408

 Score =   125 bits (315),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 70/80 (88%), Gaps = 4/80 (5%)
 Frame = +2

Query  83   MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  250
            MAP TAE    +I  RDV IVGVARTPMG FLG+LSSLPATKLGSIAIE+ALKR +VDPS
Sbjct  1    MAPVTAEACSDSIKPRDVYIVGVARTPMGAFLGALSSLPATKLGSIAIEAALKRANVDPS  60

Query  251  LVEEVFFGNVLSANLGQAPA  310
            LVEEVFFGNVLSANLGQAPA
Sbjct  61   LVEEVFFGNVLSANLGQAPA  80



>gb|AAL18924.1|AF429383_1 acetyl Co-A acetyltransferase [Hevea brasiliensis]
Length=411

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            M+P++ ++IN RDVCIVGVARTPMGGFLGSLSS  ATKLGSIAI++ALKR +VDPSLV+E
Sbjct  1    MSPSS-DSINPRDVCIVGVARTPMGGFLGSLSSFSATKLGSIAIQAALKRANVDPSLVQE  59

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  60   VFFGNVLSANLGQAPA  75



>ref|XP_008229933.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Prunus 
mume]
Length=408

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 70/80 (88%), Gaps = 4/80 (5%)
 Frame = +2

Query  83   MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  250
            MAP TAE    +I  RDV IVGVARTPMG FLG+LSSLPATKLGSIAIE+ALKR +VDPS
Sbjct  1    MAPVTAEACSDSIKPRDVYIVGVARTPMGAFLGALSSLPATKLGSIAIEAALKRANVDPS  60

Query  251  LVEEVFFGNVLSANLGQAPA  310
            LVEEVFFGNVLSANLGQAPA
Sbjct  61   LVEEVFFGNVLSANLGQAPA  80



>gb|KJB42687.1| hypothetical protein B456_007G165600 [Gossypium raimondii]
Length=352

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            +A A++++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +V+PSLV+E
Sbjct  4    VAAASSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVNPSLVQE  63

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  64   VFFGNVLSANLGQAPA  79



>ref|XP_004293407.2| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Fragaria 
vesca subsp. vesca]
Length=414

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MA ++  +I  RDVCIVGVARTPMGGFLGSLSSL AT+LGSIAIE+ALKR  VDPSLV+E
Sbjct  1    MASSSDSSIKPRDVCIVGVARTPMGGFLGSLSSLSATRLGSIAIETALKRAKVDPSLVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>gb|KHG30083.1| Acetyl-CoA acetyltransferase, cytosolic 1 -like protein [Gossypium 
arboreum]
Length=407

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 70/79 (89%), Gaps = 3/79 (4%)
 Frame = +2

Query  83   MAPATA---ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  253
            MAP  A   ++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +VDPSL
Sbjct  1    MAPVAATSSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVDPSL  60

Query  254  VEEVFFGNVLSANLGQAPA  310
            V+EVFFGNVLSANLGQAPA
Sbjct  61   VQEVFFGNVLSANLGQAPA  79



>gb|KJB42688.1| hypothetical protein B456_007G165600 [Gossypium raimondii]
Length=353

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            +A A++++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +V+PSLV+E
Sbjct  4    VAAASSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVNPSLVQE  63

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  64   VFFGNVLSANLGQAPA  79



>ref|XP_010689228.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Beta vulgaris 
subsp. vulgaris]
Length=405

 Score =   125 bits (314),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP   +E+IN +DVCIVGVARTPMGGFLG+LSSLPATKLGS+AI+ ALKR ++DPSLV+
Sbjct  1    MAPVPNSESINPKDVCIVGVARTPMGGFLGTLSSLPATKLGSVAIQGALKRANIDPSLVQ  60

Query  260  EVFFGNVLSANLGQAPA  310
            EV FGNVLSANLGQAPA
Sbjct  61   EVIFGNVLSANLGQAPA  77



>ref|XP_009111830.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Brassica 
rapa]
Length=403

 Score =   125 bits (314),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4    SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVAITAALKRATVDPSLVQEVVFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>gb|ADD10719.1| acetyl-CoA C-acetyltransferase protein [Camellia oleifera]
Length=408

 Score =   125 bits (314),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            +++  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAI SALKR  VDPSLV+EVFFGNV
Sbjct  11   DSVKPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIGSALKRAHVDPSLVQEVFFGNV  70

Query  281  LSANLGQAPA  310
            LSANLGQAPA
Sbjct  71   LSANLGQAPA  80



>emb|CDY48742.1| BnaA02g30030D [Brassica napus]
Length=403

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4    SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVAIAAALKRANVDPSLVQEVVFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>gb|ACU87560.2| acetyl-CoA C-acetyltransferase [Bacopa monnieri]
Length=405

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAPA A ++I  ++VCIVGVARTPMGGFLGSLSSL ATKLGS+AIESALKR ++DPSLV+
Sbjct  1    MAPAAAADSIQPKNVCIVGVARTPMGGFLGSLSSLSATKLGSVAIESALKRANLDPSLVQ  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  61   EVFFGNVLSANLGQAPA  77



>emb|CDY19963.1| BnaA09g02880D [Brassica napus]
Length=403

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4    SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVAITAALKRANVDPSLVQEVVFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>ref|XP_009129715.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Brassica rapa]
Length=435

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 3/91 (3%)
 Frame = +2

Query  38   HYNQHRSSICIH*LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIE  217
            H  +  + +C   +A    +A+++N RDVCIVGVARTPMGGFLGS+SSLPATKLGS+AI 
Sbjct  20   HVKKASTYLCSFLMAH---SADSVNPRDVCIVGVARTPMGGFLGSISSLPATKLGSVAIA  76

Query  218  SALKRGSVDPSLVEEVFFGNVLSANLGQAPA  310
            +ALKR +VDPSLV+EV FGNVLSANLGQAPA
Sbjct  77   AALKRANVDPSLVQEVVFGNVLSANLGQAPA  107



>gb|KJB42689.1| hypothetical protein B456_007G165600 [Gossypium raimondii]
Length=405

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            +A A++++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +V+PSLV+E
Sbjct  4    VAAASSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVNPSLVQE  63

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  64   VFFGNVLSANLGQAPA  79



>emb|CDY00071.1| BnaC09g02300D [Brassica napus]
Length=403

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4    SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVAITAALKRANVDPSLVQEVVFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>ref|XP_009151624.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Brassica 
rapa]
Length=403

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            TA+++N RDVCIVGVARTPMGGFLGSLSS PATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4    TADSVNPRDVCIVGVARTPMGGFLGSLSSFPATKLGSVAIAAALKRANVDPSLVQEVVFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>gb|KJB42690.1| hypothetical protein B456_007G165600 [Gossypium raimondii]
Length=407

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            +A A++++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +V+PSLV+E
Sbjct  4    VAAASSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVNPSLVQE  63

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  64   VFFGNVLSANLGQAPA  79



>ref|NP_568694.2| acetoacetyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q8S4Y1.1|THIC1_ARATH RecName: Full=Acetyl-CoA acetyltransferase, cytosolic 1; AltName: 
Full=Cytosolic acetoacetyl-CoA thiolase 1; Short=Thiolase 
1; AltName: Full=Protein EMBRYO DEFECTIVE 1276 [Arabidopsis 
thaliana]
 gb|AAM00280.1|AF364059_1 acetoacetyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAH19918.1| AT5G48230 [Arabidopsis thaliana]
 gb|AED95638.1| acetoacetyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=403

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            T+E++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDP+LV+EV FG
Sbjct  4    TSESVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>dbj|BAA97003.1| acetyl-CoA C-acetyltransferase [Arabidopsis thaliana]
Length=486

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +2

Query  50   HRSSICIH*LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALK  229
             RS + +   AMA  T+E++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALK
Sbjct  73   RRSLLELKNQAMAH-TSESVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALK  131

Query  230  RGSVDPSLVEEVFFGNVLSANLGQAPA  310
            R +VDP+LV+EV FGNVLSANLGQAPA
Sbjct  132  RANVDPALVQEVVFGNVLSANLGQAPA  158



>gb|KFK31312.1| hypothetical protein AALP_AA6G096400 [Arabis alpina]
Length=404

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MA +   ++N RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAI +ALKR +VDPSLV+E
Sbjct  1    MAHSPDSSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIAAALKRANVDPSLVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            V FGNVLSANLGQAPA
Sbjct  61   VIFGNVLSANLGQAPA  76



>ref|XP_010482068.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Camelina 
sativa]
Length=403

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            TA+++N +DVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4    TADSVNPKDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPSLVQEVVFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>gb|EPS67778.1| hypothetical protein M569_06996, partial [Genlisea aurea]
Length=348

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 2/78 (3%)
 Frame = +2

Query  83   MAPA--TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLV  256
            MAPA  T +TI  RDVCIVGVARTPMGGFLG+LSSL A K+GS+AI++ALKR +VDPSL+
Sbjct  1    MAPAADTTDTIKPRDVCIVGVARTPMGGFLGTLSSLSAIKIGSVAIQAALKRANVDPSLI  60

Query  257  EEVFFGNVLSANLGQAPA  310
            +EVFFGNVLSANLGQAPA
Sbjct  61   QEVFFGNVLSANLGQAPA  78



>ref|XP_009129716.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Brassica rapa]
Length=403

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            +A+++N RDVCIVGVARTPMGGFLGS+SSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4    SADSVNPRDVCIVGVARTPMGGFLGSISSLPATKLGSVAIAAALKRANVDPSLVQEVVFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>ref|XP_010481278.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Camelina sativa]
Length=405

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 72/77 (94%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP+ ++ ++N RDVC+VGVARTPMGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVE
Sbjct  1    MAPSVSDDSVNPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVL+ANLGQAPA
Sbjct  61   EVFFGNVLTANLGQAPA  77



>ref|XP_010481277.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Camelina sativa]
Length=415

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 72/77 (94%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP+ ++ ++N RDVC+VGVARTPMGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVE
Sbjct  1    MAPSVSDDSVNPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVL+ANLGQAPA
Sbjct  61   EVFFGNVLTANLGQAPA  77



>ref|XP_007211795.1| hypothetical protein PRUPE_ppa006371mg [Prunus persica]
 gb|EMJ12994.1| hypothetical protein PRUPE_ppa006371mg [Prunus persica]
Length=415

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            M+P+++E+I  RDVCIVGVARTPMGGFLGSLSS+ AT+LGS+AI  ALKR ++DPSLV+E
Sbjct  2    MSPSSSESIKPRDVCIVGVARTPMGGFLGSLSSVTATQLGSLAIRCALKRANLDPSLVQE  61

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  62   VFFGNVLSANLGQAPA  77



>gb|EYU27653.1| hypothetical protein MIMGU_mgv1a007243mg [Erythranthe guttata]
Length=414

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MA    + IN +DVCIVGVARTPMGGFLGSLSSLPATKLGSIAI  ALKR  VDPSLV+E
Sbjct  1    MASLADDPINPQDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIACALKRAGVDPSLVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>emb|CDX85319.1| BnaC07g26300D [Brassica napus]
Length=425

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            TA+++N R+VCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  26   TADSVNPREVCIVGVARTPMGGFLGSLSSLPATKLGSVAIAAALKRANVDPSLVQEVVFG  85

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  86   NVLSANLGQAPA  97



>emb|CDP04540.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MA AT + +I  RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAI+SALKR +VDPSLV+
Sbjct  1    MAYATTDNSIQPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIQSALKRANVDPSLVQ  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVL ANLGQAPA
Sbjct  61   EVFFGNVLCANLGQAPA  77



>gb|AAL18928.1|AF429387_1 truncated acetyl Co-A acetyltransferase-like protein [Hevea brasiliensis]
Length=232

 Score =   120 bits (302),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            I  RDVCIVGVARTPMGGFLGSL +L ATKLGSIAIE+ALKR +VDPSLV+EVFFGNVLS
Sbjct  13   IKPRDVCIVGVARTPMGGFLGSLCTLSATKLGSIAIEAALKRANVDPSLVQEVFFGNVLS  72

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  73   ANLGQAPA  80



>ref|XP_002532204.1| acetyl-CoA acetyltransferase, mitochondrial, putative [Ricinus 
communis]
 gb|EEF30173.1| acetyl-CoA acetyltransferase, mitochondrial, putative [Ricinus 
communis]
Length=232

 Score =   120 bits (302),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 4/76 (5%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP     I  RDVCIVGVARTPMGGFLGSLSSL ATKLGS+AIE+ALKR ++DPSLV+E
Sbjct  1    MAP----EIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSLAIEAALKRANLDPSLVQE  56

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  57   VFFGNVLSANLGQAPA  72



>ref|XP_007049379.1| Acetoacetyl-CoA thiolase 2 isoform 2 [Theobroma cacao]
 gb|EOX93536.1| Acetoacetyl-CoA thiolase 2 isoform 2 [Theobroma cacao]
Length=408

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 3/79 (4%)
 Frame = +2

Query  83   MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  253
            MAP   A +++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +VDPSL
Sbjct  1    MAPTAAAASDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVDPSL  60

Query  254  VEEVFFGNVLSANLGQAPA  310
            V+EV FGNVLSANLGQAPA
Sbjct  61   VQEVIFGNVLSANLGQAPA  79



>ref|XP_007049378.1| Acetoacetyl-CoA thiolase 2 isoform 1 [Theobroma cacao]
 gb|EOX93535.1| Acetoacetyl-CoA thiolase 2 isoform 1 [Theobroma cacao]
Length=407

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 3/79 (4%)
 Frame = +2

Query  83   MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  253
            MAP   A +++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +VDPSL
Sbjct  1    MAPTAAAASDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVDPSL  60

Query  254  VEEVFFGNVLSANLGQAPA  310
            V+EV FGNVLSANLGQAPA
Sbjct  61   VQEVIFGNVLSANLGQAPA  79



>gb|AEM42969.1| acetyl-CoA C-acetyltransferase [Siraitia grosvenorii]
Length=407

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 3/79 (4%)
 Frame = +2

Query  83   MAPATA---ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  253
            MAPA A   ++I+ RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR  VDPS 
Sbjct  1    MAPAAAASTDSIHPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRAKVDPSQ  60

Query  254  VEEVFFGNVLSANLGQAPA  310
            V+EV FGNVLSANLGQAPA
Sbjct  61   VQEVIFGNVLSANLGQAPA  79



>emb|CDP18953.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAPA +E +I   DVCIVGVARTPMGGFLGSLSS+PATKLGSIAIE ALK  +VDPSLV+
Sbjct  1    MAPAASENSIKPTDVCIVGVARTPMGGFLGSLSSIPATKLGSIAIERALKGANVDPSLVQ  60

Query  260  EVFFGNVLSANLGQAPA  310
            EV+FGNVLSANLGQAPA
Sbjct  61   EVYFGNVLSANLGQAPA  77



>ref|XP_006280568.1| hypothetical protein CARUB_v10026521mg [Capsella rubella]
 gb|EOA13466.1| hypothetical protein CARUB_v10026521mg [Capsella rubella]
Length=403

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            TA+++N +DVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDP+LV+EV FG
Sbjct  4    TADSVNPKDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>ref|XP_010442239.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Camelina 
sativa]
Length=403

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            TA+++N +DVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDP+LV+EV FG
Sbjct  4    TADSVNPKDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>ref|XP_002320528.1| truncated acetyl Co-A acetyltransferase-like family protein [Populus 
trichocarpa]
 gb|EEE98843.1| truncated acetyl Co-A acetyltransferase-like family protein [Populus 
trichocarpa]
Length=401

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            T+  I  RDVC+VGVARTPMGGFLGSLSSLPATKLGSIAIE+ALKR +VDPS V+EVFFG
Sbjct  2    TSAEIKPRDVCVVGVARTPMGGFLGSLSSLPATKLGSIAIEAALKRANVDPSTVQEVFFG  61

Query  275  NVLSANLGQAPA  310
            NVL ANLGQAPA
Sbjct  62   NVLCANLGQAPA  73



>ref|XP_008462041.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Cucumis 
melo]
Length=406

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            E+IN RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR  VDP+LV+EV FGNV
Sbjct  9    ESINPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRAKVDPALVQEVIFGNV  68

Query  281  LSANLGQAPA  310
            LSANLGQAPA
Sbjct  69   LSANLGQAPA  78



>gb|ACX47470.1| acetoacetyl-CoA thiolase [Medicago sativa]
Length=403

 Score =   122 bits (307),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  92   ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  271
            A+  TI  RDVCIVGVARTPMG FLG+LSS+PATKLGSIAIE+ALKR +VDP++VEEVFF
Sbjct  3    ASDSTITPRDVCIVGVARTPMGVFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFF  62

Query  272  GNVLSANLGQAPA  310
            GNVLSANLGQAPA
Sbjct  63   GNVLSANLGQAPA  75



>gb|ACX46381.1| acetoacetyl-CoA thiolase [Helianthus annuus]
Length=411

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            + IN RDVCIVGVARTPMG FLGSLSSLPATKLGSIAI+SAL+R ++DP LV+EVFFGNV
Sbjct  5    DKINPRDVCIVGVARTPMGDFLGSLSSLPATKLGSIAIQSALQRANIDPRLVQEVFFGNV  64

Query  281  LSANLGQAPA  310
            LSANLGQAPA
Sbjct  65   LSANLGQAPA  74



>ref|XP_008224638.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Prunus 
mume]
Length=415

 Score =   122 bits (307),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            M+P+++++I  RDVCIVGVARTPMGGFLGSLSS+ AT+LGS+AI  ALKR ++DPSLV+E
Sbjct  2    MSPSSSDSIKPRDVCIVGVARTPMGGFLGSLSSVSATQLGSLAIRCALKRANLDPSLVQE  61

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  62   VFFGNVLSANLGQAPA  77



>ref|XP_003580738.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Brachypodium 
distachyon]
Length=401

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            ++ +  RDVC+VGVARTPMGGFLG+LSSLPATKLGSIAIE+ALKR  VDPSLV+EV+FGN
Sbjct  3    SDNVGPRDVCVVGVARTPMGGFLGALSSLPATKLGSIAIEAALKRAHVDPSLVQEVYFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>ref|XP_002865618.1| acetoacetyl-CoA thiolase 2, embryo defective 1276 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41877.1| acetoacetyl-CoA thiolase 2, embryo defective 1276 [Arabidopsis 
lyrata subsp. lyrata]
Length=403

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            T+E++  RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDP+LV+EV FG
Sbjct  4    TSESVKPRDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>ref|XP_009608453.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Nicotiana 
tomentosiformis]
Length=414

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MA    ++I  RDVCIVGVARTPMGGFLGSLSSL AT+LGS+AI +ALKR +VDPSLV+E
Sbjct  1    MAKMVNDSIKPRDVCIVGVARTPMGGFLGSLSSLSATELGSVAIRAALKRANVDPSLVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>gb|AAU95619.1| peroxisomal acetoacetyl-coenzyme A thiolase [Nicotiana tabacum]
Length=414

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MA    ++I  RDVCIVGVARTPMGGFLGSLSSL AT+LGS+AI +ALKR +VDPSLV+E
Sbjct  1    MAKMVNDSIKPRDVCIVGVARTPMGGFLGSLSSLSATELGSVAIRAALKRANVDPSLVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_007142529.1| hypothetical protein PHAVU_008G288400g [Phaseolus vulgaris]
 gb|ESW14523.1| hypothetical protein PHAVU_008G288400g [Phaseolus vulgaris]
Length=407

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            +++ I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDPSLVEEV FG
Sbjct  8    SSDDIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVEEVIFG  67

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  68   NVLSANLGQAPA  79



>ref|XP_004144550.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Cucumis 
sativus]
 ref|XP_004172131.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Cucumis 
sativus]
Length=407

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            E+IN RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AIE+ALKR  VDP+LV+EV FGNV
Sbjct  10   ESINPRDVCIVGVARTPMGGFLGTLSSLSATKLGSLAIEAALKRAKVDPALVQEVIFGNV  69

Query  281  LSANLGQAPA  310
            LSANLGQAPA
Sbjct  70   LSANLGQAPA  79



>ref|XP_009787709.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Nicotiana 
sylvestris]
Length=414

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MA    ++I  RDVCIVGVARTPMGGFLGSLSSL AT+LGS+AI +ALKR +VDPSLV+E
Sbjct  1    MAKMVNDSIKPRDVCIVGVARTPMGGFLGSLSSLSATELGSVAIRAALKRANVDPSLVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>gb|KEH15899.1| peroxisomal acetoacetyl-coenzyme A thiolase, partial [Medicago 
truncatula]
Length=350

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            I  RDVCIVGVARTPMG FLG+LSS+PATKLGSIAIE+ALKR +VDP++VEEVFFGNVLS
Sbjct  12   IQPRDVCIVGVARTPMGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLS  71

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  72   ANLGQAPA  79



>ref|XP_010495012.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Camelina sativa]
Length=415

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP+ ++ ++  RDVC+VGVARTPMGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVE
Sbjct  1    MAPSVSDDSVKPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVL+ANLGQAPA
Sbjct  61   EVFFGNVLTANLGQAPA  77



>ref|XP_010495013.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Camelina sativa]
Length=405

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP+ ++ ++  RDVC+VGVARTPMGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVE
Sbjct  1    MAPSVSDDSVKPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVL+ANLGQAPA
Sbjct  61   EVFFGNVLTANLGQAPA  77



>ref|XP_004303573.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Fragaria 
vesca subsp. vesca]
Length=405

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAP-ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP A A++I+ R V IVGVARTPMG FLG+LSSLPATKLGSIAIE+ALKR +VDPSLVE
Sbjct  1    MAPEACADSISPRGVYIVGVARTPMGAFLGALSSLPATKLGSIAIEAALKRANVDPSLVE  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  61   EVFFGNVLSANLGQAPA  77



>ref|XP_011002352.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Populus euphratica]
Length=402

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  92   ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  271
            A++++I  RDVCIVGVARTPMGGFLGSLSS  ATKLGSIAI+ AL+R ++DPSLV+EVFF
Sbjct  2    ASSDSIKPRDVCIVGVARTPMGGFLGSLSSFSATKLGSIAIQCALQRANIDPSLVQEVFF  61

Query  272  GNVLSANLGQAPA  310
            GNVLSANLGQAPA
Sbjct  62   GNVLSANLGQAPA  74



>ref|XP_002308755.1| truncated acetyl Co-A acetyltransferase-like family protein [Populus 
trichocarpa]
 gb|EEE92278.1| truncated acetyl Co-A acetyltransferase-like family protein [Populus 
trichocarpa]
Length=412

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  92   ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  271
            A++++I  RDVCIVGVARTPMGGFLGSLSS  ATKLGSIAI+ AL+R ++DPSLV+EVFF
Sbjct  2    ASSDSIKPRDVCIVGVARTPMGGFLGSLSSFSATKLGSIAIQCALQRANIDPSLVQEVFF  61

Query  272  GNVLSANLGQAPA  310
            GNVLSANLGQAPA
Sbjct  62   GNVLSANLGQAPA  74



>ref|XP_006398472.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
 gb|ESQ39925.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
Length=400

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP+ ++ +I  RDVC+VGVARTPMGGFLGSLSS+ AT+LGSIAIE+AL+R  VDP LVE
Sbjct  1    MAPSVSDGSIQPRDVCVVGVARTPMGGFLGSLSSMTATRLGSIAIEAALRRAKVDPRLVE  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVL+ANLGQAPA
Sbjct  61   EVFFGNVLTANLGQAPA  77



>ref|XP_011002351.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Populus euphratica]
Length=412

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  92   ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  271
            A++++I  RDVCIVGVARTPMGGFLGSLSS  ATKLGSIAI+ AL+R ++DPSLV+EVFF
Sbjct  2    ASSDSIKPRDVCIVGVARTPMGGFLGSLSSFSATKLGSIAIQCALQRANIDPSLVQEVFF  61

Query  272  GNVLSANLGQAPA  310
            GNVLSANLGQAPA
Sbjct  62   GNVLSANLGQAPA  74



>ref|XP_011085410.1| PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA acetyltransferase, 
cytosolic 1-like [Sesamum indicum]
Length=403

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            M+PA  ++I  RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAI SALKR ++DPSLVEE
Sbjct  1    MSPAARDSIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIASALKRANIDPSLVEE  60

Query  263  VFFGNVLSANLG  298
            VFFGNVLSANLG
Sbjct  61   VFFGNVLSANLG  72



>ref|XP_010267979.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Nelumbo nucifera]
Length=407

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            ++I  RDVC++GVARTPMGGFLGSLSSL ATKLGSIAIE ALKR +VDP+LV+EVFFGNV
Sbjct  10   DSIKPRDVCVIGVARTPMGGFLGSLSSLSATKLGSIAIECALKRANVDPALVQEVFFGNV  69

Query  281  LSANLGQAPA  310
            LSANLGQAPA
Sbjct  70   LSANLGQAPA  79



>gb|KDO78589.1| hypothetical protein CISIN_1g015003mg [Citrus sinensis]
Length=339

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  67   VLSANLGQAPA  77



>ref|XP_006398474.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
 gb|ESQ39927.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
Length=415

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP+ ++ +I  RDVC+VGVARTPMGGFLGSLSS+ AT+LGSIAIE+AL+R  VDP LVE
Sbjct  1    MAPSVSDGSIQPRDVCVVGVARTPMGGFLGSLSSMTATRLGSIAIEAALRRAKVDPRLVE  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVL+ANLGQAPA
Sbjct  61   EVFFGNVLTANLGQAPA  77



>ref|NP_001062685.1| Os09g0252100 [Oryza sativa Japonica Group]
 dbj|BAF24599.1| Os09g0252100, partial [Oryza sativa Japonica Group]
Length=433

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  86   APATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEV  265
            A   ++ I +RDVC+VGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDP+LV+EV
Sbjct  31   AAMASDNIGSRDVCVVGVARTPMGGFLGALSSLSATKLGSIAIEAALKRANVDPALVQEV  90

Query  266  FFGNVLSANLGQAPA  310
            FFGNVLSANLGQAPA
Sbjct  91   FFGNVLSANLGQAPA  105



>ref|XP_002522876.1| acetyl-CoA acetyltransferase, mitochondrial, putative [Ricinus 
communis]
 gb|EEF39476.1| acetyl-CoA acetyltransferase, mitochondrial, putative [Ricinus 
communis]
Length=402

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 66/76 (87%), Gaps = 2/76 (3%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP   +++  RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAI  AL+R  VDPSLVEE
Sbjct  1    MAPT--DSLKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIHCALERARVDPSLVEE  58

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  59   VFFGNVLSANLGQAPA  74



>ref|XP_010267976.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010267978.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Nelumbo nucifera]
Length=417

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            ++I  RDVC++GVARTPMGGFLGSLSSL ATKLGSIAIE ALKR +VDP+LV+EVFFGNV
Sbjct  10   DSIKPRDVCVIGVARTPMGGFLGSLSSLSATKLGSIAIECALKRANVDPALVQEVFFGNV  69

Query  281  LSANLGQAPA  310
            LSANLGQAPA
Sbjct  70   LSANLGQAPA  79



>gb|EMT20974.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Aegilops 
tauschii]
Length=409

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  110  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  289
            +ARDVC+VGVARTPMG FLG LSSLPATKLGSIAIE+AL+R +VDPSLV+EVFFGNVLSA
Sbjct  15   DARDVCVVGVARTPMGSFLGGLSSLPATKLGSIAIEAALRRANVDPSLVQEVFFGNVLSA  74

Query  290  NLGQAPA  310
            NLGQAPA
Sbjct  75   NLGQAPA  81



>ref|XP_004977186.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Setaria italica]
 ref|XP_004977187.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Setaria italica]
Length=401

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            ++ I  RDVC+VGVARTPMGGFLG+LSSLPATKLGSIAIE+ALKR +VDP+LV+EV+FGN
Sbjct  3    SDGIAPRDVCVVGVARTPMGGFLGALSSLPATKLGSIAIEAALKRANVDPALVQEVYFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>gb|ACJ84564.1| unknown [Medicago truncatula]
 gb|AFK36455.1| unknown [Medicago truncatula]
Length=407

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            I  RDVCIVGVARTPMG FLG+LSS+PATKLGSIAIE+ALKR +VDP++VEEVFFGNVLS
Sbjct  12   IQPRDVCIVGVARTPMGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLS  71

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  72   ANLGQAPA  79



>ref|XP_003618039.1| Acetyl-CoA acetyltransferase, cytosolic [Medicago truncatula]
 gb|AET00998.1| peroxisomal acetoacetyl-coenzyme A thiolase [Medicago truncatula]
Length=407

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            I  RDVCIVGVARTPMG FLG+LSS+PATKLGSIAIE+ALKR +VDP++VEEVFFGNVLS
Sbjct  12   IQPRDVCIVGVARTPMGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLS  71

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  72   ANLGQAPA  79



>ref|XP_006398473.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
 gb|ESQ39926.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
Length=405

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP+ ++ +I  RDVC+VGVARTPMGGFLGSLSS+ AT+LGSIAIE+AL+R  VDP LVE
Sbjct  1    MAPSVSDGSIQPRDVCVVGVARTPMGGFLGSLSSMTATRLGSIAIEAALRRAKVDPRLVE  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVL+ANLGQAPA
Sbjct  61   EVFFGNVLTANLGQAPA  77



>gb|AFK39138.1| unknown [Medicago truncatula]
Length=407

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            I  RDVCIVGVARTPMG FLG+LSS+PATKLGSIAIE+ALKR +VDP++VEEVFFGNVLS
Sbjct  12   IQPRDVCIVGVARTPMGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLS  71

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  72   ANLGQAPA  79



>ref|XP_011008068.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Populus 
euphratica]
Length=401

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            T+  I  RDVC+VGVARTPMG FLGSLSSLPATKLGSIAIE+ALKR +VDPS V+EVFFG
Sbjct  2    TSAEIKPRDVCVVGVARTPMGAFLGSLSSLPATKLGSIAIEAALKRANVDPSTVQEVFFG  61

Query  275  NVLSANLGQAPA  310
            NVL ANLGQAPA
Sbjct  62   NVLCANLGQAPA  73



>dbj|BAD22334.1| putative acetyl-CoA C-acyltransferase [Oryza sativa Japonica 
Group]
 gb|EAZ08304.1| hypothetical protein OsI_30555 [Oryza sativa Indica Group]
 gb|EAZ43919.1| hypothetical protein OsJ_28542 [Oryza sativa Japonica Group]
 dbj|BAG95604.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            ++ I +RDVC+VGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDP+LV+EVFFGN
Sbjct  3    SDNIGSRDVCVVGVARTPMGGFLGALSSLSATKLGSIAIEAALKRANVDPALVQEVFFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>ref|XP_010493636.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Camelina 
sativa]
Length=403

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  95   TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  274
            TA+++N +DVCIVGVARTPM GFLGSLSSLPATKLGS+AI +ALKR +VDP+LV+EV FG
Sbjct  4    TADSVNPKDVCIVGVARTPMSGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  275  NVLSANLGQAPA  310
            NVLSANLGQAPA
Sbjct  64   NVLSANLGQAPA  75



>ref|XP_006857772.1| hypothetical protein AMTR_s00061p00203040 [Amborella trichopoda]
 gb|ERN19239.1| hypothetical protein AMTR_s00061p00203040 [Amborella trichopoda]
Length=459

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAPA  ++++  RDVCIVGVARTPMGG  GSLSSLPATKLGSIAIE ALKR +VDP+ V+
Sbjct  56   MAPAAVSDSLKPRDVCIVGVARTPMGGLCGSLSSLPATKLGSIAIECALKRANVDPAHVQ  115

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  116  EVFFGNVLSANLGQAPA  132



>ref|XP_006660462.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006660463.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Oryza brachyantha]
Length=401

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            ++ + +RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AIE+ALKR +VDP+LV+EVFFGN
Sbjct  3    SDNVGSRDVCVVGVARTPMGGFLGSLSSLSATKLGSVAIEAALKRANVDPALVQEVFFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>ref|XP_004969865.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Setaria 
italica]
Length=401

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            ++ I  RDVC+VGVARTPMGGFLG+LSSLPATKLGSIAIE+ALKR +VDP LV+EV+FGN
Sbjct  3    SDGITPRDVCVVGVARTPMGGFLGALSSLPATKLGSIAIEAALKRANVDPVLVQEVYFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>ref|XP_011095902.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Sesamum indicum]
Length=428

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 69/87 (79%), Gaps = 3/87 (3%)
 Frame = +2

Query  50   HRSSICIH*LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALK  229
            HR S  I    MA    ++I  RDVCIVGVARTPMG FLGSLSSLPATKLGSIAIE AL+
Sbjct  4    HRHSAII---LMASVADDSIKDRDVCIVGVARTPMGSFLGSLSSLPATKLGSIAIECALR  60

Query  230  RGSVDPSLVEEVFFGNVLSANLGQAPA  310
            R  V PS+V+EVFFGNVL+ANLGQAPA
Sbjct  61   RAGVHPSMVQEVFFGNVLTANLGQAPA  87



>ref|XP_010538441.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Tarenaya hassleriana]
Length=404

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MA + ++++  RDVC+VG++RTPMGGFLGSLSSL A KLGSIAIE AL+R +VDPSLVEE
Sbjct  1    MALSVSDSVQPRDVCVVGMSRTPMGGFLGSLSSLTAIKLGSIAIECALRRANVDPSLVEE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_006449942.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
 gb|ESR63182.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
Length=412

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  67   VLSANLGQAPA  77



>ref|XP_010538440.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Tarenaya hassleriana]
Length=414

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MA + ++++  RDVC+VG++RTPMGGFLGSLSSL A KLGSIAIE AL+R +VDPSLVEE
Sbjct  1    MALSVSDSVQPRDVCVVGMSRTPMGGFLGSLSSLTAIKLGSIAIECALRRANVDPSLVEE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_006449941.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
 gb|ESR63181.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
Length=414

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  67   VLSANLGQAPA  77



>ref|XP_011095903.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Sesamum indicum]
 ref|XP_011095904.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Sesamum indicum]
 ref|XP_011095905.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Sesamum indicum]
 ref|XP_011095906.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Sesamum indicum]
Length=417

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MA    ++I  RDVCIVGVARTPMG FLGSLSSLPATKLGSIAIE AL+R  V PS+V+E
Sbjct  1    MASVADDSIKDRDVCIVGVARTPMGSFLGSLSSLPATKLGSIAIECALRRAGVHPSMVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVL+ANLGQAPA
Sbjct  61   VFFGNVLTANLGQAPA  76



>gb|KDO78587.1| hypothetical protein CISIN_1g015003mg [Citrus sinensis]
Length=414

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  67   VLSANLGQAPA  77



>ref|XP_006467262.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
[Citrus sinensis]
Length=414

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  67   VLSANLGQAPA  77



>ref|XP_006449940.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
 gb|ESR63180.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
Length=404

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  67   VLSANLGQAPA  77



>gb|KDO78588.1| hypothetical protein CISIN_1g015003mg [Citrus sinensis]
Length=404

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  67   VLSANLGQAPA  77



>ref|XP_006279490.1| hypothetical protein CARUB_v10026490mg [Capsella rubella]
 gb|EOA12388.1| hypothetical protein CARUB_v10026490mg [Capsella rubella]
Length=414

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP+ + +++  RDVC+VGVARTPMGGFLGSLSSL AT+LGSIAIE++L+R +VDP+LVE
Sbjct  1    MAPSFSDDSVQPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEASLRRANVDPALVE  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVL+ANLGQAPA
Sbjct  61   EVFFGNVLTANLGQAPA  77



>dbj|BAF98277.1| acetyl-CoA C-acetyltransferase [Hevea brasiliensis]
Length=408

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            I  RDVCIVGVARTPMGGFLGSL +L ATKLGSIAIE+ALKR +VDPSLV+EVFFGNVLS
Sbjct  13   IKPRDVCIVGVARTPMGGFLGSLCTLSATKLGSIAIEAALKRANVDPSLVQEVFFGNVLS  72

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  73   ANLGQAPA  80



>tpg|DAA47710.1| TPA: hypothetical protein ZEAMMB73_220204 [Zea mays]
Length=394

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            I  RDVC+VGVARTP+GGFLG+LSSLPATKLGSIAIE+ALKR +VDP+LV+EVFFGNVLS
Sbjct  6    IAPRDVCVVGVARTPLGGFLGALSSLPATKLGSIAIEAALKRANVDPALVQEVFFGNVLS  65

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  66   ANLGQAPA  73



>ref|XP_008342241.1| PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA acetyltransferase, 
cytosolic 1-like [Malus domestica]
Length=408

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 69/80 (86%), Gaps = 4/80 (5%)
 Frame = +2

Query  83   MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  250
            MAP  AE    +I  RDV IVGVARTPMGGFLG+LSS+PATKLGSIAI +ALKR +VDP+
Sbjct  1    MAPVAAEACSDSIKPRDVYIVGVARTPMGGFLGALSSVPATKLGSIAIGAALKRANVDPA  60

Query  251  LVEEVFFGNVLSANLGQAPA  310
            LVEEVFFGNVLSANLGQAPA
Sbjct  61   LVEEVFFGNVLSANLGQAPA  80



>ref|NP_001266315.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
 gb|ACG34735.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
Length=401

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            I  RDVC+VGVARTP+GGFLG+LSSLPATKLGSIAIE+ALKR +VDP+LV+EVFFGNVLS
Sbjct  6    IAPRDVCVVGVARTPLGGFLGALSSLPATKLGSIAIEAALKRANVDPALVQEVFFGNVLS  65

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  66   ANLGQAPA  73



>gb|ACF85124.1| unknown [Zea mays]
 tpg|DAA47708.1| TPA: acetoacetyl CoA thiolase isoform 1 [Zea mays]
 tpg|DAA47709.1| TPA: acetoacetyl CoA thiolase isoform 2 [Zea mays]
Length=401

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            I  RDVC+VGVARTP+GGFLG+LSSLPATKLGSIAIE+ALKR +VDP+LV+EVFFGNVLS
Sbjct  6    IAPRDVCVVGVARTPLGGFLGALSSLPATKLGSIAIEAALKRANVDPALVQEVFFGNVLS  65

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  66   ANLGQAPA  73



>ref|XP_004507588.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
isoform X2 [Cicer arietinum]
Length=408

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  110  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  289
             +RDVCIVGVARTPMGGFLGSLSSL AT+LGSIAI SALKR +VDPSLV+EVFFGNVLSA
Sbjct  4    QSRDVCIVGVARTPMGGFLGSLSSLSATQLGSIAINSALKRANVDPSLVQEVFFGNVLSA  63

Query  290  NLGQAPA  310
            NLGQAPA
Sbjct  64   NLGQAPA  70



>gb|AEI27246.1| putative acetyl-CoA-C-acetyltransferase [Vanda hybrid cultivar]
Length=376

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  92   ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  271
            A  + +  RDVCIVGVARTP+G FLGSLSSLPATKLGSI IESAL+R +VDP+LV+EV+F
Sbjct  5    AVHDELKPRDVCIVGVARTPIGAFLGSLSSLPATKLGSIVIESALRRANVDPTLVQEVYF  64

Query  272  GNVLSANLGQAPA  310
            GNVLSANLGQAPA
Sbjct  65   GNVLSANLGQAPA  77



>ref|XP_004507587.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
isoform X1 [Cicer arietinum]
Length=433

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  110  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  289
             +RDVCIVGVARTPMGGFLGSLSSL AT+LGSIAI SALKR +VDPSLV+EVFFGNVLSA
Sbjct  4    QSRDVCIVGVARTPMGGFLGSLSSLSATQLGSIAINSALKRANVDPSLVQEVFFGNVLSA  63

Query  290  NLGQAPA  310
            NLGQAPA
Sbjct  64   NLGQAPA  70



>ref|XP_010647164.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X3 [Vitis vinifera]
Length=404

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 2/76 (3%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP   ++I  RDVCIVGVARTPMGGFLG LSSL ATKLGSIAI  AL+R ++DPSLV+E
Sbjct  1    MAPH--DSIKPRDVCIVGVARTPMGGFLGFLSSLSATKLGSIAIRGALRRANIDPSLVQE  58

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  59   VFFGNVLSANLGQAPA  74



>ref|XP_010647165.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X4 [Vitis vinifera]
Length=401

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 2/76 (3%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP   ++I  RDVCIVGVARTPMGGFLG LSSL ATKLGSIAI  AL+R ++DPSLV+E
Sbjct  1    MAPH--DSIKPRDVCIVGVARTPMGGFLGFLSSLSATKLGSIAIRGALRRANIDPSLVQE  58

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  59   VFFGNVLSANLGQAPA  74



>ref|XP_002865105.1| hypothetical protein ARALYDRAFT_494196 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41364.1| hypothetical protein ARALYDRAFT_494196 [Arabidopsis lyrata subsp. 
lyrata]
Length=415

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP  ++ ++  RDVC+VGVARTP+GGFLGSLSSL AT+LGSIAI++ALKR  VDP+LVE
Sbjct  1    MAPHVSDDSLQPRDVCVVGVARTPIGGFLGSLSSLTATRLGSIAIQAALKRAHVDPALVE  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVL+ANLGQAPA
Sbjct  61   EVFFGNVLTANLGQAPA  77



>ref|XP_003635396.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Vitis vinifera]
 emb|CBI33249.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 2/76 (3%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP   ++I  RDVCIVGVARTPMGGFLG LSSL ATKLGSIAI  AL+R ++DPSLV+E
Sbjct  1    MAPH--DSIKPRDVCIVGVARTPMGGFLGFLSSLSATKLGSIAIRGALRRANIDPSLVQE  58

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  59   VFFGNVLSANLGQAPA  74



>ref|XP_010647163.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Vitis vinifera]
Length=404

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 2/76 (3%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP   ++I  RDVCIVGVARTPMGGFLG LSSL ATKLGSIAI  AL+R ++DPSLV+E
Sbjct  1    MAPH--DSIKPRDVCIVGVARTPMGGFLGFLSSLSATKLGSIAIRGALRRANIDPSLVQE  58

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  59   VFFGNVLSANLGQAPA  74



>ref|XP_006350251.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
[Solanum tuberosum]
Length=414

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MA    ++I  +DVCIVGVARTPMGGFLGSLSSL AT+LGS AI +ALKR +VDPSLV+E
Sbjct  1    MAKMVQDSIKLQDVCIVGVARTPMGGFLGSLSSLSATELGSAAIRAALKRANVDPSLVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>ref|XP_006600286.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X3 [Glycine max]
Length=423

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  80   AMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            A +P+ +  + +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI++ALKR +VDPSLV+
Sbjct  19   ARSPSMSTCVKSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQ  78

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  79   EVFFGNVLSANLGQAPA  95



>ref|XP_006600285.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Glycine max]
Length=432

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  80   AMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            A +P+ +  + +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI++ALKR +VDPSLV+
Sbjct  19   ARSPSMSTCVKSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQ  78

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  79   EVFFGNVLSANLGQAPA  95



>ref|XP_004236650.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
[Solanum lycopersicum]
Length=414

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MA    ++I  +DVCIVGVARTPMGGFLGSLSSL AT+LGS AI +ALKR +VDPSLV+E
Sbjct  1    MAKMVQDSIKPQDVCIVGVARTPMGGFLGSLSSLSATELGSAAIRAALKRANVDPSLVQE  60

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  61   VFFGNVLSANLGQAPA  76



>gb|AFI57868.1| acetoacetyl-CoA thiolase, partial [Elaeis guineensis]
Length=282

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP+   + +  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AI+ ALKR +V+P+LV+
Sbjct  1    MAPSGVYDDLKPRDVCIVGVARTPMGGFLGALSSLSATKLGSVAIQCALKRANVEPALVQ  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  61   EVFFGNVLSANLGQAPA  77



>gb|ABD57973.1| acetoacetyl-coenzyme A thiolase [Arnebia euchroma]
Length=419

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            ++I  RDVCIVGVARTPMGGFLGSLSSL AT+LGSIAI+SALKR +VDPSLV+EV FGNV
Sbjct  4    DSIKPRDVCIVGVARTPMGGFLGSLSSLSATELGSIAIKSALKRANVDPSLVQEVIFGNV  63

Query  281  LSANLGQAPA  310
            LSANLGQAPA
Sbjct  64   LSANLGQAPA  73



>gb|ACU18264.1| unknown [Glycine max]
Length=204

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            + +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI++ALKR +VDPSLV+EVFFGNVLS
Sbjct  5    VKSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQEVFFGNVLS  64

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  65   ANLGQAPA  72



>gb|ABM66459.1| acetyl CoA C-acetyltranseferase [Brassica juncea]
Length=189

 Score =   114 bits (286),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            +  RDVC+VGVARTPMG FLGSLSSL A +LGSIAIE+AL+R +VDPSLVEEVFFGNVL+
Sbjct  8    VQPRDVCVVGVARTPMGDFLGSLSSLTAPRLGSIAIEAALRRANVDPSLVEEVFFGNVLT  67

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  68   ANLGQAPA  75



>ref|XP_010675964.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Beta 
vulgaris subsp. vulgaris]
Length=417

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            ++I  RDVCIVGVARTPMGG LGSLS+L ATKLGS+AIE AL+R  VDPSLV+EVFFGNV
Sbjct  10   QSIKPRDVCIVGVARTPMGGLLGSLSTLSATKLGSVAIECALRRARVDPSLVQEVFFGNV  69

Query  281  LSANLGQAPA  310
            LSANLGQAPA
Sbjct  70   LSANLGQAPA  79



>ref|XP_008782420.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Phoenix 
dactylifera]
 ref|XP_008782421.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Phoenix 
dactylifera]
Length=415

 Score =   117 bits (293),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPAT-AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP+   + +N RDVCIVGVARTPMGGFLG+LSSL ATKLGSI I+ ALKR +VD +LV+
Sbjct  1    MAPSGFCDDLNPRDVCIVGVARTPMGGFLGALSSLSATKLGSIVIQCALKRANVDTTLVQ  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  61   EVFFGNVLSANLGQAPA  77



>gb|ACU15722.1| unknown [Glycine max]
Length=196

 Score =   113 bits (283),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  110  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  289
             +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI+SAL+R +VDPSLV+EVFFGNVLSA
Sbjct  6    KSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKSALERANVDPSLVQEVFFGNVLSA  65

Query  290  NLGQAPA  310
            NLGQAPA
Sbjct  66   NLGQAPA  72



>ref|NP_199583.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 ref|NP_974901.2| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 sp|Q9FIK7.1|THIC2_ARATH RecName: Full=Probable acetyl-CoA acetyltransferase, cytosolic 
2; AltName: Full=Cytosolic acetoacetyl-CoA thiolase 2; Short=Thiolase 
2 [Arabidopsis thaliana]
 dbj|BAB11319.1| acetoacyl-CoA-thiolase [Arabidopsis thaliana]
 gb|AAM67058.1| acetoacyl-CoA-thiolase [Arabidopsis thaliana]
 gb|ABM06028.1| At5g47720 [Arabidopsis thaliana]
 dbj|BAH19561.1| AT5G47720 [Arabidopsis thaliana]
 gb|AED95559.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AED95560.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=415

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  89   PATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVF  268
            P + +++  RDVC+VGVARTP+G FLGSLSSL AT+LGSIAI++ALKR  VDP+LVEEVF
Sbjct  4    PVSDDSLQPRDVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVDPALVEEVF  63

Query  269  FGNVLSANLGQAPA  310
            FGNVL+ANLGQAPA
Sbjct  64   FGNVLTANLGQAPA  77



>ref|XP_010936771.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Elaeis 
guineensis]
 ref|XP_010936772.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Elaeis 
guineensis]
Length=415

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = +2

Query  83   MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  259
            MAP+   + +  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AI+ ALKR +V+P+LV+
Sbjct  1    MAPSGVYDDLKPRDVCIVGVARTPMGGFLGALSSLSATKLGSVAIQCALKRANVEPALVQ  60

Query  260  EVFFGNVLSANLGQAPA  310
            EVFFGNVLSANLGQAPA
Sbjct  61   EVFFGNVLSANLGQAPA  77



>ref|NP_851150.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 ref|NP_974900.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AED95558.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AED95561.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=405

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  89   PATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVF  268
            P + +++  RDVC+VGVARTP+G FLGSLSSL AT+LGSIAI++ALKR  VDP+LVEEVF
Sbjct  4    PVSDDSLQPRDVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVDPALVEEVF  63

Query  269  FGNVLSANLGQAPA  310
            FGNVL+ANLGQAPA
Sbjct  64   FGNVLTANLGQAPA  77



>ref|XP_010039422.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Eucalyptus 
grandis]
 gb|KCW45974.1| hypothetical protein EUGRSUZ_L00148 [Eucalyptus grandis]
Length=413

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MA A+ E+I  +DVCIVGVARTPMGG LGSLSS  AT+LGSIAI+ ALKR +VDP+LV+E
Sbjct  1    MASAS-ESIRPQDVCIVGVARTPMGGLLGSLSSFSATQLGSIAIQCALKRANVDPALVQE  59

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  60   VFFGNVLSANLGQAPA  75



>gb|KEH32696.1| peroxisomal acetoacetyl-coenzyme A thiolase [Medicago truncatula]
Length=298

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  110  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  289
             +RDVCIVGV RTPMGGFLGSLSSL AT LGS+AI++ALKR +VDPSLV+EVFFGNVLSA
Sbjct  4    KSRDVCIVGVGRTPMGGFLGSLSSLSATHLGSLAIKAALKRANVDPSLVQEVFFGNVLSA  63

Query  290  NLGQAPA  310
            NLGQAPA
Sbjct  64   NLGQAPA  70



>gb|AEZ55671.1| acetyl-CoA C-acetyltransferase 2 [Salvia miltiorrhiza]
Length=403

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  119  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  298
            DVCIVGVARTP+GGFLGSLSSLPATKLGSIAI  ALKR  VDPSLV+EVFFGNVLSANLG
Sbjct  9    DVCIVGVARTPIGGFLGSLSSLPATKLGSIAIACALKRAGVDPSLVQEVFFGNVLSANLG  68

Query  299  QAPA  310
            QAPA
Sbjct  69   QAPA  72



>ref|XP_008384190.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Malus domestica]
Length=405

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  86   APATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEV  265
            +P++++ I+ RDVCIVGVARTPMGGFLGSLSS  AT LGS+AI+ ALKR +VDPSLV+EV
Sbjct  3    SPSSSDPIHPRDVCIVGVARTPMGGFLGSLSSFSATHLGSLAIQCALKRANVDPSLVQEV  62

Query  266  FFGNVLSANLGQ  301
            FFGNVLSANLGQ
Sbjct  63   FFGNVLSANLGQ  74



>ref|XP_008384188.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Malus domestica]
 ref|XP_008384189.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Malus domestica]
Length=416

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  86   APATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEV  265
            +P++++ I+ RDVCIVGVARTPMGGFLGSLSS  AT LGS+AI+ ALKR +VDPSLV+EV
Sbjct  3    SPSSSDPIHPRDVCIVGVARTPMGGFLGSLSSFSATHLGSLAIQCALKRANVDPSLVQEV  62

Query  266  FFGNVLSANLGQ  301
            FFGNVLSANLGQ
Sbjct  63   FFGNVLSANLGQ  74



>ref|XP_009396114.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009396123.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Musa 
acuminata subsp. malaccensis]
Length=401

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            ++ I  RDVC+VGVARTPMG FLG+LSSL ATKLGS+AIE ALKR  +DP+LV+EVFFGN
Sbjct  3    SDLIQPRDVCVVGVARTPMGSFLGALSSLSATKLGSVAIECALKRAGIDPALVQEVFFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>ref|XP_003637597.1| Acetyl-CoA acetyltransferase cytosolic [Medicago truncatula]
 gb|KEH32694.1| peroxisomal acetoacetyl-coenzyme A thiolase [Medicago truncatula]
Length=408

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  110  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  289
             +RDVCIVGV RTPMGGFLGSLSSL AT LGS+AI++ALKR +VDPSLV+EVFFGNVLSA
Sbjct  4    KSRDVCIVGVGRTPMGGFLGSLSSLSATHLGSLAIKAALKRANVDPSLVQEVFFGNVLSA  63

Query  290  NLGQAPA  310
            NLGQAPA
Sbjct  64   NLGQAPA  70



>ref|XP_009374846.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Pyrus x bretschneideri]
Length=405

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  89   PATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVF  268
            P++++ I+ RDVCIVGVARTPMGGFLGSLSS  AT LGS+AI+ ALKR +VDPSLV+EVF
Sbjct  4    PSSSDPIHPRDVCIVGVARTPMGGFLGSLSSFSATHLGSLAIQCALKRANVDPSLVQEVF  63

Query  269  FGNVLSANLGQ  301
            FGNVLSANLGQ
Sbjct  64   FGNVLSANLGQ  74



>ref|XP_009374845.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Pyrus x bretschneideri]
Length=416

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  89   PATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVF  268
            P++++ I+ RDVCIVGVARTPMGGFLGSLSS  AT LGS+AI+ ALKR +VDPSLV+EVF
Sbjct  4    PSSSDPIHPRDVCIVGVARTPMGGFLGSLSSFSATHLGSLAIQCALKRANVDPSLVQEVF  63

Query  269  FGNVLSANLGQ  301
            FGNVLSANLGQ
Sbjct  64   FGNVLSANLGQ  74



>ref|NP_851154.1| acetoacetyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAL24148.1| putative acetyl-CoA C-acetyltransferase [Arabidopsis thaliana]
 gb|AAM14210.1| putative acetyl-CoA C-acetyltransferase [Arabidopsis thaliana]
 gb|AED95639.1| acetoacetyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=398

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  104  TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVL  283
             ++  DVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDP+LV+EV FGNVL
Sbjct  2    NVDESDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFGNVL  61

Query  284  SANLGQAPA  310
            SANLGQAPA
Sbjct  62   SANLGQAPA  70



>ref|XP_003565785.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Brachypodium 
distachyon]
Length=417

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 4/80 (5%)
 Frame = +2

Query  83   MAPATA----ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  250
            MAP +     E +N RDVC+VGVARTP+G  LGSLSSLPATKLGS+AI+ AL+R SVDP+
Sbjct  1    MAPPSTSGGHEGLNPRDVCVVGVARTPIGALLGSLSSLPATKLGSVAIQGALRRASVDPA  60

Query  251  LVEEVFFGNVLSANLGQAPA  310
            LV+EVF GNVLSANLGQAPA
Sbjct  61   LVQEVFMGNVLSANLGQAPA  80



>ref|XP_008811276.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008811277.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Phoenix dactylifera]
Length=401

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            ++ I  RDVC+VG+ARTPMGGFLG+LS+L ATKLGSI IESALKR +V P+LV+EVFFGN
Sbjct  3    SDQIKPRDVCVVGIARTPMGGFLGALSTLSATKLGSIVIESALKRANVAPALVQEVFFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>ref|XP_007026385.1| Thiolase family protein isoform 1 [Theobroma cacao]
 ref|XP_007026386.1| Thiolase family protein isoform 1 [Theobroma cacao]
 ref|XP_007026387.1| Thiolase family protein isoform 1 [Theobroma cacao]
 gb|EOY29007.1| Thiolase family protein isoform 1 [Theobroma cacao]
 gb|EOY29008.1| Thiolase family protein isoform 1 [Theobroma cacao]
 gb|EOY29009.1| Thiolase family protein isoform 1 [Theobroma cacao]
Length=422

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            I  RDVCIVGVARTPMG FLGSLSS  AT+LGSIAI SALKR ++DPSLV+EVFFGNVLS
Sbjct  17   IRPRDVCIVGVARTPMGAFLGSLSSFSATQLGSIAIHSALKRANLDPSLVQEVFFGNVLS  76

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  77   ANLGQAPA  84



>ref|NP_001148667.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
 ref|XP_008676213.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Zea mays]
 gb|ACF78705.1| unknown [Zea mays]
 gb|ACF87104.1| unknown [Zea mays]
 gb|ACG32450.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
 gb|ACG34415.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
 tpg|DAA45681.1| TPA: acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
Length=401

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            ++ I  RDVC+VGVARTPMGGFLG+LS LPATKLGSI I++AL+R +VDP+LV+EV+FGN
Sbjct  3    SDGIGPRDVCVVGVARTPMGGFLGALSPLPATKLGSIVIQAALERANVDPALVQEVYFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>ref|XP_009412114.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412121.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            +E I  RDVC+VG+ARTPMGGFLG+LSSL AT+LGSIAI+ AL R ++DP+LV+EVFFGN
Sbjct  3    SEQIKPRDVCVVGIARTPMGGFLGALSSLSATQLGSIAIKHALARANLDPALVQEVFFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>ref|XP_009412128.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=401

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            +E I  RDVC+VG+ARTPMGGFLG+LSSL AT+LGSIAI+ AL R ++DP+LV+EVFFGN
Sbjct  3    SEQIKPRDVCVVGIARTPMGGFLGALSSLSATQLGSIAIKHALARANLDPALVQEVFFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>ref|XP_010942603.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Elaeis 
guineensis]
 ref|XP_010942604.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Elaeis 
guineensis]
Length=401

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            ++ I  RDVC+VGVARTPMGGFLG+LSSL ATKLGS+AI+ ALKR +V P+LV+EVFFGN
Sbjct  3    SDQIKPRDVCVVGVARTPMGGFLGALSSLSATKLGSVAIDCALKRANVAPALVQEVFFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>ref|XP_003551110.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Glycine max]
Length=409

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            + +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI++ALKR +VDPSLV+EVFFGNVLS
Sbjct  5    VKSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQEVFFGNVLS  64

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  65   ANLGQAPA  72



>ref|XP_010087672.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Morus notabilis]
 gb|EXB29565.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Morus notabilis]
Length=434

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            I  RDVCIVGVARTP+GGFLGSLSSL AT+LGS+AI++AL+R  V+PSLV+EVFFGNVLS
Sbjct  12   IKPRDVCIVGVARTPIGGFLGSLSSLSATQLGSVAIKAALRRAGVEPSLVQEVFFGNVLS  71

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  72   ANLGQAPA  79



>ref|XP_009399870.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009399878.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            +E I  RDVC+VGVARTPMGGFLG+LSSL A +LGS+AI+ AL+R ++DP+LV+EVFFGN
Sbjct  3    SEKIKPRDVCVVGVARTPMGGFLGALSSLSAMQLGSMAIKYALRRANIDPALVQEVFFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>ref|XP_009399886.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=401

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            +E I  RDVC+VGVARTPMGGFLG+LSSL A +LGS+AI+ AL+R ++DP+LV+EVFFGN
Sbjct  3    SEKIKPRDVCVVGVARTPMGGFLGALSSLSAMQLGSMAIKYALRRANIDPALVQEVFFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>ref|NP_001141874.1| acetyl-CoA acetyltransferase, cytosolic 2 isoform 1 [Zea mays]
 ref|XP_008654617.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 2 isoform 
1 isoform X1 [Zea mays]
 gb|ACF87213.1| unknown [Zea mays]
 gb|ACG39847.1| acetyl-CoA acetyltransferase, cytosolic 2 [Zea mays]
 gb|ACR34643.1| unknown [Zea mays]
 gb|AFW79796.1| acetyl-CoA acetyltransferase, cytosolic 2 isoform 1 [Zea mays]
 gb|AFW79797.1| acetyl-CoA acetyltransferase, cytosolic 2 isoform 2 [Zea mays]
Length=421

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            ++ + ARD CIVGVARTP+G  LGSLSSLPATKLGSIAI+ ALKR  VDP+LV+EVF GN
Sbjct  14   SQGLKARDACIVGVARTPIGALLGSLSSLPATKLGSIAIQGALKRAKVDPALVQEVFMGN  73

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  74   VLSANLGQAPA  84



>ref|XP_003529679.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Glycine max]
Length=400

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  110  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  289
             +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI+SAL+R +VDPSLV+EVFFGNVLSA
Sbjct  6    KSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKSALERANVDPSLVQEVFFGNVLSA  65

Query  290  NLGQAPA  310
            NLGQAPA
Sbjct  66   NLGQAPA  72



>ref|XP_004967971.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Setaria italica]
Length=413

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            + ARDVCIVGVARTP+G  LGSLSSLPATKLGSIAI+ AL+R +VDP+LV+EVF GNVLS
Sbjct  17   LKARDVCIVGVARTPIGALLGSLSSLPATKLGSIAIQGALRRANVDPALVQEVFMGNVLS  76

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  77   ANLGQAPA  84



>ref|XP_004967970.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Setaria italica]
Length=421

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            + ARDVCIVGVARTP+G  LGSLSSLPATKLGSIAI+ AL+R +VDP+LV+EVF GNVLS
Sbjct  17   LKARDVCIVGVARTPIGALLGSLSSLPATKLGSIAIQGALRRANVDPALVQEVFMGNVLS  76

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  77   ANLGQAPA  84



>ref|XP_010088359.1| Acetyl-CoA acetyltransferase, cytosolic 1 [Morus notabilis]
 gb|EXB34477.1| Acetyl-CoA acetyltransferase, cytosolic 1 [Morus notabilis]
Length=399

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  119  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  298
            DVCIVGVARTPMGGFLG+LSSL ATKLGSI IE+ALKR  V+PSLV+EVFFGNVLSANLG
Sbjct  8    DVCIVGVARTPMGGFLGALSSLSATKLGSIVIEAALKRAGVNPSLVQEVFFGNVLSANLG  67

Query  299  QAPA  310
            QAPA
Sbjct  68   QAPA  71



>ref|XP_006584106.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Glycine max]
Length=409

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  110  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  289
             +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI+SAL+R +VDPSLV+EVFFGNVLSA
Sbjct  6    KSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKSALERANVDPSLVQEVFFGNVLSA  65

Query  290  NLGQAPA  310
            NLGQAPA
Sbjct  66   NLGQAPA  72



>ref|XP_008654616.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 2 isoform 
1 isoform X3 [Zea mays]
Length=451

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            ++ + ARD CIVGVARTP+G  LGSLSSLPATKLGSIAI+ ALKR  VDP+LV+EVF GN
Sbjct  14   SQGLKARDACIVGVARTPIGALLGSLSSLPATKLGSIAIQGALKRAKVDPALVQEVFMGN  73

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  74   VLSANLGQAPA  84



>ref|XP_010092017.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Morus notabilis]
 gb|EXB49753.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Morus notabilis]
Length=407

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            RDVCIVGVARTP+GGFLGSLSSL AT+LGS+AI++AL+R  V+PSLV+EVFFGNVLSANL
Sbjct  15   RDVCIVGVARTPIGGFLGSLSSLSATQLGSVAIKAALRRAGVEPSLVQEVFFGNVLSANL  74

Query  296  GQAPA  310
            GQAPA
Sbjct  75   GQAPA  79



>gb|KHN42262.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Glycine soja]
Length=419

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  110  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  289
             +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI+SAL+R +VDPSLV+EVFFGNVLSA
Sbjct  6    KSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKSALERANVDPSLVQEVFFGNVLSA  65

Query  290  NLGQAPA  310
            NLGQAPA
Sbjct  66   NLGQAPA  72



>ref|XP_008654615.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 2 isoform 
1 isoform X2 [Zea mays]
Length=467

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            ++ + ARD CIVGVARTP+G  LGSLSSLPATKLGSIAI+ ALKR  VDP+LV+EVF GN
Sbjct  14   SQGLKARDACIVGVARTPIGALLGSLSSLPATKLGSIAIQGALKRAKVDPALVQEVFMGN  73

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  74   VLSANLGQAPA  84



>gb|KEH32695.1| peroxisomal acetoacetyl-coenzyme A thiolase [Medicago truncatula]
Length=415

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  119  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  298
            DVCIVGV RTPMGGFLGSLSSL AT LGS+AI++ALKR +VDPSLV+EVFFGNVLSANLG
Sbjct  14   DVCIVGVGRTPMGGFLGSLSSLSATHLGSLAIKAALKRANVDPSLVQEVFFGNVLSANLG  73

Query  299  QAPA  310
            QAPA
Sbjct  74   QAPA  77



>gb|AHZ96597.1| acetyl-CoA C-acetyl transferase [Aquilaria sinensis]
Length=411

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  277
            +++I  RDVCIVGVARTP+G FLG+LSSL AT LGS+AI +ALKR +VDPSLV+EVFFGN
Sbjct  3    SDSIRPRDVCIVGVARTPVGSFLGALSSLSATFLGSVAIRAALKRANVDPSLVQEVFFGN  62

Query  278  VLSANLGQAPA  310
            VLSANLGQAPA
Sbjct  63   VLSANLGQAPA  73



>dbj|BAH57117.1| AT5G47720 [Arabidopsis thaliana]
Length=396

 Score =   111 bits (278),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  119  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  298
            DVC+VGVARTP+G FLGSLSSL AT+LGSIAI++ALKR  VDP+LVEEVFFGNVL+ANLG
Sbjct  21   DVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVDPALVEEVFFGNVLTANLG  80

Query  299  QAPA  310
            QAPA
Sbjct  81   QAPA  84



>gb|EEC69797.1| hypothetical protein OsI_00091 [Oryza sativa Indica Group]
Length=416

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 68/79 (86%), Gaps = 3/79 (4%)
 Frame = +2

Query  83   MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  253
            MAP   + ++ +  RDVCIVGVARTP+G  LGSLSSLPATKLGS+AI++AL+R +V+P+L
Sbjct  1    MAPPPHSDSDLLKPRDVCIVGVARTPIGALLGSLSSLPATKLGSVAIQAALRRANVEPAL  60

Query  254  VEEVFFGNVLSANLGQAPA  310
            V+EVF GNVLSANLGQAPA
Sbjct  61   VQEVFMGNVLSANLGQAPA  79



>ref|NP_001041797.1| Os01g0110400 [Oryza sativa Japonica Group]
 dbj|BAB39872.1| putative acetoacetyl-coenzyme A thiolase [Oryza sativa Japonica 
Group]
 dbj|BAF03711.1| Os01g0110400 [Oryza sativa Japonica Group]
 dbj|BAG95946.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53732.1| hypothetical protein OsJ_00082 [Oryza sativa Japonica Group]
Length=416

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 68/79 (86%), Gaps = 3/79 (4%)
 Frame = +2

Query  83   MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  253
            MAP   + ++ +  RDVCIVGVARTP+G  LGSLSSLPATKLGS+AI++AL+R +V+P+L
Sbjct  1    MAPPPHSDSDLLKPRDVCIVGVARTPIGALLGSLSSLPATKLGSVAIQAALRRANVEPAL  60

Query  254  VEEVFFGNVLSANLGQAPA  310
            V+EVF GNVLSANLGQAPA
Sbjct  61   VQEVFMGNVLSANLGQAPA  79



>emb|CDM80037.1| unnamed protein product [Triticum aestivum]
 emb|CDM80063.1| unnamed protein product [Triticum aestivum]
Length=418

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            ++ RDVC+VGVARTP+G  LGSLSSLPAT+LGS+AI+ AL+R SVDP+LV+EVF GNVLS
Sbjct  14   LDPRDVCVVGVARTPIGALLGSLSSLPATRLGSVAIQGALRRASVDPALVQEVFMGNVLS  73

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  74   ANLGQAPA  81



>ref|NP_001032028.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AED95562.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=412

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  119  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  298
            DVC+VGVARTP+G FLGSLSSL AT+LGSIAI++ALKR  VDP+LVEEVFFGNVL+ANLG
Sbjct  21   DVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVDPALVEEVFFGNVLTANLG  80

Query  299  QAPA  310
            QAPA
Sbjct  81   QAPA  84



>emb|CDY25950.1| BnaC09g20370D [Brassica napus]
Length=415

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            +++  +DVC+VGVARTPMG FLGSLSS+ A +LGSIAIE+ALKR +V+P+LVEEVFFGNV
Sbjct  8    QSVQPQDVCVVGVARTPMGDFLGSLSSITAPRLGSIAIEAALKRANVEPALVEEVFFGNV  67

Query  281  LSANLGQAPA  310
            L+ANLGQAPA
Sbjct  68   LTANLGQAPA  77



>gb|KHN03551.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Glycine soja]
Length=422

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +2

Query  119  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  298
            DVCIVGVARTP+GG LG+LSSL AT+LGSIAI++ALKR +VDPSLV+EVFFGNVLSANLG
Sbjct  22   DVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQEVFFGNVLSANLG  81

Query  299  QAPA  310
            QAPA
Sbjct  82   QAPA  85



>ref|XP_002968816.1| hypothetical protein SELMODRAFT_146037 [Selaginella moellendorffii]
 gb|EFJ29932.1| hypothetical protein SELMODRAFT_146037 [Selaginella moellendorffii]
Length=419

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  86   APATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEV  265
            AP+ +  I  RD CIVGVARTPMGG  GSLS+L ATKLGSIAI+ A+ R  +DP+LV+EV
Sbjct  7    APSESSPIGPRDACIVGVARTPMGGLSGSLSALAATKLGSIAIQGAIARAGIDPALVQEV  66

Query  266  FFGNVLSANLGQAPA  310
            FFGNVLSANLGQAPA
Sbjct  67   FFGNVLSANLGQAPA  81



>gb|EMS66391.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Triticum 
urartu]
Length=523

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 12/83 (14%)
 Frame = +2

Query  98   AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAI------------ESALKRGSV  241
            ++ I  RDVC+VGVARTPMGGFLG+LSSL ATKLGS+AI            E+ALKR +V
Sbjct  96   SDNIGPRDVCVVGVARTPMGGFLGALSSLSATKLGSVAIEGEISIFSICPREAALKRANV  155

Query  242  DPSLVEEVFFGNVLSANLGQAPA  310
            DPSLV+EVFFGNVLSANLGQAPA
Sbjct  156  DPSLVQEVFFGNVLSANLGQAPA  178



>ref|XP_002974156.1| hypothetical protein SELMODRAFT_173909 [Selaginella moellendorffii]
 gb|EFJ25111.1| hypothetical protein SELMODRAFT_173909 [Selaginella moellendorffii]
Length=409

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  86   APATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEV  265
            AP+ +  I  RD CIVGVARTPMGG  GSLS+L ATKLGSIAI+ A+ R  +DP+LV+EV
Sbjct  7    APSESSPIGPRDACIVGVARTPMGGLSGSLSALAATKLGSIAIQGAIARAGIDPALVQEV  66

Query  266  FFGNVLSANLGQAPA  310
            FFGNVLSANLGQAPA
Sbjct  67   FFGNVLSANLGQAPA  81



>gb|EMT15552.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Aegilops 
tauschii]
Length=452

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            ++ RDVC+VGVARTP+G  LGSLSSLPAT+LGS+AI+ AL+R SVDP+LV+EVF GNVLS
Sbjct  14   LDPRDVCVVGVARTPIGALLGSLSSLPATRLGSVAIQGALRRASVDPALVQEVFMGNVLS  73

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  74   ANLGQAPA  81



>ref|XP_009114253.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Brassica rapa]
 ref|XP_009114254.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Brassica rapa]
 emb|CDY41065.1| BnaA09g18440D [Brassica napus]
Length=415

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            +++  +DVC+VGVARTPMG FLGSLSS+ A +LGSIAIE+ALK  +V+P+LVEEVFFGNV
Sbjct  8    QSVQPQDVCVVGVARTPMGDFLGSLSSITAPRLGSIAIEAALKSANVEPALVEEVFFGNV  67

Query  281  LSANLGQAPA  310
            L+ANLGQAPA
Sbjct  68   LTANLGQAPA  77



>ref|XP_009114255.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Brassica rapa]
Length=405

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            +++  +DVC+VGVARTPMG FLGSLSS+ A +LGSIAIE+ALK  +V+P+LVEEVFFGNV
Sbjct  8    QSVQPQDVCVVGVARTPMGDFLGSLSSITAPRLGSIAIEAALKSANVEPALVEEVFFGNV  67

Query  281  LSANLGQAPA  310
            L+ANLGQAPA
Sbjct  68   LTANLGQAPA  77



>gb|ACN40771.1| unknown [Picea sitchensis]
Length=404

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            +++  RDVCIVGVARTP+GG  GSLS+LPATKLGSI I +ALKR  V+  +V+EVFFGNV
Sbjct  8    DSLKPRDVCIVGVARTPLGGLSGSLSTLPATKLGSITIAAALKRAGVESGMVQEVFFGNV  67

Query  281  LSANLGQAPA  310
            LSANLGQAPA
Sbjct  68   LSANLGQAPA  77



>emb|CAA55006.1| Acetoacetyl-coenzyme A thiolase [Raphanus sativus]
Length=406

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MA +   + N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR  +     +E
Sbjct  1    MAHSADSSDNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSLAITAALKREMLTRLWSKE  60

Query  263  VFFGNVLSANLGQAPA  310
            V FGNVLSANLGQAPA
Sbjct  61   VVFGNVLSANLGQAPA  76



>gb|ACN41149.1| unknown [Picea sitchensis]
Length=404

 Score =   103 bits (256),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +2

Query  104  TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVL  283
            ++  RDVCIVGVARTP+GG  GSLS+L ATKLGSIAI +ALKR  V+  +V+EVFFGNVL
Sbjct  9    SLKPRDVCIVGVARTPLGGLSGSLSTLSATKLGSIAIVAALKRAGVESGMVQEVFFGNVL  68

Query  284  SANLGQAPA  310
            SANLGQAPA
Sbjct  69   SANLGQAPA  77



>gb|EPS62555.1| hypothetical protein M569_12233, partial [Genlisea aurea]
Length=348

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  77   LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLV  256
            + MA    +++ A+DVCIVGVARTP+G FLGSLSSL ATKLGS+AIE ALKR  VDPS+V
Sbjct  2    ITMASGAHDSVRAQDVCIVGVARTPLGSFLGSLSSLSATKLGSVAIECALKRAGVDPSMV  61

Query  257  EEVFFGNVLSANLGQAPA  310
            +EVFFGNVLSANLGQAPA
Sbjct  62   QEVFFGNVLSANLGQAPA  79



>ref|XP_001773218.1| predicted protein [Physcomitrella patens]
 gb|EDQ61908.1| predicted protein [Physcomitrella patens]
Length=404

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  101  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  280
            ++I  RDVCIVGVARTPMGG  GSLSSL ATKLGS AI++A+KR  VDPSLVEEVFFGNV
Sbjct  7    DSIAPRDVCIVGVARTPMGGLSGSLSSLSATKLGSTAIQAAVKRSGVDPSLVEEVFFGNV  66

Query  281  LSANLGQAPA  310
            LSANLGQAPA
Sbjct  67   LSANLGQAPA  76



>ref|WP_020082106.1| acetyl-CoA acetyltransferase [Flavobacterium sp. SCGC AAA160-P02]
Length=393

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            +N RDV IV VARTP+G F+GSLSS+PA KLG+IAI+ AL++  +DP+LV+EVF GNV+S
Sbjct  1    MNTRDVVIVAVARTPIGSFMGSLSSIPAPKLGAIAIKGALEKIKLDPNLVDEVFMGNVVS  60

Query  287  ANLGQAPA  310
            A LGQAPA
Sbjct  61   AGLGQAPA  68



>ref|XP_003618040.1| Acetyl-CoA acetyltransferase, cytosolic [Medicago truncatula]
Length=381

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  152  MGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPA  310
            MG FLG+LSS+PATKLGSIAIE+ALKR +VDP++VEEVFFGNVLSANLGQAPA
Sbjct  1    MGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLSANLGQAPA  53



>ref|XP_007154060.1| hypothetical protein PHAVU_003G087600g [Phaseolus vulgaris]
 ref|XP_007154061.1| hypothetical protein PHAVU_003G087600g [Phaseolus vulgaris]
 gb|ESW26054.1| hypothetical protein PHAVU_003G087600g [Phaseolus vulgaris]
 gb|ESW26055.1| hypothetical protein PHAVU_003G087600g [Phaseolus vulgaris]
Length=409

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  104  TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVL  283
            ++ +RDVCIVGVARTP+GG LGSLSSL AT+LGSI I++ALKR +VDPSLV+EVFFGNVL
Sbjct  4    SVKSRDVCIVGVARTPIGGLLGSLSSLSATELGSIVIKNALKRANVDPSLVQEVFFGNVL  63

Query  284  SANLGQAPA  310
            SANLGQAPA
Sbjct  64   SANLGQAPA  72



>ref|XP_010441408.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Camelina sativa]
Length=391

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  152  MGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPA  310
            MGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVEEVFFGNVL+ANLGQAPA
Sbjct  1    MGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVEEVFFGNVLTANLGQAPA  53



>ref|XP_010441409.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Camelina sativa]
Length=381

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  152  MGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPA  310
            MGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVEEVFFGNVL+ANLGQAPA
Sbjct  1    MGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVEEVFFGNVLTANLGQAPA  53



>gb|KJB68526.1| hypothetical protein B456_010G248300 [Gossypium raimondii]
Length=379

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP  +  I  RD CIVGVARTPMGGFLGSLSS  AT LGS+AI++AL+R ++DPSLV+E
Sbjct  1    MAPPDS-MIKPRDACIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  60   VFFGNVLSANLGQAPA  75



>gb|KJB68525.1| hypothetical protein B456_010G248300 [Gossypium raimondii]
Length=375

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP  +  I  RD CIVGVARTPMGGFLGSLSS  AT LGS+AI++AL+R ++DPSLV+E
Sbjct  1    MAPPDS-MIKPRDACIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  60   VFFGNVLSANLGQAPA  75



>gb|KHG07894.1| hypothetical protein F383_03812 [Gossypium arboreum]
Length=415

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP  +  I  +DVCIVGVARTPMGGFLGSLSS  AT LGS+AI++AL+R ++DPSLV+E
Sbjct  1    MAPPDS-MIKPKDVCIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  60   VFFGNVLSANLGQAPA  75



>gb|KJB68524.1| hypothetical protein B456_010G248300 [Gossypium raimondii]
Length=403

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP  +  I  RD CIVGVARTPMGGFLGSLSS  AT LGS+AI++AL+R ++DPSLV+E
Sbjct  1    MAPPDS-MIKPRDACIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  60   VFFGNVLSANLGQAPA  75



>gb|KJB68523.1| hypothetical protein B456_010G248300 [Gossypium raimondii]
Length=415

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +2

Query  83   MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  262
            MAP  +  I  RD CIVGVARTPMGGFLGSLSS  AT LGS+AI++AL+R ++DPSLV+E
Sbjct  1    MAPPDS-MIKPRDACIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  263  VFFGNVLSANLGQAPA  310
            VFFGNVLSANLGQAPA
Sbjct  60   VFFGNVLSANLGQAPA  75



>gb|ESA20734.1| hypothetical protein GLOINDRAFT_43599, partial [Rhizophagus irregularis 
DAOM 181602]
Length=257

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  119  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  298
            DV I  +ARTP+GGF GSL+SL A KLGSIA+E+ALK+  ++P+ V+EVFFGNVLSA LG
Sbjct  1    DVYIAAIARTPLGGFNGSLASLSAVKLGSIAVEAALKKAKIEPNNVQEVFFGNVLSAGLG  60

Query  299  QAPA  310
            Q PA
Sbjct  61   QNPA  64



>gb|EXX68470.1| acetyl-CoA C-acetyltransferase [Rhizophagus irregularis DAOM 
197198w]
Length=396

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            +DV I  +ARTP+GGF GSL+SL A KLGSIA+E+ALK+  ++P+ V+EVFFGNVLSA L
Sbjct  4    KDVYIAAIARTPLGGFNGSLASLSAVKLGSIAVEAALKKAKIEPNNVQEVFFGNVLSAGL  63

Query  296  GQAPA  310
            GQ PA
Sbjct  64   GQNPA  68



>gb|KGN43403.1| hypothetical protein Csa_7G031640 [Cucumis sativus]
Length=360

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  152  MGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPA  310
            MGGFLG+LSSL ATKLGS+AIE+ALKR  VDP+LV+EV FGNVLSANLGQAPA
Sbjct  1    MGGFLGTLSSLSATKLGSLAIEAALKRAKVDPALVQEVIFGNVLSANLGQAPA  53



>ref|WP_026777333.1| acetyl-CoA acetyltransferase [Polaribacter sp. Hel_I_88]
Length=391

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            +DV IV VARTP+G F+GSLS++PAT LG+ AI+ AL + ++DPSLV+EVF GNV+SA L
Sbjct  2    KDVVIVSVARTPIGSFMGSLSTIPATILGATAIKGALNKINLDPSLVQEVFMGNVVSAGL  61

Query  296  GQAPA  310
            GQAPA
Sbjct  62   GQAPA  66



>ref|WP_004570201.1| acetyl-CoA acetyltransferase [Polaribacter irgensii]
 gb|EAR12533.1| acetyl-CoA acetyltransferase [Polaribacter irgensii 23-P]
Length=391

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            ++V IV VARTP+G F+GSL+++PATKLG+IAI+ AL++ ++ PS+VEEVF GNV+SA L
Sbjct  2    KEVVIVAVARTPIGSFMGSLATIPATKLGAIAIKGALEKINLAPSMVEEVFMGNVVSAGL  61

Query  296  GQAPA  310
            GQAPA
Sbjct  62   GQAPA  66



>gb|EAQ42003.1| acetyl-CoA acetyltransferase [Polaribacter sp. MED152]
Length=408

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            ++V IV VARTP+G F+GSLSS+PATKLG+IAI+ AL + ++D +LV+EVF GNV+SA L
Sbjct  19   KEVVIVSVARTPIGSFMGSLSSIPATKLGAIAIKGALDKINLDANLVQEVFMGNVVSAGL  78

Query  296  GQAPA  310
            GQAPA
Sbjct  79   GQAPA  83



>ref|WP_041383877.1| acetyl-CoA acetyltransferase [Polaribacter sp. MED152]
Length=391

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            ++V IV VARTP+G F+GSLSS+PATKLG+IAI+ AL + ++D +LV+EVF GNV+SA L
Sbjct  2    KEVVIVSVARTPIGSFMGSLSSIPATKLGAIAIKGALDKINLDANLVQEVFMGNVVSAGL  61

Query  296  GQAPA  310
            GQAPA
Sbjct  62   GQAPA  66



>ref|XP_008811278.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008811280.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Phoenix dactylifera]
Length=381

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  152  MGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPA  310
            MGGFLG+LS+L ATKLGSI IESALKR +V P+LV+EVFFGNVLSANLGQAPA
Sbjct  1    MGGFLGALSTLSATKLGSIVIESALKRANVAPALVQEVFFGNVLSANLGQAPA  53



>ref|WP_036784849.1| acetyl-CoA acetyltransferase [Polaribacter sp. Hel1_33_49]
 gb|KGL60258.1| acetyl-CoA acetyltransferase [Polaribacter sp. Hel1_33_49]
Length=391

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            +DV IV VARTP+G F+GSLSS+PA KLG+IAI+ AL + ++D  LVEEVF GNV+SA L
Sbjct  2    KDVVIVSVARTPLGSFMGSLSSIPAPKLGAIAIKGALGKINLDAKLVEEVFMGNVVSAGL  61

Query  296  GQAPA  310
            GQAPA
Sbjct  62   GQAPA  66



>ref|WP_027391341.1| acetyl-CoA acetyltransferase [Aquimarina latercula]
Length=392

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  113  ARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSAN  292
            ++DV IV  ARTP+G FLGSLS++PAT+LGSIAI+ AL + ++DPSLV+EVF GNV+ A 
Sbjct  2    SKDVVIVSAARTPIGSFLGSLSTVPATQLGSIAIKGALDKINLDPSLVQEVFMGNVVQAG  61

Query  293  LGQAPA  310
             GQAPA
Sbjct  62   NGQAPA  67



>ref|XP_001619139.1| hypothetical protein NEMVEDRAFT_v1g46486 [Nematostella vectensis]
 gb|EDO27039.1| predicted protein, partial [Nematostella vectensis]
Length=184

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            ++V IV VARTP+G F+GSLSS+PA KLG+IAI+ AL + ++ P++V+EVF GNV+SA L
Sbjct  2    KEVVIVSVARTPIGSFMGSLSSIPAPKLGAIAIKGALDKINLQPNMVQEVFMGNVVSAGL  61

Query  296  GQAPA  310
            GQAPA
Sbjct  62   GQAPA  66



>ref|WP_028298670.1| acetyl-CoA acetyltransferase [Olivibacter sitiensis]
Length=393

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  107  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  286
            ++ +DV IV   RTP+G F+G LS   AT+LG +A+  A+KR ++ P LV+E+FFGNVLS
Sbjct  1    MSKKDVFIVAACRTPIGSFIGQLSEFTATQLGGLAVADAIKRAAIAPHLVQEIFFGNVLS  60

Query  287  ANLGQAPA  310
            ANLGQAPA
Sbjct  61   ANLGQAPA  68



>ref|WP_036822109.1| acetyl-CoA acetyltransferase [Polaribacter sp. Hel1_85]
 gb|KGL64065.1| acetyl-CoA acetyltransferase [Polaribacter sp. Hel1_85]
Length=391

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            ++V IV VARTP+G F+GSLS++PA KLG+IAI+ AL++ ++ P+LVEEVF GNV+SA L
Sbjct  2    KEVVIVSVARTPIGSFMGSLSTIPAPKLGAIAIKGALEKINLAPNLVEEVFMGNVVSAGL  61

Query  296  GQAPA  310
            GQAPA
Sbjct  62   GQAPA  66



>ref|WP_013688178.1| acetyl-CoA acetyltransferase [Fluviicola taffensis]
 gb|AEA45411.1| acetyl-CoA acetyltransferase [Fluviicola taffensis DSM 16823]
Length=392

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  113  ARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSAN  292
            +++V I+   RTPMG F+G LSS+PAT+LGS+AI+ AL +  V+PSL++EVF GNVL A 
Sbjct  2    SKEVYIIAAVRTPMGSFMGGLSSIPATQLGSVAIKGALDKSGVNPSLIDEVFMGNVLQAG  61

Query  293  LGQAPA  310
            +GQAPA
Sbjct  62   VGQAPA  67



>ref|XP_009412135.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=391

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  152  MGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPA  310
            MGGFLG+LSSL AT+LGSIAI+ AL R ++DP+LV+EVFFGNVLSANLGQAPA
Sbjct  1    MGGFLGALSSLSATQLGSIAIKHALARANLDPALVQEVFFGNVLSANLGQAPA  53



>ref|WP_027378013.1| acetyl-CoA acetyltransferase [Chryseobacterium palustre]
Length=392

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            ++V IV  ARTPMG F+GSLS++PATKLGSIAI+ AL + +++P LVEEV+ GNVL A  
Sbjct  2    KEVFIVSAARTPMGRFMGSLSTVPATKLGSIAIKGALDKINLNPDLVEEVYMGNVLQAGE  61

Query  296  GQAPA  310
            GQAPA
Sbjct  62   GQAPA  66



>gb|EHK39793.1| putative acetyl-CoA acetyltransferase [Trichoderma atroviride 
IMI 206040]
Length=398

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  122  VCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQ  301
            V IV  ARTP+G FLGSLS L AT+LGS AI+ A++R  + P  VEEVFFGNVLSANLGQ
Sbjct  7    VYIVSAARTPVGSFLGSLSGLTATQLGSAAIKGAVERSGIKPEDVEEVFFGNVLSANLGQ  66

Query  302  APA  310
            APA
Sbjct  67   APA  69



>ref|WP_028890799.1| acetyl-CoA acetyltransferase [Tenacibaculum sp. 47A_GOM-205m]
Length=391

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            ++V IV VARTP+G FLGSLS++PA KLG++AI+ AL + ++ P +VEEVF GNV+SA L
Sbjct  2    KEVVIVSVARTPIGSFLGSLSTIPAPKLGAVAIKGALDKINLKPEMVEEVFMGNVVSAGL  61

Query  296  GQAPA  310
            GQAPA
Sbjct  62   GQAPA  66



>ref|WP_039347783.1| acetyl-CoA acetyltransferase [Chryseobacterium jeonii]
 gb|KIA90609.1| acetyl-CoA acetyltransferase [Chryseobacterium jeonii]
Length=392

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            ++V IV  ARTPMG F+GSLS++PATKLGS AI+ AL++ ++DP +V+EV+ GNVL A  
Sbjct  2    KEVFIVSAARTPMGSFMGSLSTVPATKLGSTAIKGALEKINLDPKMVQEVYMGNVLQAGE  61

Query  296  GQAPA  310
            GQAPA
Sbjct  62   GQAPA  66



>ref|WP_026812948.1| acetyl-CoA acetyltransferase [Arenibacter certesii]
Length=391

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            +DV IV +ARTP+G F+GSLSS+PA KLG++AI+ AL +  +DPSLVEEV  GNV+ A +
Sbjct  2    KDVVIVSLARTPIGSFMGSLSSIPAPKLGAVAIKGALDKIKLDPSLVEEVIMGNVVQAGV  61

Query  296  GQAPA  310
            GQAPA
Sbjct  62   GQAPA  66



>ref|WP_028887593.1| acetyl-CoA acetyltransferase [Tenacibaculum ovolyticum]
Length=391

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            ++V IV VARTP+G FLGSLS +PA KLG++AI+ AL + ++ P +VEEVF GNV+SA L
Sbjct  2    KEVVIVSVARTPIGSFLGSLSKIPAPKLGAVAIKGALDKINLKPEMVEEVFMGNVVSAGL  61

Query  296  GQAPA  310
            GQAPA
Sbjct  62   GQAPA  66



>gb|EPB83074.1| acetyl-CoA C-acetyltransferase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=396

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +2

Query  113  ARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSAN  292
            +RDV I  V+RTP+GGF GSL+SL ATKLGSIAIESALK+ +V    VEEV FG VL AN
Sbjct  3    SRDVYISAVSRTPIGGFNGSLASLQATKLGSIAIESALKKSTVPVDAVEEVVFGCVLPAN  62

Query  293  LGQAPA  310
            LGQ PA
Sbjct  63   LGQNPA  68



>gb|EPX71259.1| acetyl-CoA C-acetyltransferase Erg10 [Schizosaccharomyces octosporus 
yFS286]
Length=395

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  119  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  298
            DV IV   RTPMG F GSL+SLPATKLGS+AI+ AL++  +  S V+EVF GNVLSANLG
Sbjct  5    DVYIVSAVRTPMGSFGGSLASLPATKLGSVAIKGALEKAKIQASDVQEVFMGNVLSANLG  64

Query  299  QAPA  310
            Q PA
Sbjct  65   QNPA  68



>ref|WP_024740986.1| acetyl-CoA acetyltransferase [Tenacibaculum maritimum]
Length=391

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  116  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  295
            ++V IV VARTP+G FLGSLS++PA KLG+IAI+ AL + ++ P +VEEVF GNV+SA L
Sbjct  2    KEVVIVSVARTPIGSFLGSLSTIPAPKLGAIAIKGALDKINLIPEMVEEVFMGNVVSAGL  61

Query  296  GQAPA  310
            GQAPA
Sbjct  62   GQAPA  66



>ref|NP_596686.1| acetyl-CoA C-acetyltransferase Erg10 (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|Q9UQW6.1|THIL_SCHPO RecName: Full=Acetyl-CoA acetyltransferase; AltName: Full=Acetoacetyl-CoA 
thiolase; AltName: Full=Ergosterol biosynthesis 
protein 10 [Schizosaccharomyces pombe 972h-]
 emb|CAA22123.1| acetyl-CoA C-acetyltransferase Erg10 (predicted) [Schizosaccharomyces 
pombe]
Length=395

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  119  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  298
            +V IV   RTPMG F GS +SLPATKLGSIAI+ AL+R ++ PS V+EVF GNV+SANLG
Sbjct  5    EVYIVSAVRTPMGSFGGSFASLPATKLGSIAIKGALERVNIKPSDVDEVFMGNVVSANLG  64

Query  299  QAPA  310
            Q PA
Sbjct  65   QNPA  68



>dbj|BAA13846.1| unnamed protein product [Schizosaccharomyces pombe]
Length=395

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  119  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  298
            +V IV   RTPMG F GS +SLPATKLGSIAI+ AL+R ++ PS V+EVF GNV+SANLG
Sbjct  5    EVYIVSAVRTPMGSFGGSFASLPATKLGSIAIKGALERVNIKPSDVDEVFMGNVVSANLG  64

Query  299  QAPA  310
            Q PA
Sbjct  65   QNPA  68



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556888308225