BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF011L03

Length=367
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36421.1|  hypothetical protein MIMGU_mgv1a000813mg                103   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_011074301.1|  PREDICTED: receptor-like protein kinase HAIKU2     100   2e-21   Sesamum indicum [beniseed]
ref|XP_002510007.1|  Receptor protein kinase CLAVATA1 precursor, ...  98.2    8e-21   Ricinus communis
ref|XP_006306692.1|  hypothetical protein CARUB_v10008210mg           97.1    2e-20   Capsella rubella
emb|CDY22611.1|  BnaC08g42450D                                        96.7    2e-20   Brassica napus [oilseed rape]
gb|KDP41542.1|  hypothetical protein JCGZ_15949                       96.7    3e-20   Jatropha curcas
ref|XP_002283600.3|  PREDICTED: uncharacterized protein LOC100257433  96.3    5e-20   
ref|XP_002889779.1|  hypothetical protein ARALYDRAFT_888250           94.7    1e-19   Arabidopsis lyrata subsp. lyrata
ref|NP_172468.3|  leucine-rich receptor-like protein kinase           94.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAL12626.1|  leucine-rich repeat receptor-like kinase F21M12.36    94.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850942.1|  leucine-rich receptor-like protein kinase           94.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490508.1|  PREDICTED: receptor-like protein kinase HAIKU2   94.4    2e-19   Camelina sativa [gold-of-pleasure]
emb|CDP00968.1|  unnamed protein product                              93.6    3e-19   Coffea canephora [robusta coffee]
ref|XP_006356791.1|  PREDICTED: receptor-like protein kinase HAIK...  91.7    1e-18   Solanum tuberosum [potatoes]
ref|XP_009118284.1|  PREDICTED: receptor-like protein kinase HAIKU2   90.9    2e-18   Brassica rapa
ref|XP_009148316.1|  PREDICTED: receptor-like protein kinase HAIKU2   90.9    3e-18   Brassica rapa
ref|XP_009769216.1|  PREDICTED: receptor-like protein kinase HAIKU2   89.7    7e-18   Nicotiana sylvestris
ref|XP_006417507.1|  hypothetical protein EUTSA_v10006696mg           89.7    7e-18   Eutrema salsugineum [saltwater cress]
gb|EPS73238.1|  hypothetical protein M569_01518                       89.0    1e-17   Genlisea aurea
emb|CDY20667.1|  BnaC08g13910D                                        89.0    1e-17   Brassica napus [oilseed rape]
ref|XP_004238042.1|  PREDICTED: receptor-like protein kinase HAIKU2   88.6    2e-17   Solanum lycopersicum
ref|XP_011016947.1|  PREDICTED: receptor-like protein kinase HAIKU2   88.2    2e-17   Populus euphratica
ref|XP_006492298.1|  PREDICTED: receptor-like protein kinase HAIK...  87.4    2e-17   Citrus sinensis [apfelsine]
emb|CDY62731.1|  BnaC05g49230D                                        88.2    2e-17   Brassica napus [oilseed rape]
ref|XP_006448082.1|  hypothetical protein CICLE_v10014879mg           87.0    3e-17   
gb|KJB58765.1|  hypothetical protein B456_009G225300                  87.8    4e-17   Gossypium raimondii
ref|XP_010458318.1|  PREDICTED: receptor-like protein kinase HAIKU2   87.4    4e-17   Camelina sativa [gold-of-pleasure]
gb|KFK43299.1|  hypothetical protein AALP_AA1G106000                  87.4    4e-17   Arabis alpina [alpine rockcress]
ref|XP_009591322.1|  PREDICTED: receptor-like protein kinase HAIKU2   87.4    5e-17   Nicotiana tomentosiformis
emb|CDY53829.1|  BnaA09g57210D                                        87.4    5e-17   Brassica napus [oilseed rape]
gb|KHG17335.1|  Receptor-like protein kinase HAIKU2                   87.0    6e-17   Gossypium arboreum [tree cotton]
ref|XP_006472374.1|  PREDICTED: receptor-like protein kinase HAIK...  86.7    7e-17   Citrus sinensis [apfelsine]
ref|XP_010475857.1|  PREDICTED: receptor-like protein kinase HAIKU2   86.7    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_007041450.1|  Leucine-rich receptor-like protein kinase fa...  86.3    9e-17   
ref|XP_010104545.1|  Receptor-like protein kinase HAIKU2              86.3    1e-16   Morus notabilis
ref|XP_006492299.1|  PREDICTED: receptor-like protein kinase HAIK...  85.1    1e-16   Citrus sinensis [apfelsine]
ref|XP_006386429.1|  leucine-rich repeat transmembrane protein ki...  85.1    3e-16   Populus trichocarpa [western balsam poplar]
emb|CDO97335.1|  unnamed protein product                              85.1    3e-16   Coffea canephora [robusta coffee]
gb|KHG23504.1|  Receptor-like protein kinase HAIKU2                   85.1    3e-16   Gossypium arboreum [tree cotton]
ref|XP_006433710.1|  hypothetical protein CICLE_v10000155mg           84.7    4e-16   Citrus clementina [clementine]
ref|XP_004501071.1|  PREDICTED: receptor-like protein kinase HAIK...  84.7    4e-16   Cicer arietinum [garbanzo]
ref|XP_008236214.1|  PREDICTED: receptor-like protein kinase HAIKU2   84.3    5e-16   Prunus mume [ume]
ref|XP_003522732.1|  PREDICTED: receptor-like protein kinase HAIK...  84.3    5e-16   Glycine max [soybeans]
ref|XP_008219159.1|  PREDICTED: receptor-like protein kinase HAIKU2   84.3    5e-16   Prunus mume [ume]
ref|XP_010553669.1|  PREDICTED: receptor-like protein kinase HAIKU2   84.0    6e-16   Tarenaya hassleriana [spider flower]
gb|KJB29385.1|  hypothetical protein B456_005G097600                  84.0    7e-16   Gossypium raimondii
gb|KDP35915.1|  hypothetical protein JCGZ_09887                       84.0    7e-16   Jatropha curcas
gb|KDO42361.1|  hypothetical protein CISIN_1g012103mg                 82.8    7e-16   Citrus sinensis [apfelsine]
ref|XP_007199705.1|  hypothetical protein PRUPE_ppa000895mg           83.2    1e-15   Prunus persica
ref|XP_003526519.1|  PREDICTED: receptor-like protein kinase HAIK...  82.8    2e-15   Glycine max [soybeans]
ref|XP_010544042.1|  PREDICTED: receptor-like protein kinase HAIKU2   82.8    2e-15   Tarenaya hassleriana [spider flower]
ref|XP_007020154.1|  Leucine-rich receptor-like protein kinase fa...  80.5    4e-15   
gb|KJB77870.1|  hypothetical protein B456_012G162000                  80.9    7e-15   Gossypium raimondii
ref|XP_003541774.1|  PREDICTED: receptor-like protein kinase HAIK...  80.5    9e-15   Glycine max [soybeans]
ref|XP_007227019.1|  hypothetical protein PRUPE_ppa001010mg           80.5    1e-14   
ref|XP_011002775.1|  PREDICTED: receptor-like protein kinase HAIKU2   80.1    1e-14   Populus euphratica
ref|XP_007148314.1|  hypothetical protein PHAVU_006G198200g           79.7    2e-14   Phaseolus vulgaris [French bean]
ref|XP_002271143.2|  PREDICTED: receptor-like protein kinase HAIKU2   79.3    2e-14   Vitis vinifera
emb|CAN65551.1|  hypothetical protein VITISV_033329                   79.3    3e-14   Vitis vinifera
ref|XP_009407104.1|  PREDICTED: uncharacterized protein LOC103989885  79.3    3e-14   
ref|XP_008466102.1|  PREDICTED: receptor-like protein kinase HAIKU2   79.0    4e-14   Cucumis melo [Oriental melon]
ref|XP_008339015.1|  PREDICTED: receptor-like protein kinase HAIKU2   78.6    5e-14   
ref|XP_009416779.1|  PREDICTED: receptor-like protein kinase HAIKU2   78.6    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009335487.1|  PREDICTED: receptor-like protein kinase HAIKU2   78.6    5e-14   
ref|XP_006422685.1|  hypothetical protein CICLE_v10027748mg           78.6    5e-14   Citrus clementina [clementine]
ref|XP_002313944.2|  hypothetical protein POPTR_0009s08540g           78.2    6e-14   
gb|KDO67927.1|  hypothetical protein CISIN_1g002250mg                 78.2    6e-14   Citrus sinensis [apfelsine]
ref|XP_006486805.1|  PREDICTED: receptor-like protein kinase HAIK...  78.2    6e-14   Citrus sinensis [apfelsine]
ref|XP_007018364.1|  Leucine-rich receptor-like protein kinase fa...  78.2    6e-14   
gb|KEH36110.1|  LRR receptor-like kinase                              77.8    8e-14   Medicago truncatula
gb|KEH36109.1|  LRR receptor-like kinase                              77.8    9e-14   Medicago truncatula
ref|XP_004292067.1|  PREDICTED: receptor-like protein kinase HAIKU2   77.8    1e-13   Fragaria vesca subsp. vesca
ref|XP_008378672.1|  PREDICTED: receptor-like protein kinase HAIKU2   77.4    1e-13   
ref|XP_009144482.1|  PREDICTED: receptor-like protein kinase HAIKU2   77.4    1e-13   Brassica rapa
ref|XP_007137286.1|  hypothetical protein PHAVU_009G114500g           77.0    1e-13   Phaseolus vulgaris [French bean]
ref|XP_010667749.1|  PREDICTED: receptor-like protein kinase HAIKU2   77.0    1e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004485648.1|  PREDICTED: receptor-like protein kinase HAIK...  77.0    2e-13   Cicer arietinum [garbanzo]
ref|XP_010268649.1|  PREDICTED: receptor-like protein kinase HAIKU2   77.0    2e-13   Nelumbo nucifera [Indian lotus]
gb|KJB64050.1|  hypothetical protein B456_010G030600                  76.6    2e-13   Gossypium raimondii
emb|CDY31055.1|  BnaA08g26050D                                        76.6    2e-13   Brassica napus [oilseed rape]
ref|XP_003593346.1|  Receptor-like protein kinase HAIKU2              75.9    4e-13   Medicago truncatula
emb|CBI25073.3|  unnamed protein product                              75.5    4e-13   Vitis vinifera
ref|XP_009779240.1|  PREDICTED: receptor-like protein kinase HAIKU2   75.5    5e-13   Nicotiana sylvestris
ref|XP_002522038.1|  Receptor protein kinase CLAVATA1 precursor, ...  75.5    5e-13   Ricinus communis
ref|XP_010061583.1|  PREDICTED: receptor-like protein kinase HAIKU2   75.5    6e-13   Eucalyptus grandis [rose gum]
gb|KJB16079.1|  hypothetical protein B456_002G211900                  75.1    7e-13   Gossypium raimondii
gb|KJB16078.1|  hypothetical protein B456_002G211900                  75.1    7e-13   Gossypium raimondii
gb|KFK39298.1|  hypothetical protein AALP_AA3G226400                  74.3    1e-12   Arabis alpina [alpine rockcress]
ref|XP_004136412.1|  PREDICTED: receptor-like protein kinase HAIK...  74.3    1e-12   Cucumis sativus [cucumbers]
ref|XP_010065822.1|  PREDICTED: receptor-like protein kinase HAIKU2   74.3    1e-12   Eucalyptus grandis [rose gum]
ref|XP_009357239.1|  PREDICTED: receptor-like protein kinase HAIKU2   74.3    1e-12   Pyrus x bretschneideri [bai li]
gb|KCW63493.1|  hypothetical protein EUGRSUZ_G01123                   74.3    2e-12   Eucalyptus grandis [rose gum]
ref|XP_006367082.1|  PREDICTED: receptor-like protein kinase HAIK...  73.6    3e-12   Solanum tuberosum [potatoes]
ref|XP_004230660.1|  PREDICTED: receptor-like protein kinase HAIKU2   73.6    3e-12   Solanum lycopersicum
ref|XP_009616818.1|  PREDICTED: receptor-like protein kinase HAIKU2   73.6    3e-12   Nicotiana tomentosiformis
ref|XP_010668040.1|  PREDICTED: receptor-like protein kinase HAIKU2   73.2    3e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008372891.1|  PREDICTED: receptor-like protein kinase HAIKU2   73.2    4e-12   
ref|XP_010107637.1|  Receptor-like protein kinase HAIKU2              72.8    4e-12   Morus notabilis
ref|XP_010943231.1|  PREDICTED: receptor-like protein kinase HAIKU2   72.4    6e-12   Elaeis guineensis
ref|XP_009378558.1|  PREDICTED: receptor-like protein kinase HAIKU2   72.0    8e-12   Pyrus x bretschneideri [bai li]
ref|XP_010271554.1|  PREDICTED: receptor-like protein kinase HAIKU2   71.6    1e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010060141.1|  PREDICTED: receptor-like protein kinase HAIKU2   70.9    2e-11   Eucalyptus grandis [rose gum]
gb|KCW66704.1|  hypothetical protein EUGRSUZ_F00467                   70.9    2e-11   Eucalyptus grandis [rose gum]
ref|XP_004299841.2|  PREDICTED: receptor-like protein kinase HAIKU2   70.9    2e-11   Fragaria vesca subsp. vesca
ref|XP_009346454.1|  PREDICTED: receptor-like protein kinase HAIKU2   70.9    2e-11   
ref|XP_009394911.1|  PREDICTED: LRR receptor-like serine/threonin...  70.1    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008382378.1|  PREDICTED: receptor-like protein kinase HAIKU2   69.7    5e-11   Malus domestica [apple tree]
emb|CDY42201.1|  BnaA01g25940D                                        69.7    5e-11   Brassica napus [oilseed rape]
ref|XP_009111593.1|  PREDICTED: receptor-like protein kinase HAIKU2   69.7    6e-11   Brassica rapa
ref|XP_006852741.1|  hypothetical protein AMTR_s00033p00104210        68.9    8e-11   
ref|XP_008787835.1|  PREDICTED: uncharacterized protein LOC103705762  68.6    1e-10   
gb|ABK26727.1|  unknown                                               65.5    3e-10   Picea sitchensis
ref|NP_188604.1|  leucine rich repeat kinase HAIKU 2                  67.0    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300009.1|  hypothetical protein CARUB_v10016232mg           66.6    6e-10   Capsella rubella
emb|CDX95422.1|  BnaC01g33140D                                        66.2    7e-10   
ref|XP_004170874.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  66.2    7e-10   
ref|XP_002883200.1|  hypothetical protein ARALYDRAFT_479487           64.3    3e-09   
ref|XP_010489950.1|  PREDICTED: receptor-like protein kinase HAIKU2   64.3    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_008455077.1|  PREDICTED: receptor-like protein kinase HAIKU2   64.3    3e-09   Cucumis melo [Oriental melon]
gb|KGN43819.1|  hypothetical protein Csa_7G069690                     62.4    2e-08   Cucumis sativus [cucumbers]
ref|XP_004137077.1|  PREDICTED: receptor-like protein kinase HAIK...  62.4    2e-08   
ref|XP_006406469.1|  hypothetical protein EUTSA_v10022054mg           61.2    4e-08   Eutrema salsugineum [saltwater cress]
ref|XP_010420074.1|  PREDICTED: receptor-like protein kinase HAIKU2   61.2    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006395826.1|  hypothetical protein EUTSA_v10003548mg           60.8    4e-08   Eutrema salsugineum [saltwater cress]
ref|XP_009101284.1|  PREDICTED: serine/threonine-protein kinase B...  60.8    5e-08   Brassica rapa
ref|XP_010468302.1|  PREDICTED: receptor-like protein kinase HAIKU2   60.8    5e-08   Camelina sativa [gold-of-pleasure]
emb|CDY17621.1|  BnaA06g34400D                                        60.8    5e-08   Brassica napus [oilseed rape]
emb|CDY03088.1|  BnaC07g21390D                                        60.8    5e-08   
ref|XP_010424991.1|  PREDICTED: serine/threonine-protein kinase B...  59.7    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002979988.1|  hypothetical protein SELMODRAFT_178079           59.3    1e-07   Selaginella moellendorffii
gb|ADQ43184.1|  leucine-rich receptor kinase                          58.9    2e-07   Schrenkiella parvula
ref|XP_010506907.1|  PREDICTED: serine/threonine-protein kinase B...  58.2    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002991932.1|  hypothetical protein SELMODRAFT_438              57.4    5e-07   
gb|KJB59874.1|  hypothetical protein B456_009G278300                  57.4    5e-07   Gossypium raimondii
ref|XP_010513950.1|  PREDICTED: serine/threonine-protein kinase B...  57.8    5e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010513948.1|  PREDICTED: serine/threonine-protein kinase B...  57.8    5e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006857826.1|  hypothetical protein AMTR_s00069p00033900        57.4    6e-07   
ref|WP_010653235.1|  RHS repeat-associated core domain-containing...  55.8    8e-07   Fluoribacter dumoffii
ref|XP_006290522.1|  hypothetical protein CARUB_v10016602mg           57.0    8e-07   Capsella rubella
ref|XP_002876787.1|  hypothetical protein ARALYDRAFT_484119           57.0    1e-06   
ref|NP_178304.1|  serine/threonine-protein kinase BRI1-like 2         57.0    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009354606.1|  PREDICTED: LRR receptor-like serine/threonin...  56.2    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_009354587.1|  PREDICTED: LRR receptor-like serine/threonin...  56.2    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_011093340.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  55.1    4e-06   Sesamum indicum [beniseed]
ref|XP_006408369.1|  hypothetical protein EUTSA_v10020304mg           53.9    8e-06   Eutrema salsugineum [saltwater cress]
gb|KFK33407.1|  hypothetical protein AALP_AA5G008900                  54.3    8e-06   Arabis alpina [alpine rockcress]
ref|XP_006408370.1|  hypothetical protein EUTSA_v10020304mg           53.5    9e-06   Eutrema salsugineum [saltwater cress]
ref|XP_010527832.1|  PREDICTED: serine/threonine-protein kinase B...  53.5    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_010023352.1|  PREDICTED: LRR receptor-like serine/threonin...  53.1    2e-05   Eucalyptus grandis [rose gum]
ref|WP_027271448.1|  hypothetical protein                             52.0    2e-05   
gb|KCW59607.1|  hypothetical protein EUGRSUZ_H02351                   53.1    2e-05   Eucalyptus grandis [rose gum]
gb|KJB52934.1|  hypothetical protein B456_008G284000                  52.8    2e-05   Gossypium raimondii
ref|XP_003605636.1|  Receptor-like protein kinase                     52.4    2e-05   
ref|XP_007207228.1|  hypothetical protein PRUPE_ppa000973mg           52.4    2e-05   
gb|KJB52935.1|  hypothetical protein B456_008G284000                  52.4    3e-05   Gossypium raimondii
dbj|BAP55221.1|  hypothetical protein THII_0924                       52.4    3e-05   Thioploca ingrica
gb|EYU29298.1|  hypothetical protein MIMGU_mgv1a000685mg              52.4    3e-05   Erythranthe guttata [common monkey flower]
ref|XP_002987081.1|  hypothetical protein SELMODRAFT_125338           52.0    3e-05   
ref|XP_002318874.2|  hypothetical protein POPTR_0012s14430g           52.0    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_009420699.1|  PREDICTED: receptor-like protein kinase HAIKU2   52.0    4e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002985490.1|  hypothetical protein SELMODRAFT_122408           51.6    4e-05   
ref|XP_010023353.1|  PREDICTED: LRR receptor-like serine/threonin...  52.0    4e-05   
ref|XP_010023354.1|  PREDICTED: LRR receptor-like serine/threonin...  51.6    5e-05   Eucalyptus grandis [rose gum]
gb|KCW59611.1|  hypothetical protein EUGRSUZ_H02353                   51.6    5e-05   Eucalyptus grandis [rose gum]
ref|XP_010680110.1|  PREDICTED: serine/threonine-protein kinase B...  51.6    5e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004964453.1|  PREDICTED: probable LRR receptor-like serine...  51.2    6e-05   Setaria italica
ref|XP_011081744.1|  PREDICTED: receptor-like protein kinase 5        51.2    6e-05   Sesamum indicum [beniseed]
ref|XP_006445272.1|  hypothetical protein CICLE_v10019056mg           51.2    6e-05   Citrus clementina [clementine]
ref|XP_006445273.1|  hypothetical protein CICLE_v10019056mg           51.2    7e-05   
gb|KHG09358.1|  Leucine-rich repeat receptor protein kinase EXS       51.2    7e-05   Gossypium arboreum [tree cotton]
gb|KJB28083.1|  hypothetical protein B456_005G026500                  50.8    7e-05   Gossypium raimondii
ref|XP_008236947.1|  PREDICTED: LRR receptor-like serine/threonin...  51.2    8e-05   Prunus mume [ume]
ref|XP_003530064.1|  PREDICTED: probable inactive receptor kinase...  50.8    8e-05   Glycine max [soybeans]
ref|XP_006645116.1|  PREDICTED: receptor-like protein kinase HSL1...  50.8    8e-05   Oryza brachyantha
gb|KJB24815.1|  hypothetical protein B456_004G162200                  50.8    9e-05   Gossypium raimondii
gb|KJB24814.1|  hypothetical protein B456_004G162200                  50.8    9e-05   Gossypium raimondii
ref|XP_007038448.1|  Leucine-rich repeat protein kinase family pr...  50.4    9e-05   
ref|XP_010322765.1|  PREDICTED: receptor-like protein kinase HAIKU2   50.8    9e-05   Solanum lycopersicum
ref|XP_009382934.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  50.4    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007038447.1|  Leucine-rich repeat protein kinase family pr...  50.4    1e-04   
ref|XP_008794535.1|  PREDICTED: LRR receptor-like serine/threonin...  50.4    1e-04   Phoenix dactylifera
ref|XP_009780300.1|  PREDICTED: receptor-like protein kinase HAIKU2   50.4    1e-04   Nicotiana sylvestris
ref|XP_004506369.1|  PREDICTED: receptor-like protein kinase HAIK...  50.4    1e-04   Cicer arietinum [garbanzo]
ref|XP_002511706.1|  leucine rich repeat receptor kinase, putative    50.1    1e-04   
ref|XP_006374656.1|  hypothetical protein POPTR_0015s14480g           50.1    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_004133916.1|  PREDICTED: probable LRR receptor-like serine...  50.1    1e-04   Cucumis sativus [cucumbers]
ref|XP_002456732.1|  hypothetical protein SORBIDRAFT_03g041570        50.1    1e-04   Sorghum bicolor [broomcorn]
ref|XP_002443241.1|  hypothetical protein SORBIDRAFT_08g016220        50.1    2e-04   Sorghum bicolor [broomcorn]
ref|XP_010098918.1|  LRR receptor-like serine/threonine-protein k...  50.1    2e-04   
ref|XP_002453322.1|  hypothetical protein SORBIDRAFT_04g003840        50.1    2e-04   Sorghum bicolor [broomcorn]
gb|AGT16770.1|  hypothetical protein SHCRBa_022_K23_R_30              50.1    2e-04   Saccharum hybrid cultivar R570
ref|XP_010255622.1|  PREDICTED: somatic embryogenesis receptor ki...  49.7    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010932563.1|  PREDICTED: probable inactive receptor kinase...  49.7    2e-04   Elaeis guineensis
ref|XP_008811220.1|  PREDICTED: probable inactive receptor kinase...  50.1    2e-04   Phoenix dactylifera
ref|XP_008227225.1|  PREDICTED: probable leucine-rich repeat rece...  50.1    2e-04   Prunus mume [ume]
ref|XP_006441549.1|  hypothetical protein CICLE_v10018710mg           49.7    2e-04   Citrus clementina [clementine]
ref|XP_006478192.1|  PREDICTED: receptor-like protein kinase HAIK...  49.7    2e-04   Citrus sinensis [apfelsine]
gb|KDO45819.1|  hypothetical protein CISIN_1g002063mg                 49.7    2e-04   Citrus sinensis [apfelsine]
gb|EAY99548.1|  hypothetical protein OsI_21521                        49.7    2e-04   Oryza sativa Indica Group [Indian rice]
gb|KDO45821.1|  hypothetical protein CISIN_1g002063mg                 49.7    2e-04   Citrus sinensis [apfelsine]
dbj|BAD68873.1|  putative somatic embryogenesis protein kinase 1      49.7    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02682.1|  hypothetical protein OsI_24796                        49.7    2e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_004511799.1|  PREDICTED: LRR receptor-like serine/threonin...  49.7    2e-04   Cicer arietinum [garbanzo]
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)        49.7    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AAF73373.1|AF193835_1  LRK1 protein                                49.7    2e-04   Oryza sativa [red rice]
ref|NP_001058840.2|  Os07g0134200                                     49.7    2e-04   
ref|NP_001056717.1|  Os06g0134700                                     49.7    2e-04   
gb|EDN71345.1|  receptor protein kinase                               49.7    2e-04   Beggiatoa sp. PS
ref|XP_006826909.1|  hypothetical protein AMTR_s00010p00158940        49.3    2e-04   Amborella trichopoda
ref|XP_004305135.1|  PREDICTED: receptor-like protein 12 isoform X1   49.7    2e-04   Fragaria vesca subsp. vesca
ref|XP_011029975.1|  PREDICTED: probable LRR receptor-like serine...  49.3    2e-04   Populus euphratica
ref|XP_006353616.1|  PREDICTED: receptor-like protein kinase HAIK...  49.3    2e-04   
ref|XP_007141638.1|  hypothetical protein PHAVU_008G212900g           49.3    3e-04   Phaseolus vulgaris [French bean]
ref|XP_002882256.1|  hypothetical protein ARALYDRAFT_896266           49.3    3e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_007140941.1|  hypothetical protein PHAVU_008G154200g           49.3    3e-04   Phaseolus vulgaris [French bean]
ref|XP_004308453.2|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  49.3    3e-04   Fragaria vesca subsp. vesca
gb|EYU41358.1|  hypothetical protein MIMGU_mgv1a000915mg              49.3    3e-04   Erythranthe guttata [common monkey flower]
ref|XP_006297231.1|  hypothetical protein CARUB_v10013240mg           48.9    3e-04   Capsella rubella
ref|XP_002301282.2|  hypothetical protein POPTR_0002s14800g           48.9    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011041704.1|  PREDICTED: LRR receptor-like serine/threonin...  48.9    3e-04   Populus euphratica
gb|KFK25298.1|  hypothetical protein AALP_AA8G094300                  49.3    3e-04   Arabis alpina [alpine rockcress]
ref|XP_007213080.1|  hypothetical protein PRUPE_ppa021211mg           49.3    3e-04   
ref|XP_010925124.1|  PREDICTED: probable inactive receptor kinase...  48.9    3e-04   Elaeis guineensis
gb|KHG24857.1|  Receptor-like protein kinase HSL1                     49.3    3e-04   Gossypium arboreum [tree cotton]
gb|KJB54767.1|  hypothetical protein B456_009G048200                  48.9    3e-04   Gossypium raimondii
ref|XP_011017487.1|  PREDICTED: probable leucine-rich repeat rece...  48.9    3e-04   Populus euphratica
gb|KJB54766.1|  hypothetical protein B456_009G048200                  48.9    3e-04   Gossypium raimondii
ref|XP_010491652.1|  PREDICTED: probable inactive receptor kinase...  48.9    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002871400.1|  hypothetical protein ARALYDRAFT_487827           48.9    4e-04   
ref|XP_009390851.1|  PREDICTED: probable inactive receptor kinase...  48.9    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACK44523.1|  AT5G10020-like protein                                48.9    4e-04   Arabidopsis arenosa
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...  48.9    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001078562.1|  putative inactive receptor kinase                48.9    4e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KDP28763.1|  hypothetical protein JCGZ_14534                       48.9    4e-04   Jatropha curcas
ref|NP_196564.1|  putative inactive receptor kinase                   48.9    4e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAO00824.1|  disease resistance protein - like                     48.5    4e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAL47484.1|  AT5g10020/T31P16_9                                    48.9    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007156676.1|  hypothetical protein PHAVU_002G007800g           48.9    4e-04   Phaseolus vulgaris [French bean]
emb|CBI38873.3|  unnamed protein product                              48.1    4e-04   Vitis vinifera
emb|CAN72186.1|  hypothetical protein VITISV_012898                   48.5    4e-04   Vitis vinifera
ref|XP_002279998.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      48.5    4e-04   Vitis vinifera
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...  48.5    5e-04   Citrus sinensis [apfelsine]
ref|XP_010547240.1|  PREDICTED: receptor-like protein kinase 5        48.5    5e-04   Tarenaya hassleriana [spider flower]
dbj|BAF79981.1|  receptor-like kinase                                 48.5    5e-04   Nitella axillaris
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                 48.5    5e-04   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg           48.5    5e-04   Citrus clementina [clementine]
ref|XP_011042292.1|  PREDICTED: probable LRR receptor-like serine...  48.5    5e-04   Populus euphratica
ref|XP_007052072.1|  Leucine-rich repeat receptor protein kinase      48.5    5e-04   
ref|XP_003552234.1|  PREDICTED: probable LRR receptor-like serine...  48.5    5e-04   
ref|NP_001241340.1|  receptor-like protein kinase HSL1-like           48.5    5e-04   Glycine max [soybeans]
ref|XP_008674748.1|  PREDICTED: receptor-like protein kinase HSL1     48.5    5e-04   Zea mays [maize]
ref|XP_004970775.1|  PREDICTED: receptor-like protein kinase HSL1...  48.5    5e-04   
ref|XP_008222729.1|  PREDICTED: probable LRR receptor-like serine...  48.5    5e-04   
ref|XP_004970774.1|  PREDICTED: receptor-like protein kinase HSL1...  48.5    5e-04   
ref|XP_006591868.1|  PREDICTED: receptor-like protein kinase HSL1...  48.5    5e-04   Glycine max [soybeans]
gb|ACM89591.1|  leucine-rich repeat family protein / protein kina...  48.5    5e-04   Glycine max [soybeans]
ref|XP_006368702.1|  leucine-rich repeat transmembrane protein ki...  48.1    5e-04   
ref|XP_010276701.1|  PREDICTED: probable leucine-rich repeat rece...  48.1    6e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010053898.1|  PREDICTED: LRR receptor-like serine/threonin...  48.1    6e-04   Eucalyptus grandis [rose gum]
ref|XP_007131311.1|  hypothetical protein PHAVU_011G003200g           48.5    6e-04   Phaseolus vulgaris [French bean]
ref|XP_006286962.1|  hypothetical protein CARUB_v10000111mg           48.5    6e-04   Capsella rubella
ref|XP_010495505.1|  PREDICTED: receptor-like protein kinase HSL1     48.1    6e-04   
ref|XP_006655759.1|  PREDICTED: somatic embryogenesis receptor ki...  48.1    6e-04   
ref|XP_002468593.1|  hypothetical protein SORBIDRAFT_01g048690        48.1    6e-04   Sorghum bicolor [broomcorn]
ref|XP_007025532.1|  HAESA-like 1 isoform 1                           48.1    6e-04   
ref|NP_197963.1|  receptor like protein 52                            48.1    6e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003559525.1|  PREDICTED: probable inactive receptor kinase...  48.1    6e-04   Brachypodium distachyon [annual false brome]
ref|XP_007025533.1|  HAESA-like 1 isoform 2                           48.1    6e-04   
ref|XP_010421450.1|  PREDICTED: receptor-like protein kinase 5        48.1    6e-04   Camelina sativa [gold-of-pleasure]
ref|XP_011007233.1|  PREDICTED: probable inactive receptor kinase...  48.1    6e-04   Populus euphratica
emb|CDP08193.1|  unnamed protein product                              48.1    6e-04   Coffea canephora [robusta coffee]
emb|CDY28719.1|  BnaCnng06050D                                        48.1    6e-04   Brassica napus [oilseed rape]
gb|KJB28127.1|  hypothetical protein B456_005G028700                  48.1    6e-04   Gossypium raimondii
gb|AES78411.2|  LRR receptor-like kinase                              48.1    6e-04   Medicago truncatula
ref|XP_003579100.1|  PREDICTED: receptor-like protein kinase HAIKU2   48.1    6e-04   Brachypodium distachyon [annual false brome]
ref|XP_003622193.1|  Receptor-like protein kinase                     48.1    7e-04   
ref|XP_009147309.1|  PREDICTED: probable inactive receptor kinase...  48.1    7e-04   Brassica rapa
ref|XP_011099906.1|  PREDICTED: probable inactive receptor kinase...  48.1    7e-04   Sesamum indicum [beniseed]
gb|EPS61496.1|  hypothetical protein M569_13300                       48.1    7e-04   Genlisea aurea
ref|XP_004951827.1|  PREDICTED: receptor-like protein 2-like          48.1    7e-04   
emb|CDY51524.1|  BnaA05g33240D                                        47.8    7e-04   
ref|XP_009383174.1|  PREDICTED: receptor-like protein kinase isof...  48.1    7e-04   
gb|KEH22283.1|  LRR receptor-like kinase                              47.8    7e-04   
ref|XP_010440709.1|  PREDICTED: probable LRR receptor-like serine...  47.8    7e-04   
ref|XP_002312487.1|  leucine-rich repeat transmembrane protein ki...  48.1    7e-04   
gb|KJB28082.1|  hypothetical protein B456_005G026400                  48.1    7e-04   
ref|XP_011002185.1|  PREDICTED: probable inactive receptor kinase...  47.8    7e-04   
gb|KDP31632.1|  hypothetical protein JCGZ_14857                       48.1    7e-04   
gb|KDO65398.1|  hypothetical protein CISIN_1g044913mg                 47.4    7e-04   
ref|XP_002305880.1|  hypothetical protein POPTR_0004s08450g           47.8    7e-04   
ref|XP_006388720.1|  hypothetical protein POPTR_0113s00240g           48.1    8e-04   
ref|XP_009383177.1|  PREDICTED: receptor-like protein kinase isof...  47.8    8e-04   
ref|XP_008438169.1|  PREDICTED: probable LRR receptor-like serine...  47.8    8e-04   
emb|CDP01639.1|  unnamed protein product                              47.8    8e-04   
ref|NP_186938.1|  leucine-rich repeat protein kinase family protein   47.8    8e-04   
ref|XP_007140846.1|  hypothetical protein PHAVU_008G146600g           47.8    8e-04   
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450        47.8    8e-04   
ref|XP_009769365.1|  PREDICTED: receptor-like protein 12              47.0    8e-04   
ref|XP_004985160.1|  PREDICTED: probable inactive receptor kinase...  47.8    9e-04   
ref|XP_009769364.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  47.8    9e-04   
ref|XP_008438170.1|  PREDICTED: LRR receptor-like serine/threonin...  47.4    9e-04   
gb|EEE56324.1|  hypothetical protein OsJ_05422                        47.8    9e-04   
gb|EJK49316.1|  hypothetical protein THAOC_31821                      47.8    9e-04   
ref|XP_011001561.1|  PREDICTED: probable inactive receptor kinase...  47.8    9e-04   
ref|XP_006286985.1|  hypothetical protein CARUB_v10000132mg           47.8    0.001   
ref|XP_002303531.2|  leucine-rich repeat transmembrane protein ki...  47.4    0.001   
ref|NP_001045936.1|  Os02g0154700                                     47.8    0.001   
gb|KJB28361.1|  hypothetical protein B456_005G044400                  47.8    0.001   
ref|XP_010934669.1|  PREDICTED: leucine-rich repeat receptor prot...  47.4    0.001   
ref|XP_009345889.1|  PREDICTED: LRR receptor-like serine/threonin...  47.8    0.001   
ref|XP_010262229.1|  PREDICTED: probable inactive leucine-rich re...  47.4    0.001   
gb|KJB28360.1|  hypothetical protein B456_005G044400                  47.8    0.001   
ref|XP_010910517.1|  PREDICTED: somatic embryogenesis receptor ki...  47.4    0.001   
ref|XP_002510009.1|  receptor protein kinase, putative                47.8    0.001   
ref|XP_006421744.1|  hypothetical protein CICLE_v10004478mg           47.4    0.001   
ref|XP_009375883.1|  PREDICTED: LRR receptor-like serine/threonin...  47.8    0.001   
gb|EPS66154.1|  receptor-like protein kinase                          47.4    0.001   
ref|XP_010422906.1|  PREDICTED: probable inactive receptor kinase...  47.8    0.001   



>gb|EYU36421.1| hypothetical protein MIMGU_mgv1a000813mg [Erythranthe guttata]
Length=977

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IK A QNS+T+IFD+W +    C+FPG+TCDSNG VKEI+LS + L+GS+P  SIC L S
Sbjct  38   IKTAFQNSNTRIFDSWESETLACNFPGITCDSNGYVKEIDLSNQNLTGSLPLSSICQLNS  97

Query  330  LEKLSLGFNSLS  365
            LEKLSLGFN+LS
Sbjct  98   LEKLSLGFNNLS  109



>ref|XP_011074301.1| PREDICTED: receptor-like protein kinase HAIKU2 [Sesamum indicum]
Length=980

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IKAA Q+S+TK+FD+W +    C F G+TCDSNG VKEIELS R L+G +P  S+C LKS
Sbjct  34   IKAAFQDSNTKVFDSWESSTPVCSFSGITCDSNGFVKEIELSNRNLTGLLPLSSVCQLKS  93

Query  330  LEKLSLGFNSL  362
            LEKLSLGFN+L
Sbjct  94   LEKLSLGFNNL  104



>ref|XP_002510007.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF52194.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=973

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K +LQNS T +FD+W++ +  CDF G+TC S+ SVKEIELS R LSG +P D +C+L+S
Sbjct  32   LKTSLQNSHTNVFDSWDSTNFICDFTGITCTSDNSVKEIELSSRNLSGVLPLDRVCNLQS  91

Query  330  LEKLSLGFNSLS  365
            LEKLSLGFNSLS
Sbjct  92   LEKLSLGFNSLS  103



>ref|XP_006306692.1| hypothetical protein CARUB_v10008210mg [Capsella rubella]
 gb|EOA39590.1| hypothetical protein CARUB_v10008210mg [Capsella rubella]
Length=968

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K++L +S+  +FD+W +   PC FPGVTC+S G+V EI+LSRR LSG+ PFDS+C ++S
Sbjct  31   LKSSLSHSNPSLFDSWTSGTGPCSFPGVTCNSIGNVTEIDLSRRSLSGNFPFDSVCEIRS  90

Query  330  LEKLSLGFNSLS  365
            L+KLSLGFNSLS
Sbjct  91   LQKLSLGFNSLS  102



>emb|CDY22611.1| BnaC08g42450D [Brassica napus]
Length=943

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IK++L +S+  + D+WN+   PC F GVTC+SNGSV EI+LSRRGLSG  PF  +C L S
Sbjct  35   IKSSLLDSNPGVLDSWNSGVGPCSFAGVTCNSNGSVTEIDLSRRGLSGKFPFPFLCDLMS  94

Query  330  LEKLSLGFNSLS  365
            LEKLSLGFNSLS
Sbjct  95   LEKLSLGFNSLS  106



>gb|KDP41542.1| hypothetical protein JCGZ_15949 [Jatropha curcas]
Length=974

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K ALQNS+T  FD+W + +S C F G+TC+S  SV EIELS + L G+VP DSIC+L+S
Sbjct  31   VKTALQNSNTDAFDSWRSSNSVCKFTGITCNSVNSVAEIELSHQNLVGAVPLDSICNLQS  90

Query  330  LEKLSLGFNSLS  365
            LEKLSLGFNSLS
Sbjct  91   LEKLSLGFNSLS  102



>ref|XP_002283600.3| PREDICTED: uncharacterized protein LOC100257433 [Vitis vinifera]
Length=2026

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +KA LQN DT +FD+W +  S C+F G+TC+S+G V+EIELS + LSG VP +SIC L+S
Sbjct  37   VKAELQNFDTYVFDSWESNDSACNFRGITCNSDGRVREIELSNQRLSGVVPLESICQLES  96

Query  330  LEKLSLGFNSL  362
            LEKLSLGFN L
Sbjct  97   LEKLSLGFNFL  107



>ref|XP_002889779.1| hypothetical protein ARALYDRAFT_888250 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66038.1| hypothetical protein ARALYDRAFT_888250 [Arabidopsis lyrata subsp. 
lyrata]
Length=976

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +K++  +S+  +FD+W  N+R  PC F GVTC+S G+V EI+LSR+GLSG+ PFD +C +
Sbjct  37   LKSSFADSNLAVFDSWMLNSRTGPCSFTGVTCNSRGNVTEIDLSRQGLSGNFPFDLVCEI  96

Query  324  KSLEKLSLGFNSLS  365
            +SLEKLSLGFNSLS
Sbjct  97   QSLEKLSLGFNSLS  110



>ref|NP_172468.3| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AEE28523.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=977

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +K++  +S+  +FD+W  N+   PC F GVTC+S G+V EI+LSRRGLSG+ PFDS+C +
Sbjct  37   LKSSFADSNLAVFDSWKLNSGIGPCSFIGVTCNSRGNVTEIDLSRRGLSGNFPFDSVCEI  96

Query  324  KSLEKLSLGFNSLS  365
            +SLEKLSLGFNSLS
Sbjct  97   QSLEKLSLGFNSLS  110



>gb|AAL12626.1| leucine-rich repeat receptor-like kinase F21M12.36 [Arabidopsis 
thaliana]
Length=977

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +K++  +S+  +FD+W  N+   PC F GVTC+S G+V EI+LSRRGLSG+ PFDS+C +
Sbjct  37   LKSSFADSNLAVFDSWKLNSGIGPCSFIGVTCNSRGNVTEIDLSRRGLSGNFPFDSVCEI  96

Query  324  KSLEKLSLGFNSLS  365
            +SLEKLSLGFNSLS
Sbjct  97   QSLEKLSLGFNSLS  110



>ref|NP_850942.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL32758.1| Unknown protein [Arabidopsis thaliana]
 gb|ACN59227.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE28522.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=976

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +K++  +S+  +FD+W  N+   PC F GVTC+S G+V EI+LSRRGLSG+ PFDS+C +
Sbjct  37   LKSSFADSNLAVFDSWKLNSGIGPCSFIGVTCNSRGNVTEIDLSRRGLSGNFPFDSVCEI  96

Query  324  KSLEKLSLGFNSLS  365
            +SLEKLSLGFNSLS
Sbjct  97   QSLEKLSLGFNSLS  110



>ref|XP_010490508.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=974

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 56/68 (82%), Gaps = 2/68 (3%)
 Frame = +3

Query  168  NSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKL  341
            +S+  +FD+W  N+  +PC F GVTC+SNG+V EI+LSRRGLSG+ PFDS+C + SLEKL
Sbjct  39   DSNLAVFDSWKLNSVTAPCRFTGVTCNSNGNVSEIDLSRRGLSGNFPFDSVCEIHSLEKL  98

Query  342  SLGFNSLS  365
            SLGFNSLS
Sbjct  99   SLGFNSLS  106



>emb|CDP00968.1| unnamed protein product [Coffea canephora]
Length=1051

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICSLK  326
            IK +L+NS+T +FD+W+A+   C+F G+TCD +   VKEIELS++ LSG VPF +IC LK
Sbjct  104  IKTSLKNSNTFVFDSWDAKIPTCNFTGITCDPATKLVKEIELSKQNLSGQVPFAAICQLK  163

Query  327  SLEKLSLGFNSLS  365
            SLE+LSLGFNSLS
Sbjct  164  SLERLSLGFNSLS  176



>ref|XP_006356791.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Solanum 
tuberosum]
Length=984

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IK++L N  T +F  W      C F G+TC+S+GSVKEIELS + +SG VPFD ICSL S
Sbjct  38   IKSSLSNPTTNVFQNWEPNTPLCKFTGITCNSDGSVKEIELSSKKISGFVPFDKICSLNS  97

Query  330  LEKLSLGFNSLS  365
            LEKLSLG+NSLS
Sbjct  98   LEKLSLGYNSLS  109



>ref|XP_009118284.1| PREDICTED: receptor-like protein kinase HAIKU2 [Brassica rapa]
Length=973

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            I+++L +S+  + D+W    +PC F GVTC+SN SV EI+LSRRGLSG+ PF  +C L S
Sbjct  34   IRSSLLDSNPNVLDSWKPTSNPCSFAGVTCNSNRSVTEIDLSRRGLSGNFPFPFLCDLTS  93

Query  330  LEKLSLGFNSLS  365
            LEKLSLGFNSLS
Sbjct  94   LEKLSLGFNSLS  105



>ref|XP_009148316.1| PREDICTED: receptor-like protein kinase HAIKU2 [Brassica rapa]
Length=964

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 2/74 (3%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            IK++L NS+  +  +W  N+  +PC F GVTCD+ GSVKEI+LSR+ LSG  PF S+C L
Sbjct  30   IKSSLLNSNPGVLASWKLNSVSAPCSFTGVTCDATGSVKEIDLSRQALSGKFPFASLCDL  89

Query  324  KSLEKLSLGFNSLS  365
            KSL+KLSLGFNSLS
Sbjct  90   KSLQKLSLGFNSLS  103



>ref|XP_009769216.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana sylvestris]
Length=982

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = +3

Query  150  IKAALQNSDTK--IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            IK++L N  TK  +F  W      C+F G+ C+SNGSVKE+ELS + LSG VPFD ICSL
Sbjct  34   IKSSLTNPTTKTNVFKNWEPNTPLCNFTGIKCNSNGSVKELELSSQSLSGFVPFDKICSL  93

Query  324  KSLEKLSLGFNSLS  365
             SLEKLSLGFNSLS
Sbjct  94   NSLEKLSLGFNSLS  107



>ref|XP_006417507.1| hypothetical protein EUTSA_v10006696mg [Eutrema salsugineum]
 dbj|BAJ34167.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35860.1| hypothetical protein EUTSA_v10006696mg [Eutrema salsugineum]
Length=975

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 51/68 (75%), Gaps = 2/68 (3%)
 Frame = +3

Query  168  NSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKL  341
            NS+  + D+W  N+   PC F GVTCDS GSV EI+LS RGLSG   FDS+C +KSLEKL
Sbjct  39   NSNPGVLDSWKLNSGAGPCGFTGVTCDSRGSVTEIDLSHRGLSGKFSFDSVCEIKSLEKL  98

Query  342  SLGFNSLS  365
            SLGFNSLS
Sbjct  99   SLGFNSLS  106



>gb|EPS73238.1| hypothetical protein M569_01518, partial [Genlisea aurea]
Length=947

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IKAA ++S T++FD+W +++  C F G+TCDSNG VKEIELS + L+G VP    C ++ 
Sbjct  21   IKAAFRDSTTRVFDSWVSQNPVCSFSGITCDSNGFVKEIELSNQNLTGVVPVSDFCRIQF  80

Query  330  LEKLSLGFNSL  362
            LEKLSLGFN+L
Sbjct  81   LEKLSLGFNNL  91



>emb|CDY20667.1| BnaC08g13910D [Brassica napus]
Length=966

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IK++L  S+  + D+W    + C F GVTCDS  SV EI+LSR+GLSG+ PF S+C LKS
Sbjct  33   IKSSLLTSNPGVLDSWKLNSNHCGFTGVTCDSTNSVTEIDLSRQGLSGTFPFHSLCDLKS  92

Query  330  LEKLSLGFNSLS  365
            L KLSLGFNSLS
Sbjct  93   LRKLSLGFNSLS  104



>ref|XP_004238042.1| PREDICTED: receptor-like protein kinase HAIKU2 [Solanum lycopersicum]
Length=984

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IK++L N  T +F  W      C F G+TC+S+GSVKEIELS + +SG VPF+ ICSL S
Sbjct  38   IKSSLSNPTTNVFQNWEPSTPLCKFTGITCNSDGSVKEIELSNQKISGVVPFNKICSLTS  97

Query  330  LEKLSLGFNSLS  365
            LEKLSLG+NS S
Sbjct  98   LEKLSLGYNSFS  109



>ref|XP_011016947.1| PREDICTED: receptor-like protein kinase HAIKU2 [Populus euphratica]
Length=987

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K +L+ S+T +FD+W++    C+F G+TC+S+ SVKEIELSR+ L G +P DSIC L+S
Sbjct  37   LKTSLKKSNTHVFDSWDSNKPICEFTGITCNSDKSVKEIELSRQNLEGVLPLDSICQLQS  96

Query  330  LEKLSLGFNSL  362
            L+KLS G+N L
Sbjct  97   LDKLSFGYNFL  107



>ref|XP_006492298.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Citrus sinensis]
Length=542

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSN-GSVKEIELSRRGLSGSVPFDSICSLK  326
            +K +L++S + IF +W + +  C+F G+TC+SN  SV+EIELS R L+G+VPFDSIC L+
Sbjct  31   LKTSLKDSKSNIFSSWVSNNHFCNFTGITCNSNRSSVQEIELSNRNLTGTVPFDSICQLQ  90

Query  327  SLEKLSLGFNSL  362
            +L KLSLGFNSL
Sbjct  91   ALNKLSLGFNSL  102



>emb|CDY62731.1| BnaC05g49230D [Brassica napus]
Length=951

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 2/74 (3%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            IK++L +S+  + D+W  N+    C F GVTCDS  SV EI+LSR+GLSG  PF S+C L
Sbjct  30   IKSSLLDSNPGVLDSWKLNSVSGHCSFTGVTCDSTSSVTEIDLSRQGLSGQFPFASLCDL  89

Query  324  KSLEKLSLGFNSLS  365
            KSLEKLSLGFNSLS
Sbjct  90   KSLEKLSLGFNSLS  103



>ref|XP_006448082.1| hypothetical protein CICLE_v10014879mg [Citrus clementina]
 gb|ESR61322.1| hypothetical protein CICLE_v10014879mg [Citrus clementina]
Length=530

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSN-GSVKEIELSRRGLSGSVPFDSICSLK  326
            +K +L++S + IF +W + +  C+F G+TC+SN  SV+EIELS R L+G+VPFDSIC L+
Sbjct  31   LKTSLKDSKSNIFSSWVSNNHFCNFTGITCNSNRSSVQEIELSDRNLTGTVPFDSICQLQ  90

Query  327  SLEKLSLGFNSL  362
            +L KLSLGFNSL
Sbjct  91   ALNKLSLGFNSL  102



>gb|KJB58765.1| hypothetical protein B456_009G225300 [Gossypium raimondii]
Length=983

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K+AL  S T + D+W A  S C F G+TCD+ GSVKEIELS + L+G +P DSIC L+S
Sbjct  37   LKSALNKSSTDVLDSWAATGSVCSFNGITCDAGGSVKEIELSSQKLTGVLPLDSICQLQS  96

Query  330  LEKLSLGFNSL  362
            L+KLS+G NSL
Sbjct  97   LDKLSMGHNSL  107



>ref|XP_010458318.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=974

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 2/68 (3%)
 Frame = +3

Query  168  NSDTKIFDTWNARH--SPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKL  341
            +S+  +FD+WN      PC F G+TC+SNG+V EI+LSR GLSG+ PF+S+C + SLEKL
Sbjct  39   DSNLSVFDSWNLNSVTGPCLFTGITCNSNGNVSEIDLSRLGLSGNFPFNSVCEIHSLEKL  98

Query  342  SLGFNSLS  365
            SLGFNSLS
Sbjct  99   SLGFNSLS  106



>gb|KFK43299.1| hypothetical protein AALP_AA1G106000 [Arabis alpina]
Length=974

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K++L NS+  + ++W      C F GVTCDS GSV EI+LS +GL+G+ P DS+C LKS
Sbjct  33   LKSSLSNSNPGVLNSWKVNSDHCRFTGVTCDSRGSVTEIDLSGQGLTGNFPIDSVCELKS  92

Query  330  LEKLSLGFNSLS  365
            L+KLSLGFNS S
Sbjct  93   LQKLSLGFNSFS  104



>ref|XP_009591322.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana tomentosiformis]
Length=982

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = +3

Query  150  IKAALQNSDTK--IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            IK++L N  TK  +F  W      C+F G+ C+S+GSVKE+ELS + LSG VPFD ICSL
Sbjct  34   IKSSLINPTTKTNVFKNWEPNTPLCNFTGIKCNSDGSVKELELSSQSLSGFVPFDKICSL  93

Query  324  KSLEKLSLGFNSLS  365
             SLEKLSLGFNSLS
Sbjct  94   NSLEKLSLGFNSLS  107



>emb|CDY53829.1| BnaA09g57210D [Brassica napus]
Length=897

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IK++L +S+    D+W    +PC F GVTC+SN SV EI+LSRR LSG+ PF  +C L S
Sbjct  34   IKSSLLDSNPDALDSWKPTSNPCTFAGVTCNSNRSVTEIDLSRRNLSGNFPFPFLCDLTS  93

Query  330  LEKLSLGFNSLS  365
            LEKLSLGFNSLS
Sbjct  94   LEKLSLGFNSLS  105



>gb|KHG17335.1| Receptor-like protein kinase HAIKU2 [Gossypium arboreum]
Length=983

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K+AL  S T + D+W A  S C F G+TCD  GSVKEIELS + L+G +P DSIC L+S
Sbjct  37   LKSALNKSSTDVLDSWAATGSFCSFNGITCDGGGSVKEIELSNQKLTGVLPLDSICQLQS  96

Query  330  LEKLSLGFNSL  362
            L+KLS+G NSL
Sbjct  97   LDKLSMGHNSL  107



>ref|XP_006472374.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Citrus sinensis]
Length=982

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSN-GSVKEIELSRRGLSGSVPFDSICSLK  326
            +K +L++S + IF +W + +  C+F G+TC+SN  SV+EIELS R L+G+VPFDSIC L+
Sbjct  31   LKTSLKDSKSNIFSSWVSNNHFCNFTGITCNSNRSSVQEIELSNRNLTGTVPFDSICQLQ  90

Query  327  SLEKLSLGFNSL  362
            +L KLSLGFNSL
Sbjct  91   ALNKLSLGFNSL  102



>ref|XP_010475857.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=975

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 2/68 (3%)
 Frame = +3

Query  168  NSDTKIFDTWNARH--SPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKL  341
            +S+  +FD+WN      PC F G+TC+SNG+V EI LS +GLSG+ PFDS+C + +LEKL
Sbjct  40   DSNLSVFDSWNLNSVTGPCRFTGITCNSNGNVSEINLSHQGLSGNFPFDSVCEIHTLEKL  99

Query  342  SLGFNSLS  365
            SLGFNSL+
Sbjct  100  SLGFNSLT  107



>ref|XP_007041450.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7, 
putative [Theobroma cacao]
 gb|EOX97281.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7, 
putative [Theobroma cacao]
Length=984

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
             ++AL+ S+T +F +W   +SPC+F GV C+SNG VKEI L ++ L GS+PFDSIC L+ 
Sbjct  38   FRSALERSNTNVFSSWTQGNSPCNFTGVVCNSNGFVKEINLPQQQLFGSLPFDSICELQY  97

Query  330  LEKLSLGFNSL  362
            LEK+ LG NSL
Sbjct  98   LEKIDLGNNSL  108



>ref|XP_010104545.1| Receptor-like protein kinase HAIKU2 [Morus notabilis]
 gb|EXC01146.1| Receptor-like protein kinase HAIKU2 [Morus notabilis]
Length=1030

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDTK-IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLK  326
            +K++LQ+  T+ IF +W+A +S C+F G+ C+S+GSV EIELS + LSG +PFD+IC L 
Sbjct  75   LKSSLQSPSTENIFSSWDATNSACNFFGIACNSDGSVSEIELSHQNLSGVLPFDTICELS  134

Query  327  SLEKLSLGFNSL  362
            SLEKLSLGFN L
Sbjct  135  SLEKLSLGFNFL  146



>ref|XP_006492299.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Citrus sinensis]
Length=542

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSN-GSVKEIELSRRGLSGSVPFDSICSLK  326
            +K +L++S + IF +W + +  C+F G+TC+SN  SV+EIELS R L+G+ PFDSIC L+
Sbjct  31   LKTSLKDSKSNIFSSWVSNNHLCNFTGITCNSNRSSVQEIELSDRNLTGTAPFDSICQLQ  90

Query  327  SLEKLSLGFNSL  362
            +L KLSLGFNSL
Sbjct  91   ALNKLSLGFNSL  102



>ref|XP_006386429.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP64226.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=986

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K +L+ S+T +FD+W++    C+F G+TC+S+ SVKEIELS + L G +P DSIC L+S
Sbjct  37   LKTSLKKSNTHVFDSWDSNKPICEFTGITCNSDKSVKEIELSGQNLEGVLPLDSICQLQS  96

Query  330  LEKLSLGFNSL  362
            L+KLS G+N L
Sbjct  97   LDKLSFGYNFL  107



>emb|CDO97335.1| unnamed protein product [Coffea canephora]
Length=1050

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K+ L+++D+ +FDTW  ++S C+F GVTCDSN  V EI LS + LSG V FD ICSL+S
Sbjct  91   LKSTLRSADSPVFDTWTWQNSACNFTGVTCDSNHKVTEINLSLQNLSGPVSFDLICSLES  150

Query  330  LEKLSLGFNSL  362
            LEK+SLG N L
Sbjct  151  LEKISLGSNFL  161



>gb|KHG23504.1| Receptor-like protein kinase HAIKU2 [Gossypium arboreum]
Length=962

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K+AL  S+T + D+W A  S C F G+TC++ G VKEIELS + L G +P DSIC L+ 
Sbjct  21   LKSALNESNTNVLDSWEATSSVCSFNGITCNAQGFVKEIELSHQNLLGVLPLDSICQLQY  80

Query  330  LEKLSLGFNSL  362
            L+KLSLGFN L
Sbjct  81   LDKLSLGFNLL  91



>ref|XP_006433710.1| hypothetical protein CICLE_v10000155mg [Citrus clementina]
 gb|ESR46950.1| hypothetical protein CICLE_v10000155mg [Citrus clementina]
Length=982

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSN-GSVKEIELSRRGLSGSVPFDSICSLK  326
            +K +L++S + IF +W + +  C+F G+TC+SN  SV+EIELS R L+G+VPFDSIC L+
Sbjct  31   LKTSLKDSKSNIFSSWVSNNHFCNFTGITCNSNRSSVQEIELSNRNLTGTVPFDSICQLQ  90

Query  327  SLEKLSLGFNSL  362
            +L KLSLG NSL
Sbjct  91   ALNKLSLGLNSL  102



>ref|XP_004501071.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Cicer arietinum]
Length=985

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K+ LQNS+TK F++WN  +S C F G+TC+S  SV EI LS + LSG++P DS+C+L+S
Sbjct  38   VKSTLQNSNTKFFNSWNPNNSVCSFKGITCNSINSVTEINLSHKNLSGTLPLDSLCNLQS  97

Query  330  LEKLSLGFN  356
            L KL L FN
Sbjct  98   LTKLVLSFN  106



>ref|XP_008236214.1| PREDICTED: receptor-like protein kinase HAIKU2, partial [Prunus 
mume]
Length=950

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K ALQNS+  +F +W      C+F GV C+SNG V EI LS++ LSG +PFDSICSL+ 
Sbjct  20   LKTALQNSNPSVFTSWTEATPICNFTGVVCNSNGLVSEINLSQQKLSGFLPFDSICSLQY  79

Query  330  LEKLSLGFNSL  362
            L+KLSLG+N L
Sbjct  80   LKKLSLGWNGL  90



>ref|XP_003522732.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Glycine 
max]
Length=983

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K++LQNS++K+  +WNA +S C F GVTC+S  SV EI LS + LSG +PFDS+C L S
Sbjct  33   LKSSLQNSNSKLLHSWNATNSVCTFHGVTCNSLNSVTEINLSNQTLSGVLPFDSLCKLPS  92

Query  330  LEKLSLGFNSLS  365
            L+KL  GFN+L+
Sbjct  93   LQKLVFGFNNLN  104



>ref|XP_008219159.1| PREDICTED: receptor-like protein kinase HAIKU2 [Prunus mume]
Length=1017

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 53/74 (72%), Gaps = 2/74 (3%)
 Frame = +3

Query  150  IKAALQNSDTK--IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +K+  QNS+T   IF TWN+  + C F G+ C+ N SV+EIELS + LSG +  D IC L
Sbjct  68   LKSTFQNSNTNSSIFSTWNSSSALCSFSGIVCNENNSVREIELSNQNLSGFLALDEICQL  127

Query  324  KSLEKLSLGFNSLS  365
            +SLEKL+LGFNSL+
Sbjct  128  QSLEKLALGFNSLN  141



>ref|XP_010553669.1| PREDICTED: receptor-like protein kinase HAIKU2 [Tarenaya hassleriana]
Length=977

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +K++L  SD+ +FD+W  ++    C F G+TCDS GSV EI+LS R L+G+ PF+S+C L
Sbjct  31   LKSSLGASDSAVFDSWKPDSVAGACGFAGITCDSAGSVAEIDLSNRNLTGNFPFNSVCEL  90

Query  324  KSLEKLSLGFNSLS  365
            ++L+KLSLGFN LS
Sbjct  91   RNLQKLSLGFNFLS  104



>gb|KJB29385.1| hypothetical protein B456_005G097600 [Gossypium raimondii]
Length=975

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            + +AL  S+T + D+W A  S C F G+TC++ G VKEIELS + L G +P DSIC LK 
Sbjct  34   LTSALNESNTNVLDSWEATSSVCSFNGITCNAQGFVKEIELSHQNLLGVLPLDSICQLKY  93

Query  330  LEKLSLGFNSL  362
            L+KLSLGFN L
Sbjct  94   LDKLSLGFNLL  104



>gb|KDP35915.1| hypothetical protein JCGZ_09887 [Jatropha curcas]
Length=1036

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K+A +NS T +F++W   +  C+F G+ C++NG VKEI LSR+ L G VPFDSICSL+S
Sbjct  85   LKSAFKNSRTDVFNSWTQENPVCNFTGIICNNNGFVKEINLSRQQLVGVVPFDSICSLQS  144

Query  330  LEKLSLGFNSL  362
            LE +S+G N L
Sbjct  145  LEIISMGSNFL  155



>gb|KDO42361.1| hypothetical protein CISIN_1g012103mg [Citrus sinensis]
Length=471

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGS-VKEIELSRRGLSGSVPFDSICSLK  326
            +K +L++S + IF +W + +  C+F G+TC+S+ S V+EIELS R L G++PFDSIC L+
Sbjct  31   LKTSLKDSKSSIFSSWVSNNHFCNFTGITCNSDSSFVQEIELSNRNLKGTLPFDSICQLQ  90

Query  327  SLEKLSLGFNSL  362
            +L KLSLGFNSL
Sbjct  91   ALHKLSLGFNSL  102



>ref|XP_007199705.1| hypothetical protein PRUPE_ppa000895mg [Prunus persica]
 gb|EMJ00904.1| hypothetical protein PRUPE_ppa000895mg [Prunus persica]
Length=968

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K ALQ S+  +F +W      C F GV C+SNG V EI LS++ LSG +PFDSICSL+S
Sbjct  38   LKTALQGSNPTVFTSWTEATPICSFTGVVCNSNGLVSEINLSQQKLSGILPFDSICSLQS  97

Query  330  LEKLSLGFNSL  362
            L+KLSLG+N L
Sbjct  98   LKKLSLGWNGL  108



>ref|XP_003526519.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Glycine 
max]
 gb|KHN09043.1| Receptor-like protein kinase HAIKU2 [Glycine soja]
Length=983

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K+ L NS++K+F +WNA +S C F GVTC+S  SV EI LS + LSG +PFDS+C L S
Sbjct  32   LKSTLHNSNSKLFHSWNATNSVCTFLGVTCNSLNSVTEINLSNQTLSGVLPFDSLCKLPS  91

Query  330  LEKLSLGFNSLS  365
            L+KL  G+N L+
Sbjct  92   LQKLVFGYNYLN  103



>ref|XP_010544042.1| PREDICTED: receptor-like protein kinase HAIKU2 [Tarenaya hassleriana]
Length=969

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +K++L ++++  FD+W  ++    C F G+ CDS GSV+EIEL  R LSG+ PFDS+C L
Sbjct  31   LKSSLADTNSVFFDSWRPDSVAGACGFSGIICDSTGSVEEIELGNRNLSGNFPFDSVCEL  90

Query  324  KSLEKLSLGFNSLS  365
             +L KLSLGFNSLS
Sbjct  91   PNLRKLSLGFNSLS  104



>ref|XP_007020154.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7, 
putative [Theobroma cacao]
 gb|EOY17379.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7, 
putative [Theobroma cacao]
Length=473

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDT-KIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLK  326
            +K+AL  S T  + D+W A +S C F G+TC++ GSVK+IELS + L G +P DSIC L+
Sbjct  37   LKSALNKSSTPNVLDSWEAANSVCSFNGITCNAEGSVKKIELSSQKLRGVLPLDSICQLQ  96

Query  327  SLEKLSLGFNSL  362
            SL+KLSLG+N L
Sbjct  97   SLDKLSLGYNLL  108



>gb|KJB77870.1| hypothetical protein B456_012G162000 [Gossypium raimondii]
Length=963

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K+ALQNS+T +F +W    S C+F GV C+SNG VKEI L  + L G +PF SIC LKS
Sbjct  34   LKSALQNSNTDVFSSWIQGRSACNFNGVVCNSNGFVKEINLPHQQLIGYIPFGSICELKS  93

Query  330  LEKLSLGFNSL  362
            L K+  G NSL
Sbjct  94   LVKIDFGDNSL  104



>ref|XP_003541774.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Glycine 
max]
 gb|KHN19047.1| Receptor-like protein kinase HAIKU2 [Glycine soja]
Length=964

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
             K+++Q+S+  +F +W   +SPC F G+ C+S G V EI L+ + L G+VPFDS+C L+S
Sbjct  35   FKSSIQSSNANVFSSWTQANSPCQFTGIVCNSKGFVSEINLAEQQLKGTVPFDSLCELQS  94

Query  330  LEKLSLGFN  356
            LEK+SLG N
Sbjct  95   LEKISLGSN  103



>ref|XP_007227019.1| hypothetical protein PRUPE_ppa001010mg [Prunus persica]
 gb|EMJ28218.1| hypothetical protein PRUPE_ppa001010mg [Prunus persica]
Length=934

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +3

Query  150  IKAALQNSDTK--IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +K+  QNS+T   IF TWN+ +  C F G+ C+   SV+EIELS   LSG +  D IC L
Sbjct  39   LKSTFQNSNTNSSIFSTWNSSNPLCSFSGIVCNEKNSVREIELSNGNLSGFLALDEICQL  98

Query  324  KSLEKLSLGFNSLS  365
            +SLEKL+LGFNSL+
Sbjct  99   QSLEKLALGFNSLN  112



>ref|XP_011002775.1| PREDICTED: receptor-like protein kinase HAIKU2 [Populus euphratica]
Length=988

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
             K+A+Q+S T +F TW   +S C+F G+ C+ NG V EI L ++ L G +PFD+IC L+S
Sbjct  38   FKSAVQHSKTNVFTTWTRENSVCNFTGIVCNENGFVTEINLPQQQLEGVLPFDAICGLRS  97

Query  330  LEKLSLGFNSL  362
            LEK+S+G N L
Sbjct  98   LEKISMGSNFL  108



>ref|XP_007148314.1| hypothetical protein PHAVU_006G198200g [Phaseolus vulgaris]
 gb|ESW20308.1| hypothetical protein PHAVU_006G198200g [Phaseolus vulgaris]
Length=968

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K++LQ+S+  +F +W    SPC F G+ C+  G V EI L ++ L G+VPFDS+C L+SL
Sbjct  41   KSSLQSSNASVFSSWAPEKSPCLFTGIVCNFKGFVSEINLPQKQLEGAVPFDSLCELQSL  100

Query  333  EKLSLGFNSLS  365
            EK+SLG N+LS
Sbjct  101  EKISLGSNNLS  111



>ref|XP_002271143.2| PREDICTED: receptor-like protein kinase HAIKU2 [Vitis vinifera]
Length=975

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
             K+AL+ S+T +FDTW   +S  +F G+ C+SNG V EI L  + L G +PFDSIC LKS
Sbjct  37   FKSALEKSNTSVFDTWTQGNSVRNFTGIVCNSNGFVTEILLPEQQLEGVLPFDSICELKS  96

Query  330  LEKLSLGFNSL  362
            LEK+ LG N L
Sbjct  97   LEKIDLGANVL  107



>emb|CAN65551.1| hypothetical protein VITISV_033329 [Vitis vinifera]
Length=1253

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
             K+AL+ S+T +FDTW   +S  +F G+ C+SNG V EI L  + L G +PFDSIC LKS
Sbjct  37   FKSALEKSNTSVFDTWTQGNSVRNFTGIVCNSNGFVTEILLPEQQLEGVLPFDSICELKS  96

Query  330  LEKLSLGFNSL  362
            LEK+ LG N L
Sbjct  97   LEKIDLGANVL  107



>ref|XP_009407104.1| PREDICTED: uncharacterized protein LOC103989885 [Musa acuminata 
subsp. malaccensis]
Length=1974

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = +3

Query  153  KAALQNS-DTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            KA+LQ + ++  F +W+A +  C F G+ CDSNGSV EI+L+  G+SG +PFDS+C L S
Sbjct  36   KASLQTAANSTAFRSWDASNPTCSFDGIRCDSNGSVSEIDLTSAGISGEIPFDSLCRLPS  95

Query  330  LEKLSLGFNSL  362
            L  LSLG+N L
Sbjct  96   LSALSLGYNGL  106


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +3

Query  210   SPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSL  362
             SPC+FPG+ CD N  V EI+LS   L+G  P     SL  L  L LGFN +
Sbjct  1083  SPCNFPGIACDDNEYVVEIDLSSWLLTGGFPPAVCESLPGLRVLRLGFNEI  1133



>ref|XP_008466102.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis melo]
Length=982

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K++L  S++ +F TW  ++  C F G+ CDS G V +I+LS++ LSG VPFDS+C L +
Sbjct  34   LKSSLHTSNSNVFHTWTLQNPICSFSGIVCDSRGFVTQIDLSQQALSGVVPFDSLCQLPA  93

Query  330  LEKLSLGFNSLS  365
            LEKL+L  NSLS
Sbjct  94   LEKLALRSNSLS  105



>ref|XP_008339015.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=986

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDTK-IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLK  326
            +K+A Q S+T  IF+TWN+    C F G+ C+ NG V++I+LS + LSG +  D+IC LK
Sbjct  38   LKSAFQGSNTNNIFNTWNSTSXVCSFTGIACNENGFVRDIDLSNQNLSGFLAADAICQLK  97

Query  327  SLEKLSLGFNSL  362
            SLE LSLGFN L
Sbjct  98   SLETLSLGFNFL  109



>ref|XP_009416779.1| PREDICTED: receptor-like protein kinase HAIKU2 [Musa acuminata 
subsp. malaccensis]
Length=1026

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +3

Query  153  KAALQNS-DTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            KA+L+ S +  +F +W+A  S C F G+ CDSNGSV EI+L+  G+SG + FDS+C L S
Sbjct  45   KASLKASTNATVFQSWDAGSSACSFAGIKCDSNGSVSEIDLTETGISGEIAFDSLCRLPS  104

Query  330  LEKLSLGFNSLS  365
            L  LSLG NSL+
Sbjct  105  LSALSLGSNSLT  116



>ref|XP_009335487.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=987

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +3

Query  150  IKAALQ--NSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +K+ LQ  N++  IF+TWN+ +S C F G+ C+ NG V++I+LS + LSG +  D+IC L
Sbjct  38   LKSTLQASNTNNNIFNTWNSTNSVCSFTGIACNENGFVRDIDLSNQNLSGFLAADAICQL  97

Query  324  KSLEKLSLGFNSL  362
            +SLE LSLGFN L
Sbjct  98   ESLETLSLGFNFL  110



>ref|XP_006422685.1| hypothetical protein CICLE_v10027748mg [Citrus clementina]
 gb|ESR35925.1| hypothetical protein CICLE_v10027748mg [Citrus clementina]
Length=991

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K+ ++ SDT +F +W   +S C F G+ CDSNG V EI L  + L G VPFDSIC L++
Sbjct  47   LKSKIEKSDTGVFSSWTEANSVCKFNGIVCDSNGLVAEINLPEQQLLGVVPFDSICGLQA  106

Query  330  LEKLSLGFNSL  362
            L+K++LG N L
Sbjct  107  LQKINLGTNFL  117



>ref|XP_002313944.2| hypothetical protein POPTR_0009s08540g [Populus trichocarpa]
 gb|EEE87899.2| hypothetical protein POPTR_0009s08540g [Populus trichocarpa]
Length=989

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
             K+A+Q+S T +F TW   +S C F G+ C+ N  V EI L ++ L G +PFD+IC L+S
Sbjct  38   FKSAVQHSKTNVFTTWTQENSVCSFTGIVCNKNRFVTEINLPQQQLEGVLPFDAICGLRS  97

Query  330  LEKLSLGFNSL  362
            LEK+S+G NSL
Sbjct  98   LEKISMGSNSL  108



>gb|KDO67927.1| hypothetical protein CISIN_1g002250mg [Citrus sinensis]
Length=947

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K+ ++ SDT +F +W   +S C F G+ CDSNG V EI L  + L G VPFDSIC L++
Sbjct  3    LKSKIEKSDTGVFSSWTEANSVCKFNGIVCDSNGLVAEINLPEQQLLGVVPFDSICGLQA  62

Query  330  LEKLSLGFNSL  362
            L+K++LG N L
Sbjct  63   LQKINLGTNFL  73



>ref|XP_006486805.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Citrus sinensis]
Length=991

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K+ ++ SDT +F +W   +S C F G+ CDSNG V EI L  + L G VPFDSIC L++
Sbjct  47   LKSKIEKSDTGVFSSWTEANSVCKFNGIVCDSNGLVAEINLPEQQLLGVVPFDSICGLQA  106

Query  330  LEKLSLGFNSL  362
            L+K++LG N L
Sbjct  107  LQKINLGTNFL  117



>ref|XP_007018364.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7 
[Theobroma cacao]
 gb|EOY15589.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7 
[Theobroma cacao]
Length=987

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDT-KIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLK  326
            +K+AL  S T  + D+W A +  C F G+TC++ GSVKEIELS + L+G +P DSIC L 
Sbjct  37   LKSALNRSSTPNVLDSWEAANHVCSFHGITCNAEGSVKEIELSSQKLTGVLPLDSICQLP  96

Query  327  SLEKLSLGFNSL  362
            SL+KLSLG N L
Sbjct  97   SLDKLSLGHNLL  108



>gb|KEH36110.1| LRR receptor-like kinase [Medicago truncatula]
Length=878

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +3

Query  150  IKAALQNSDTK-IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLK  326
            +K +L+N +TK  F++WNA  S C F G+TC+S  SV EI LS + LSG +P DS+C+L+
Sbjct  30   LKTSLENPNTKDFFNSWNANSSICSFHGITCNSINSVTEINLSHKNLSGILPIDSLCNLQ  89

Query  327  SLEKLSLGFN  356
            SL KL LGFN
Sbjct  90   SLTKLVLGFN  99



>gb|KEH36109.1| LRR receptor-like kinase [Medicago truncatula]
Length=986

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +3

Query  150  IKAALQNSDTK-IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLK  326
            +K +L+N +TK  F++WNA  S C F G+TC+S  SV EI LS + LSG +P DS+C+L+
Sbjct  30   LKTSLENPNTKDFFNSWNANSSICSFHGITCNSINSVTEINLSHKNLSGILPIDSLCNLQ  89

Query  327  SLEKLSLGFN  356
            SL KL LGFN
Sbjct  90   SLTKLVLGFN  99



>ref|XP_004292067.1| PREDICTED: receptor-like protein kinase HAIKU2 [Fragaria vesca 
subsp. vesca]
Length=979

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IKA+L+ S+  +F +WN     C+F G+ C+SN  V EI LS++ LSGS+PFD++CSL  
Sbjct  37   IKASLETSNPTLFSSWNQETPTCNFTGIVCNSNELVSEINLSQQNLSGSLPFDALCSLPE  96

Query  330  LEKLSLGFNSL  362
            L+KLS G N L
Sbjct  97   LKKLSFGSNFL  107



>ref|XP_008378672.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=987

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +3

Query  150  IKAALQ--NSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            IK+ LQ  N++  IF+TWN+ +S C F G+ C  NG V+ I+LS + LSG +  D+IC L
Sbjct  38   IKSTLQVSNTNNNIFNTWNSTNSVCSFTGIACXENGFVRXIDLSNQNLSGFLAADAICQL  97

Query  324  KSLEKLSLGFNSL  362
            +SLE LSLGFN L
Sbjct  98   ESLETLSLGFNFL  110



>ref|XP_009144482.1| PREDICTED: receptor-like protein kinase HAIKU2 [Brassica rapa]
Length=966

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IK++L  S+    D+W    + C F GVTCDS  SV EI LS + LSG+ PF S+ +LK+
Sbjct  33   IKSSLLTSNPGALDSWKLNSNHCSFTGVTCDSTNSVTEINLSHQTLSGTFPFHSLSALKN  92

Query  330  LEKLSLGFNSLS  365
            L+KLSLGFNSLS
Sbjct  93   LQKLSLGFNSLS  104



>ref|XP_007137286.1| hypothetical protein PHAVU_009G114500g [Phaseolus vulgaris]
 gb|ESW09280.1| hypothetical protein PHAVU_009G114500g [Phaseolus vulgaris]
Length=981

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSD-TKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLK  326
            +K++L NS  +K+FD+WN  +S C F GVTC++  SV EI LS + L+G +PFDS+C+L 
Sbjct  31   LKSSLHNSKFSKLFDSWNDNNSVCSFHGVTCNTLRSVTEINLSDQTLTGVLPFDSLCNLP  90

Query  327  SLEKLSLGFNSL  362
            SL+KL  GFN L
Sbjct  91   SLQKLVFGFNDL  102



>ref|XP_010667749.1| PREDICTED: receptor-like protein kinase HAIKU2 [Beta vulgaris 
subsp. vulgaris]
Length=979

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  183  IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSL  362
            +F TW + +  CDF G++C++ G+V EI+LS++ LSG++PFD+ICSL SL+KL+ GFNSL
Sbjct  41   LFSTWISSNPICDFHGISCNNAGNVIEIDLSKQRLSGTLPFDTICSLPSLQKLAFGFNSL  100

Query  363  S  365
            S
Sbjct  101  S  101



>ref|XP_004485648.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Cicer arietinum]
Length=969

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K+++Q S T +F +WN  +SPC+F G+ C+SNG V +I L  R L G++PF SIC+L+ L
Sbjct  41   KSSIQTSHTNLFTSWNQSNSPCNFTGILCNSNGFVSQINLPNRTLMGTLPFHSICNLQFL  100

Query  333  EKLSLGFNSL  362
            EK+SL  N L
Sbjct  101  EKISLESNFL  110



>ref|XP_010268649.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nelumbo nucifera]
Length=1004

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K ALQ SDT +FD+W    +PC F GV C  +GSV  I+LS   L G +P DSIC L S
Sbjct  42   LKTALQKSDTHVFDSWTPNGNPCKFDGVICGLDGSVTGIDLSNNRLVGVLPLDSICQLPS  101

Query  330  LEKLSLGFNSL  362
            L+ LSLG N L
Sbjct  102  LQMLSLGNNLL  112



>gb|KJB64050.1| hypothetical protein B456_010G030600 [Gossypium raimondii]
Length=985

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K+AL  S T  F++W   +S C F G+TC+  G + E++LS + L+G +PFDS+C L S
Sbjct  41   LKSALNKSTTTAFNSWQTPNSICTFNGITCNHEGFITELDLSTQNLTGILPFDSLCKLPS  100

Query  330  LEKLSLGFNSL  362
            L+KLS G+NSL
Sbjct  101  LQKLSFGYNSL  111



>emb|CDY31055.1| BnaA08g26050D [Brassica napus]
Length=966

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IK++L  S+    D+W    + C F GVTCDS  SV EI LS + LSG+ PF S+  LK+
Sbjct  33   IKSSLLTSNPGALDSWKLNSNHCSFTGVTCDSTNSVTEINLSHQTLSGTFPFHSLSDLKN  92

Query  330  LEKLSLGFNSLS  365
            L+KLSLGFNSLS
Sbjct  93   LQKLSLGFNSLS  104



>ref|XP_003593346.1| Receptor-like protein kinase HAIKU2 [Medicago truncatula]
 gb|AES63597.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=979

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
             K+++Q S   IF +WN   SPC+F GV C+S G V +I L+ + L G++PFDSIC +K 
Sbjct  50   FKSSIQTSLPNIFTSWNTSTSPCNFTGVLCNSEGFVTQINLANKNLVGTLPFDSICKMKY  109

Query  330  LEKLSLGFNSL  362
            LEK+SL  N L
Sbjct  110  LEKISLESNFL  120



>emb|CBI25073.3| unnamed protein product [Vitis vinifera]
Length=650

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +3

Query  156  AALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLE  335
            ++L+ S+T +FDTW   +S  +F G+ C+SNG V EI L  + L G +PFDSIC LKSLE
Sbjct  21   SSLEKSNTSVFDTWTQGNSVRNFTGIVCNSNGFVTEILLPEQQLEGVLPFDSICELKSLE  80

Query  336  KLSLGFNSL  362
            K+ LG N L
Sbjct  81   KIDLGANVL  89



>ref|XP_009779240.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana sylvestris]
Length=990

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  177  TKIFDTWNARHSPCDFPGVTCDSNGS-VKEIELSRRGLSGSVPFDSICSLKSLEKLSLGF  353
            +++FDTW   +S C+F G+ CDS    VKEI LS + LSG V FDS+CSLKSLEKLSLG 
Sbjct  47   SQLFDTWTPENSICNFTGIICDSTSQLVKEIYLSEQNLSGVVSFDSLCSLKSLEKLSLGS  106

Query  354  NSLS  365
            N L+
Sbjct  107  NFLN  110



>ref|XP_002522038.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF40238.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=996

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
             K++L++S+T +F +W  + S C F G+ C ++G VKEI L  + L G VPF SIC+L+ 
Sbjct  41   FKSSLKDSETNVFSSWTEQSSVCKFTGIVCTADGFVKEISLPEKKLQGVVPFGSICALQY  100

Query  330  LEKLSLGFNSL  362
            LEK+SLG N L
Sbjct  101  LEKISLGSNFL  111



>ref|XP_010061583.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
 gb|KCW68568.1| hypothetical protein EUGRSUZ_F02181 [Eucalyptus grandis]
Length=982

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            + A L+  ++  F +W   + PC F G+ CD NGSV  I+LS + L+G +P  S+C LK+
Sbjct  39   LTATLRTPNSNPFSSWTPNNPPCRFAGIACDVNGSVTAIDLSNQQLTGVLPLGSLCELKN  98

Query  330  LEKLSLGFNSL  362
            LE+L+LGFNSL
Sbjct  99   LERLALGFNSL  109



>gb|KJB16079.1| hypothetical protein B456_002G211900 [Gossypium raimondii]
Length=968

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
             K++++ SD+ +F +W    S C+F GV C+SNG V EI L ++ + G +PFDSIC L++
Sbjct  60   FKSSVERSDSNVFSSWTQGKSACNFSGVVCNSNGFVTEINLPQQQIVGYLPFDSICELQA  119

Query  330  LEKLSLGFNSL  362
            LEK+ +G NS 
Sbjct  120  LEKIDVGNNSF  130



>gb|KJB16078.1| hypothetical protein B456_002G211900 [Gossypium raimondii]
Length=996

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K++++ SD+ +F +W    S C+F GV C+SNG V EI L ++ + G +PFDSIC L++L
Sbjct  61   KSSVERSDSNVFSSWTQGKSACNFSGVVCNSNGFVTEINLPQQQIVGYLPFDSICELQAL  120

Query  333  EKLSLGFNSL  362
            EK+ +G NS 
Sbjct  121  EKIDVGNNSF  130



>gb|KFK39298.1| hypothetical protein AALP_AA3G226400 [Arabis alpina]
Length=986

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = +3

Query  165  QNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGL--SGSVPFDSICSLKSLEK  338
            + +   +F TW  R+S C+F G+ C+S G V EI L  R L  SG +PFDSIC LK LEK
Sbjct  39   ETNSNDVFSTWTNRNSVCEFAGIVCNSGGHVVEINLGSRNLTNSGDIPFDSICDLKFLEK  98

Query  339  LSLGFNSL  362
            L+LG NSL
Sbjct  99   LALGNNSL  106



>ref|XP_004136412.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Cucumis 
sativus]
 ref|XP_004165068.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Cucumis 
sativus]
 gb|KGN60296.1| Receptor protein kinase CLAVATA1 [Cucumis sativus]
Length=981

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K++L  S++ +F  W  ++  C F G+ C+S+G V +I+LS++ LSG VPFDS+C L +L
Sbjct  35   KSSLHTSNSNVFHNWTLQNPICTFSGIACNSHGFVTQIDLSQQALSGVVPFDSLCQLPAL  94

Query  333  EKLSLGFNSLS  365
            EKL+L  NSLS
Sbjct  95   EKLALRSNSLS  105



>ref|XP_010065822.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
Length=995

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  171  SDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLG  350
            S T +F +W   +  C+F G+ C+S+G V EI LS+ GL G++PFDSICSL SLEK+ LG
Sbjct  48   STTGVFSSWRVGNDKCNFTGIVCNSDGFVTEINLSQMGLVGTLPFDSICSLGSLEKIDLG  107

Query  351  FN  356
             N
Sbjct  108  EN  109



>ref|XP_009357239.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=983

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDTK-IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLK  326
            +K+A Q S+T  IF++WN+ +  C F G+ C  NG V++I+LS + LSG +  D+IC LK
Sbjct  35   LKSAFQGSNTNNIFNSWNSTNPVCSFNGIACHENGFVRDIDLSNQNLSGFLAADAICQLK  94

Query  327  SLEKLSLGFNSL  362
            SLE LS GFN L
Sbjct  95   SLETLSFGFNFL  106



>gb|KCW63493.1| hypothetical protein EUGRSUZ_G01123 [Eucalyptus grandis]
Length=1003

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +3

Query  159  ALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEK  338
            AL  S+  +F +W   +  C+F G+ C+S+G V EI LS+ GL G++PFDSICSL SLEK
Sbjct  52   ALPLSERGVFSSWRVGNDKCNFTGIVCNSDGFVTEINLSQMGLVGTLPFDSICSLGSLEK  111

Query  339  LSLGFN  356
            + LG N
Sbjct  112  IDLGEN  117



>ref|XP_006367082.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Solanum 
tuberosum]
Length=1008

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +3

Query  177  TKIFDTWNARHSPCDFPGVTCDSNGS-VKEIELSRRGLSGSVPFDSICSLKSLEKLSLGF  353
            + +FDTW  +++ C+F GV CDS+   VKEI LS + LSG V FDS+CSLKSLEK+SLG 
Sbjct  75   SHLFDTWTPQNNICNFTGVFCDSDSKLVKEIILSEQNLSGVVSFDSLCSLKSLEKISLGT  134

Query  354  NSL  362
            N L
Sbjct  135  NYL  137



>ref|XP_004230660.1| PREDICTED: receptor-like protein kinase HAIKU2 [Solanum lycopersicum]
Length=980

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = +3

Query  177  TKIFDTWNARHSPCDFPGVTCDSNGS-VKEIELSRRGLSGSVPFDSICSLKSLEKLSLGF  353
            +++FDTW  +++ C+F G+ CDS+   VKEI LS + LSG V FDS+CSLKSL+K+SLG 
Sbjct  47   SELFDTWTPQNNICNFTGIFCDSDSKLVKEINLSEQNLSGVVSFDSLCSLKSLQKISLGT  106

Query  354  NSL  362
            N L
Sbjct  107  NYL  109



>ref|XP_009616818.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana tomentosiformis]
Length=986

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +3

Query  177  TKIFDTWNARHSPCDFPGVTCDSNGS-VKEIELSRRGLSGSVPFDSICSLKSLEKLSLGF  353
            +++FDTW   +S C+F G+ C+S    VKEI LS + LSG V FDS+CSLKSLEKLSLG 
Sbjct  47   SQLFDTWTPENSICNFTGIICNSTSQLVKEIYLSEQNLSGVVSFDSLCSLKSLEKLSLGS  106

Query  354  NSL  362
            N L
Sbjct  107  NFL  109



>ref|XP_010668040.1| PREDICTED: receptor-like protein kinase HAIKU2 [Beta vulgaris 
subsp. vulgaris]
Length=973

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K+ LQ ++  +F +W   +  C+F G++C++ G++  I+LS++ LSG++ F +ICS+ SL
Sbjct  33   KSHLQTTNVNLFSSWLPSNPTCNFTGISCNNAGNITGIDLSKQALSGTIHFQAICSIPSL  92

Query  333  EKLSLGFNSLS  365
            +KL LGFNSLS
Sbjct  93   QKLDLGFNSLS  103



>ref|XP_008372891.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=973

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K +L+ S+  +F TW   +  C+F G+ CDS+G V EI LS++ LSG +P  +ICSL S
Sbjct  40   LKQSLETSNPSLFTTWAPPNGVCNFTGIVCDSDGFVSEINLSQQNLSGFLPLHAICSLPS  99

Query  330  LEKLSLGFNSL  362
            L+KLSLG N L
Sbjct  100  LKKLSLGSNGL  110



>ref|XP_010107637.1| Receptor-like protein kinase HAIKU2 [Morus notabilis]
 gb|EXC54479.1| Receptor-like protein kinase HAIKU2 [Morus notabilis]
Length=988

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +3

Query  150  IKAAL--QNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +K AL  ++  + +F +W   +  C+F G+ C+S GSV EI+LS R LSG +P D+ICSL
Sbjct  36   LKTALLPESKTSDVFSSWKEDNPVCNFIGIGCNSEGSVTEIDLSGRNLSGVIPLDAICSL  95

Query  324  KSLEKLSLGFNSL  362
            +SLEK+SL  NSL
Sbjct  96   QSLEKISLSSNSL  108



>ref|XP_010943231.1| PREDICTED: receptor-like protein kinase HAIKU2 [Elaeis guineensis]
Length=1002

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K +L   + K F++W   +SPC+F G+ C+S  SV EI L  RG SG +P  S+C L S
Sbjct  33   LKTSLGLDNIKGFESWTPDNSPCNFTGIVCNSANSVAEINLRNRGFSGELPLSSLCQLPS  92

Query  330  LEKLSLGFNSL  362
            L +LSLG+N L
Sbjct  93   LSELSLGYNHL  103



>ref|XP_009378558.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
 ref|XP_009378566.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=973

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K +L+ S+  +F TW   +  C+F G+ CDS+G V EI LS++ LSG +P  +ICSL S
Sbjct  40   LKQSLETSNPSLFTTWAPPNWVCNFTGIVCDSDGFVSEINLSQQNLSGFLPLHAICSLPS  99

Query  330  LEKLSLGFNSL  362
            L+KLSLG N L
Sbjct  100  LKKLSLGSNGL  110



>ref|XP_010271554.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nelumbo nucifera]
Length=993

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            KAAL +SDT  F +W   ++PC+F GV C S+GSV EI L  + L G +P DSIC L SL
Sbjct  38   KAALHSSDTHAFHSWIPGNAPCNFTGVLCGSDGSVTEINLPNQRLVGVLPLDSICQLPSL  97

Query  333  EKLSLGFNSL  362
              L LG N L
Sbjct  98   RVLYLGNNFL  107



>ref|XP_010060141.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
Length=1050

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +  ALQ++   +F +W      C+F GV CD+ GSV  I+LS + L+G +P DSIC+L S
Sbjct  98   LPGALQSASPDVFSSWTPTTPACNFTGVACDAAGSVVSIDLSSQQLTGVLPLDSICTLPS  157

Query  330  LEKLSLGFNSL  362
            LE+L+ G NSL
Sbjct  158  LERLAFGGNSL  168



>gb|KCW66704.1| hypothetical protein EUGRSUZ_F00467 [Eucalyptus grandis]
Length=985

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +  ALQ++   +F +W      C+F GV CD+ GSV  I+LS + L+G +P DSIC+L S
Sbjct  33   LPGALQSASPDVFSSWTPTTPACNFTGVACDAAGSVVSIDLSSQQLTGVLPLDSICTLPS  92

Query  330  LEKLSLGFNSL  362
            LE+L+ G NSL
Sbjct  93   LERLAFGGNSL  103



>ref|XP_004299841.2| PREDICTED: receptor-like protein kinase HAIKU2 [Fragaria vesca 
subsp. vesca]
Length=1022

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 4/69 (6%)
 Frame = +3

Query  168  NSDTKIFDTWN----ARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLE  335
            +S+T++F TW+    A +S C F G+TC+   SV EI+LS + LSGS+P DSIC L SLE
Sbjct  75   DSNTQLFSTWDSSSTANYSFCSFTGITCNGVNSVLEIDLSNKKLSGSLPLDSICQLPSLE  134

Query  336  KLSLGFNSL  362
            KL+ G N L
Sbjct  135  KLAFGSNFL  143



>ref|XP_009346454.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=973

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K  L+NS+  +F +W   +  C+F G+ C S+G V +I LSR+ LSG +P  +ICSL S
Sbjct  40   LKRYLENSNPSLFTSWAPPNGVCNFTGIVCGSDGLVSQINLSRQNLSGFLPLHAICSLPS  99

Query  330  LEKLSLGFNSL  362
            L+KLSLG N L
Sbjct  100  LKKLSLGSNGL  110



>ref|XP_009394911.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Musa acuminata subsp. malaccensis]
Length=841

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNAR-HSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLK  326
             KA+L  +    F++W +   S C F G+ CDS GSV E++L+  GLSG++PF S+C L 
Sbjct  31   FKASLSTTKNNTFESWTSEGRSTCSFAGIKCDSTGSVSELDLTDSGLSGTIPFRSLCRLP  90

Query  327  SLEKLSLGFNSL  362
            SL +LSLG N L
Sbjct  91   SLSRLSLGSNLL  102



>ref|XP_008382378.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=973

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K +L+NS+  +F +W   +  C+F G+ C S+G V +I LS++ LSG +P  +ICSL S
Sbjct  40   LKQSLENSNPSLFTSWAPPNGVCNFTGIVCSSDGLVSQINLSQQNLSGFLPLHAICSLPS  99

Query  330  LEKLSLGFNSL  362
            L+KLSLG N L
Sbjct  100  LKKLSLGSNGL  110



>emb|CDY42201.1| BnaA01g25940D [Brassica napus]
Length=921

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 50/80 (63%), Gaps = 8/80 (10%)
 Frame = +3

Query  150  IKAALQNSD-TKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGL-------SGSVPF  305
            +K+  Q ++   +F TW  +  PC+F G+TC+S G+V EI L  R L       +  +PF
Sbjct  33   LKSTFQETEPNSVFATWTHQKPPCEFSGITCNSGGNVVEINLESRSLNNGDNNNTSDLPF  92

Query  306  DSICSLKSLEKLSLGFNSLS  365
            DSIC+LK LEKL LG N+LS
Sbjct  93   DSICNLKFLEKLVLGNNALS  112



>ref|XP_009111593.1| PREDICTED: receptor-like protein kinase HAIKU2 [Brassica rapa]
Length=970

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 8/80 (10%)
 Frame = +3

Query  150  IKAALQNSD-TKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGL-------SGSVPF  305
            +K+  Q ++   +F TW  R  PC+F G+TC+S G+V EI L  + L       +  +PF
Sbjct  33   LKSTFQETEPNSVFATWTHRKPPCEFSGITCNSGGNVVEINLESQSLNNGYNNNTSDLPF  92

Query  306  DSICSLKSLEKLSLGFNSLS  365
            DSIC LK LEKL LG N+LS
Sbjct  93   DSICDLKFLEKLVLGNNALS  112



>ref|XP_006852741.1| hypothetical protein AMTR_s00033p00104210 [Amborella trichopoda]
 gb|ERN14208.1| hypothetical protein AMTR_s00033p00104210 [Amborella trichopoda]
Length=967

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +3

Query  162  LQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKL  341
            L++S T + D+W    SPC++ G+ C+  G+V EI LS + L+G +P +SIC L SLEKL
Sbjct  38   LKSSATSLLDSWKNDTSPCNWTGIHCNLQGNVTEINLSSKRLAGELPLESICGLASLEKL  97

Query  342  SLGFNSL  362
             +G NSL
Sbjct  98   FMGKNSL  104



>ref|XP_008787835.1| PREDICTED: uncharacterized protein LOC103705762 [Phoenix dactylifera]
Length=2109

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K +L  +D + F++W   +SPC+F G+ C+S  SV +I L+ +G+SG  PF S+C L +
Sbjct  34   LKVSLGLNDIEGFESWTPDNSPCNFTGIVCNSANSVAKINLNSKGISGKPPFSSLCRLPA  93

Query  330  LEKLSLGFNSLS  365
            L +LSLG N LS
Sbjct  94   LSELSLGSNHLS  105


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +K +L  +D + F++W   +SPC+F G+ C+S  SV +I L+ +G+SG  PF S+C L +
Sbjct  922  LKTSLGLNDIEGFESWTPDNSPCNFTGIVCNSANSVAKINLNSKGISGKPPFSSLCRLPA  981

Query  330  LEKLSLGFNSLS  365
            L +LSLG N LS
Sbjct  982  LSELSLGSNHLS  993



>gb|ABK26727.1| unknown [Picea sitchensis]
Length=291

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW-NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLK  326
            IK+ L++S T  F  W ++  SPC + G+TC++ GSV EI L   GLSG +P  +ICSLK
Sbjct  63   IKSGLRDS-TNAFQGWESSAASPCKWNGITCNTAGSVTEINLENNGLSGPIPSSAICSLK  121

Query  327  SLEKLSLGFNSL  362
            +L  + LG NSL
Sbjct  122  ALTSIQLGNNSL  133



>ref|NP_188604.1| leucine rich repeat kinase HAIKU 2 [Arabidopsis thaliana]
 sp|Q9LJM4.1|IKU2_ARATH RecName: Full=Receptor-like protein kinase HAIKU2; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB02557.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AEE76277.1| leucine rich repeat kinase HAIKU 2 [Arabidopsis thaliana]
Length=991

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 42/68 (62%), Gaps = 8/68 (12%)
 Frame = +3

Query  183  IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSG--------SVPFDSICSLKSLEK  338
            +F TW  R+S C+F G+ C+S+G+V EI L  R L           +PFDSIC LK LEK
Sbjct  45   VFKTWTHRNSACEFAGIVCNSDGNVVEINLGSRSLINRDDDGRFTDLPFDSICDLKLLEK  104

Query  339  LSLGFNSL  362
            L LG NSL
Sbjct  105  LVLGNNSL  112



>ref|XP_006300009.1| hypothetical protein CARUB_v10016232mg [Capsella rubella]
 gb|EOA32907.1| hypothetical protein CARUB_v10016232mg [Capsella rubella]
Length=982

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 41/68 (60%), Gaps = 8/68 (12%)
 Frame = +3

Query  183  IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRR--------GLSGSVPFDSICSLKSLEK  338
            +F TW  R+S C+F G+ CDS G+V EI L  R        G    +PFDS+C +K LEK
Sbjct  45   VFATWTHRNSACEFAGIVCDSGGNVIEINLGSRSLINRGGDGYITDLPFDSLCDMKFLEK  104

Query  339  LSLGFNSL  362
            L LG NSL
Sbjct  105  LVLGNNSL  112



>emb|CDX95422.1| BnaC01g33140D [Brassica napus]
Length=970

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 8/80 (10%)
 Frame = +3

Query  150  IKAALQNSD-TKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGL-------SGSVPF  305
            +K+  Q ++   +F TW  R   C+F G+TC+S G+V EI L  + L       + ++PF
Sbjct  33   LKSTFQETEPNHVFATWTHRKPTCEFSGITCNSGGNVVEINLESQSLNNGDNNNTSNLPF  92

Query  306  DSICSLKSLEKLSLGFNSLS  365
            DSIC LK LEKL LG NSLS
Sbjct  93   DSICDLKFLEKLVLGNNSLS  112



>ref|XP_004170874.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HAIKU2-like [Cucumis sativus]
Length=985

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  222  FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSL  362
            F G+ C+SNG V EI L  + LSG +PFDSICSLKSLEKLS GFN L
Sbjct  69   FHGIVCNSNGFVVEINLPAQNLSGIIPFDSICSLKSLEKLSFGFNXL  115



>ref|XP_002883200.1| hypothetical protein ARALYDRAFT_479487 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59459.1| hypothetical protein ARALYDRAFT_479487 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 8/69 (12%)
 Frame = +3

Query  183  IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSG--------SVPFDSICSLKSLEK  338
            +F TW  R+S C+F G+ C+S+G+V EI L  + L           +PFD IC LK LEK
Sbjct  46   VFKTWTHRNSACEFSGIVCNSDGNVTEINLGSQSLINCDGDGKITDLPFDLICDLKFLEK  105

Query  339  LSLGFNSLS  365
            L LG NSLS
Sbjct  106  LVLGNNSLS  114



>ref|XP_010489950.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=987

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 9/69 (13%)
 Frame = +3

Query  183  IFDTWNARHSPCDFPGVTCDSNGSVKEIEL------SRRGLSGSV---PFDSICSLKSLE  335
            +F TW   +S C+F G+ C+S G+V EI L      +RRG  G +   PFDSIC +K LE
Sbjct  44   VFATWTHNNSACEFSGIVCNSGGNVIEINLGSRSLTNRRGGDGCITDLPFDSICGMKFLE  103

Query  336  KLSLGFNSL  362
            KL LG NSL
Sbjct  104  KLVLGNNSL  112



>ref|XP_008455077.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis melo]
Length=983

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  222  FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSL  362
            F G+ C+SNG V EI L  + LSG +PFDSICSL+SLEKLS G NSL
Sbjct  68   FHGIVCNSNGFVVEINLPAQNLSGIIPFDSICSLQSLEKLSFGLNSL  114



>gb|KGN43819.1| hypothetical protein Csa_7G069690 [Cucumis sativus]
Length=985

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  222  FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSL  362
            F G+ C+SNG V EI L  + LS  +PFDSICSLKSLEKLS GFN L
Sbjct  69   FHGIVCNSNGFVVEINLPAQNLSRIIPFDSICSLKSLEKLSFGFNFL  115



>ref|XP_004137077.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Cucumis 
sativus]
Length=1004

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  222  FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSL  362
            F G+ C+SNG V EI L  + LS  +PFDSICSLKSLEKLS GFN L
Sbjct  69   FHGIVCNSNGFVVEINLPAQNLSRIIPFDSICSLKSLEKLSFGFNFL  115



>ref|XP_006406469.1| hypothetical protein EUTSA_v10022054mg [Eutrema salsugineum]
 gb|ESQ47922.1| hypothetical protein EUTSA_v10022054mg [Eutrema salsugineum]
Length=994

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 42/68 (62%), Gaps = 8/68 (12%)
 Frame = +3

Query  183  IFDTW-NARHSPCDFPGVTCDSNGSVKEIELSRRGL-------SGSVPFDSICSLKSLEK  338
            +F TW N ++S C+F G+ C+S G+V EI L  R L       S  +PFDSIC LK LEK
Sbjct  45   VFSTWTNHQNSACEFAGIVCNSIGNVVEINLGSRSLINGDDDSSSDLPFDSICDLKFLEK  104

Query  339  LSLGFNSL  362
            L LG N L
Sbjct  105  LVLGNNFL  112



>ref|XP_010420074.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=988

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 10/80 (13%)
 Frame = +3

Query  153  KAALQNSDT-KIFDTWNARHSPCDFPGVTCDSNGSVKEIEL------SRRGLSGSV---P  302
            K+    +D+ ++F TW   +S C F G+ C+S G+V EI L      +RRG  G +   P
Sbjct  35   KSVFGETDSDEVFATWTHNNSACKFAGIFCNSGGNVIEINLGSRSLTNRRGGDGCITDLP  94

Query  303  FDSICSLKSLEKLSLGFNSL  362
            FD IC +K LEKL LG NSL
Sbjct  95   FDLICDMKFLEKLVLGNNSL  114



>ref|XP_006395826.1| hypothetical protein EUTSA_v10003548mg [Eutrema salsugineum]
 gb|ACQ90590.1| brassinosteroid receptor-like protein [Eutrema halophilum]
 gb|ESQ33112.1| hypothetical protein EUTSA_v10003548mg [Eutrema salsugineum]
Length=1143

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K+ +Q+   KI   W  R SPC F GVTC + G V EI LS  GLSG V FD+  SL SL
Sbjct  49   KSMIQDDPNKILSNWTPRKSPCQFSGVTCLA-GRVSEINLSGSGLSGIVSFDAFTSLDSL  107

Query  333  EKLSLGFN  356
              L L  N
Sbjct  108  SVLKLSEN  115



>ref|XP_009101284.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2 [Brassica 
rapa]
Length=1134

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            KA +Q+    I  TW  R SPC F GVTC + G V EI LS  GLSG+V F++  SL +L
Sbjct  43   KAMIQDDPNNILSTWTPRKSPCQFSGVTCLA-GRVSEINLSGSGLSGTVSFNAFTSLDAL  101

Query  333  EKLSLGFN  356
              L L  N
Sbjct  102  SVLKLSEN  109



>ref|XP_010468302.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=985

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 40/69 (58%), Gaps = 9/69 (13%)
 Frame = +3

Query  183  IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSG---------SVPFDSICSLKSLE  335
            +F  W   +S C+F G+ C+S+G+V EI L  R L            +PFDSIC +K LE
Sbjct  42   VFAIWTHNNSACEFAGIVCNSDGNVIEINLGSRNLINLRGGDGCITDLPFDSICDIKFLE  101

Query  336  KLSLGFNSL  362
            KL LG NSL
Sbjct  102  KLVLGNNSL  110



>emb|CDY17621.1| BnaA06g34400D [Brassica napus]
Length=1126

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            KA +Q+    I  TW  R SPC F GVTC + G V EI LS  GLSG+V F++  SL +L
Sbjct  43   KAMIQDDPNNILSTWTPRKSPCQFSGVTCLA-GRVSEINLSGSGLSGTVSFNAFTSLDAL  101

Query  333  EKLSLGFN  356
              L L  N
Sbjct  102  SVLKLSEN  109



>emb|CDY03088.1| BnaC07g21390D [Brassica napus]
Length=1136

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            KA +Q+    I  TW  R SPC F GVTC + G V EI LS  GLSG+V F++  SL +L
Sbjct  45   KAMIQDDPNNILSTWTPRKSPCQFSGVTCLA-GRVSEINLSGSGLSGTVSFNAFTSLDAL  103

Query  333  EKLSLGFN  356
              L L  N
Sbjct  104  SVLKLSEN  111



>ref|XP_010424991.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2 [Camelina 
sativa]
Length=1159

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 38/68 (56%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            KA +Q+    I   W  R SPC F GVTC   G V EI LS  GLSG+V F++  SL SL
Sbjct  62   KAMIQDDPNNILSNWTPRKSPCQFSGVTC-LGGRVSEINLSGSGLSGTVSFNAFTSLDSL  120

Query  333  EKLSLGFN  356
              L L  N
Sbjct  121  TVLKLSEN  128



>ref|XP_002979988.1| hypothetical protein SELMODRAFT_178079 [Selaginella moellendorffii]
 gb|EFJ18858.1| hypothetical protein SELMODRAFT_178079 [Selaginella moellendorffii]
Length=704

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICS-LK  326
            ++A L +SD     +W+   +PC +PG+ C  +G V+EIELS R LSG +P   I S   
Sbjct  51   LRAWLVSSDDYFAKSWSNASTPCAWPGIKCWPDGLVREIELSSRNLSGKLPIPDIFSHFP  110

Query  327  SLEKLSLGFNSLS  365
             LE LS+G N+LS
Sbjct  111  QLEALSIGDNALS  123



>gb|ADQ43184.1| leucine-rich receptor kinase [Schrenkiella parvula]
Length=1141

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K+ +Q+    I  +W  R SPC F G+TC + G V EI LS  GLSG V FD+  SL SL
Sbjct  49   KSMIQDDPNNILSSWTPRKSPCQFSGITCLA-GRVSEINLSGSGLSGIVSFDTFTSLDSL  107

Query  333  EKLSLGFN  356
              L L  N
Sbjct  108  SVLKLSEN  115



>ref|XP_010506907.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2 [Camelina 
sativa]
Length=843

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K  +Q+    I   W  R SPC F GVTC   G V EI LS  GLSG+V F++  SL SL
Sbjct  44   KTMIQDDPNNILSNWTPRKSPCQFSGVTC-LGGRVSEINLSGSGLSGTVSFNAFTSLDSL  102

Query  333  EKLSLGFN  356
              L L  N
Sbjct  103  TVLKLSEN  110



>ref|XP_002991932.1| hypothetical protein SELMODRAFT_438, partial [Selaginella moellendorffii]
 gb|EFJ07043.1| hypothetical protein SELMODRAFT_438, partial [Selaginella moellendorffii]
Length=620

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICS-LK  326
            ++A L +SD     +W+   +PC +PG+ C  +G V+EI+LS R LSG +P   I S   
Sbjct  29   LRAWLVSSDDYFAKSWSNASTPCAWPGIKCWPDGLVREIDLSSRNLSGKLPIPDIFSHFP  88

Query  327  SLEKLSLGFNSLS  365
             LE LS+G N+LS
Sbjct  89   QLEVLSIGDNALS  101



>gb|KJB59874.1| hypothetical protein B456_009G278300, partial [Gossypium raimondii]
Length=605

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  222  FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSL  362
            F G+TC++  SVKEIELS + L+G++P + IC L+SL+KLSL +N L
Sbjct  1    FEGITCNAEESVKEIELSNQNLTGALPLNLICQLQSLDKLSLRYNLL  47



>ref|XP_010513950.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2 isoform 
X3 [Camelina sativa]
Length=1119

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K  +Q+    I   W  R SPC F GVTC   G V EI LS  GLSG+V F++  SL SL
Sbjct  44   KTMIQDDPNSILSNWTPRKSPCQFSGVTC-LGGRVSEINLSGSGLSGTVSFNAFTSLDSL  102

Query  333  EKLSLGFN  356
              L L  N
Sbjct  103  SVLKLSEN  110



>ref|XP_010513948.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2 isoform 
X1 [Camelina sativa]
 ref|XP_010513949.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2 isoform 
X2 [Camelina sativa]
Length=1141

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K  +Q+    I   W  R SPC F GVTC   G V EI LS  GLSG+V F++  SL SL
Sbjct  44   KTMIQDDPNSILSNWTPRKSPCQFSGVTC-LGGRVSEINLSGSGLSGTVSFNAFTSLDSL  102

Query  333  EKLSLGFN  356
              L L  N
Sbjct  103  SVLKLSEN  110



>ref|XP_006857826.1| hypothetical protein AMTR_s00069p00033900 [Amborella trichopoda]
 gb|ERN19293.1| hypothetical protein AMTR_s00069p00033900 [Amborella trichopoda]
Length=696

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPC--DFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +K+AL + D ++  +W     PC  +F GV C+ NG V  I L  +GLSGSVP  +I  L
Sbjct  37   MKSAL-DPDNRLLGSWTKGGDPCSGEFQGVACNENGKVANISLQGKGLSGSVP-AAISGL  94

Query  324  KSLEKLSLGFNSLS  365
            KSL  L L +NSL+
Sbjct  95   KSLTGLYLHYNSLT  108



>ref|WP_010653235.1| RHS repeat-associated core domain-containing protein [Fluoribacter 
dumoffii]
Length=285

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +3

Query  189  DTWNARHSP-CDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            D W +   P CD+ GV CD+NG V E++L   GL GS+P D++C+L  L+ L L FN + 
Sbjct  34   DNWLSDSIPYCDWHGVICDNNGHVTELQLYDNGLEGSLP-DTLCNLTELKTLYLSFNHIG  92



>ref|XP_006290522.1| hypothetical protein CARUB_v10016602mg [Capsella rubella]
 gb|EOA23420.1| hypothetical protein CARUB_v10016602mg [Capsella rubella]
Length=1145

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 38/68 (56%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K  +Q+    I   W+ R SPC + GVTC   G V EI LS  GLSG+V F++  SL SL
Sbjct  48   KTMIQDDPNNILSNWSPRKSPCQYSGVTC-LGGRVSEINLSGSGLSGTVSFNAFTSLDSL  106

Query  333  EKLSLGFN  356
              L L  N
Sbjct  107  SVLKLSEN  114



>ref|XP_002876787.1| hypothetical protein ARALYDRAFT_484119 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53046.1| hypothetical protein ARALYDRAFT_484119 [Arabidopsis lyrata subsp. 
lyrata]
Length=1075

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K+ +Q+    I   W  R SPC F GVTC   G V EI LS  GLSG V F++  SL SL
Sbjct  47   KSMIQDDPNNILSNWTPRKSPCQFSGVTC-LGGRVAEINLSGSGLSGIVSFNAFTSLDSL  105

Query  333  EKLSLGFN  356
              L L  N
Sbjct  106  SVLKLSEN  113



>ref|NP_178304.1| serine/threonine-protein kinase BRI1-like 2 [Arabidopsis thaliana]
 sp|Q9ZPS9.1|BRL2_ARATH RecName: Full=Serine/threonine-protein kinase BRI1-like 2; AltName: 
Full=BRASSINOSTEROID INSENSITIVE 1-like protein 2; AltName: 
Full=Protein VASCULAR HIGHWAY 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD20088.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAL67010.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59282.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC05526.1| serine/threonine-protein kinase BRI1-like 2 [Arabidopsis thaliana]
Length=1143

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K  +Q+    I   W+ R SPC F GVTC   G V EI LS  GLSG V F++  SL SL
Sbjct  47   KTMIQDDPNNILSNWSPRKSPCQFSGVTC-LGGRVTEINLSGSGLSGIVSFNAFTSLDSL  105

Query  333  EKLSLGFN  356
              L L  N
Sbjct  106  SVLKLSEN  113



>ref|XP_009354606.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Pyrus x bretschneideri]
Length=989

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 5/72 (7%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICS  320
            +KA L + D K+ D W   + HSPC++ G+TCD  N SV  + LS  G+SG+ PF   CS
Sbjct  37   VKAQLSDPDGKL-DDWVPGSNHSPCNWTGITCDRDNHSVLAVNLSEFGVSGAFPF-GFCS  94

Query  321  LKSLEKLSLGFN  356
            +++L+ LSL  N
Sbjct  95   IRTLQNLSLSAN  106



>ref|XP_009354587.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Pyrus x bretschneideri]
 ref|XP_009354604.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Pyrus x bretschneideri]
Length=989

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 5/72 (7%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICS  320
            +KA L + D K+ D W   + HSPC++ G+TCD  N SV  + LS  G+SG+ PF   CS
Sbjct  37   VKAQLSDPDGKL-DDWVPGSNHSPCNWTGITCDRDNHSVLAVNLSEFGVSGAFPF-GFCS  94

Query  321  LKSLEKLSLGFN  356
            +++L+ LSL  N
Sbjct  95   IRTLQNLSLSAN  106



>ref|XP_011093340.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HSL1 [Sesamum indicum]
Length=1025

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  183  IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFN  356
            + D+WNA  SPC +P + C ++G V  I L    L+GS+P DSI +L++L  L L FN
Sbjct  51   VLDSWNATSSPCHWPEIQCSADGFVTGILLKNYNLNGSIP-DSISTLENLTVLDLAFN  107



>ref|XP_006408369.1| hypothetical protein EUTSA_v10020304mg [Eutrema salsugineum]
 gb|ESQ49822.1| hypothetical protein EUTSA_v10020304mg [Eutrema salsugineum]
Length=542

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  195  WNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            WN   SPC + GV CD+ G V E+ L   GL GS+P   I +L  L+ LSL FNSLS
Sbjct  48   WNMSASPCTWHGVHCDA-GRVTELRLPGSGLFGSLPVGGIGNLTELQTLSLRFNSLS  103



>gb|KFK33407.1| hypothetical protein AALP_AA5G008900 [Arabis alpina]
Length=1092

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = +3

Query  162  LQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKL  341
            +Q+    I   W+ R SPC F GVTC + G V EI LS  GLSG V F++  +L SL  L
Sbjct  2    IQDDPNNILSNWSPRKSPCQFSGVTCLA-GRVTEINLSGSGLSGVVSFNAFTNLDSLSIL  60

Query  342  SLGFN  356
             L  N
Sbjct  61   KLSEN  65



>ref|XP_006408370.1| hypothetical protein EUTSA_v10020304mg [Eutrema salsugineum]
 gb|ESQ49823.1| hypothetical protein EUTSA_v10020304mg [Eutrema salsugineum]
Length=622

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  195  WNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            WN   SPC + GV CD+ G V E+ L   GL GS+P   I +L  L+ LSL FNSLS
Sbjct  48   WNMSASPCTWHGVHCDA-GRVTELRLPGSGLFGSLPVGGIGNLTELQTLSLRFNSLS  103



>ref|XP_010527832.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2 [Tarenaya 
hassleriana]
Length=1152

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            K  +Q+        W  R SPC++ GVTC   G V EI+LS  GLSG+V FD   SL SL
Sbjct  57   KNMIQDDPNNNLGNWILRKSPCEWSGVTC-LRGRVSEIDLSGSGLSGTVSFDPFASLYSL  115

Query  333  EKLSLGFN  356
              L L  N
Sbjct  116  SVLKLSDN  123



>ref|XP_010023352.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 isoform X1 [Eucalyptus grandis]
 gb|KCW59608.1| hypothetical protein EUGRSUZ_H02351 [Eucalyptus grandis]
Length=1001

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 6/76 (8%)
 Frame = +3

Query  150  IKAA-LQNSDTKIFDTW--NARHSPCDFPGVTCDS-NGSVKEIELSRRGLSGSVPFDSIC  317
            +KAA L++ D ++ D W   A  SPC++ GVTC++ N SV  I+LS   ++G  P+D  C
Sbjct  50   VKAAQLEDPDGQL-DDWAPTADRSPCNWTGVTCETRNRSVVAIDLSELNVAGRFPYD-FC  107

Query  318  SLKSLEKLSLGFNSLS  365
             +++L KLSLG NS +
Sbjct  108  RIRTLRKLSLGDNSFN  123



>ref|WP_027271448.1| hypothetical protein [Legionella sainthelensi]
Length=288

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = +3

Query  189  DTWNARHSP-CDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSL  362
            D W +   P C++ GV CD NG V E++L   GL GS+P +++C+L  L+ L L FN +
Sbjct  37   DNWLSDSIPYCEWHGVICDKNGHVTELQLYDNGLEGSLP-ETLCNLTELKTLYLSFNHI  94



>gb|KCW59607.1| hypothetical protein EUGRSUZ_H02351 [Eucalyptus grandis]
Length=997

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 6/76 (8%)
 Frame = +3

Query  150  IKAA-LQNSDTKIFDTW--NARHSPCDFPGVTCDS-NGSVKEIELSRRGLSGSVPFDSIC  317
            +KAA L++ D ++ D W   A  SPC++ GVTC++ N SV  I+LS   ++G  P+D  C
Sbjct  50   VKAAQLEDPDGQL-DDWAPTADRSPCNWTGVTCETRNRSVVAIDLSELNVAGRFPYD-FC  107

Query  318  SLKSLEKLSLGFNSLS  365
             +++L KLSLG NS +
Sbjct  108  RIRTLRKLSLGDNSFN  123



>gb|KJB52934.1| hypothetical protein B456_008G284000 [Gossypium raimondii]
Length=676

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IKAAL + D +   +W  +  PC F G+ C+  G V  I L  +GLSG +    I  LK 
Sbjct  39   IKAAL-DPDNQYLTSWTTKGDPCSFEGLACNEQGQVANISLQGKGLSGKIS-PVIAELKH  96

Query  330  LEKLSLGFNSL  362
            L  L L +NSL
Sbjct  97   LTGLYLHYNSL  107



>ref|XP_003605636.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES87833.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=646

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +3

Query  168  NSDTKIFDTWNARHSPCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLS  344
            N       +WN   SPC+F G+TCD  N  V+EI L    LSG + F SI +L SLE LS
Sbjct  46   NDSLNTLASWNESKSPCNFLGITCDPRNLKVREISLDGDSLSGEI-FPSITTLDSLEVLS  104

Query  345  LGFNSLS  365
            L  NS+S
Sbjct  105  LPSNSIS  111



>ref|XP_007207228.1| hypothetical protein PRUPE_ppa000973mg [Prunus persica]
 gb|EMJ08427.1| hypothetical protein PRUPE_ppa000973mg [Prunus persica]
Length=944

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 48/75 (64%), Gaps = 5/75 (7%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNG-SVKEIELSRRGLSGSVPFDSICS  320
            +KA L + D K+ D W  N+ H+PC++ G+TC+ N  +V  + +S  G++G  P+   C 
Sbjct  14   VKAKLSDPDGKL-DDWVPNSDHNPCNWTGITCEPNTHTVLAVNISGLGIAGGFPY-GFCH  71

Query  321  LKSLEKLSLGFNSLS  365
            +++L  LS+ FNS++
Sbjct  72   IRTLRNLSVSFNSIN  86



>gb|KJB52935.1| hypothetical protein B456_008G284000 [Gossypium raimondii]
Length=527

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IKAAL + D +   +W  +  PC F G+ C+  G V  I L  +GLSG +    I  LK 
Sbjct  39   IKAAL-DPDNQYLTSWTTKGDPCSFEGLACNEQGQVANISLQGKGLSGKIS-PVIAELKH  96

Query  330  LEKLSLGFNSL  362
            L  L L +NSL
Sbjct  97   LTGLYLHYNSL  107



>dbj|BAP55221.1| hypothetical protein THII_0924 [Thioploca ingrica]
Length=644

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 2/57 (4%)
 Frame = +3

Query  195  WNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            WN  ++PC + GVTCD NG V ++ L    L+GS+P DS+  L  L++LSL  N LS
Sbjct  66   WNENNTPCQWWGVTCD-NGYVTKLYLENNNLNGSIP-DSLGYLNQLQELSLSKNQLS  120



>gb|EYU29298.1| hypothetical protein MIMGU_mgv1a000685mg [Erythranthe guttata]
Length=1018

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +3

Query  174  DTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGF  353
            D    D+WNA  SPCD+P + C   GSV  I L    LSGS+  DSI +L +L  L L +
Sbjct  48   DPPALDSWNATSSPCDWPEIQCSGEGSVTGIFLKNCNLSGSIT-DSISALANLTVLDLSY  106

Query  354  N  356
            N
Sbjct  107  N  107



>ref|XP_002987081.1| hypothetical protein SELMODRAFT_125338 [Selaginella moellendorffii]
 gb|EFJ11924.1| hypothetical protein SELMODRAFT_125338 [Selaginella moellendorffii]
Length=738

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 36/66 (55%), Gaps = 5/66 (8%)
 Frame = +3

Query  180  KIFDTWNARHSPCD----FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSL  347
            ++  +W A   PC     F GV CDS G V  + L  RGL GS+P  +I  L SL  L L
Sbjct  45   EVLASWVAGKDPCGAEDGFVGVACDSRGRVTNVSLQGRGLEGSIP-GAIGELSSLTALYL  103

Query  348  GFNSLS  365
             +NSLS
Sbjct  104  HYNSLS  109



>ref|XP_002318874.2| hypothetical protein POPTR_0012s14430g [Populus trichocarpa]
 gb|EEE97094.2| hypothetical protein POPTR_0012s14430g [Populus trichocarpa]
Length=677

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 3/65 (5%)
 Frame = +3

Query  174  DTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSL  347
            + +   +WN   SPCD  F GV C+ NG V  I L  +GL+G V   +I  LK L  L L
Sbjct  39   EARYLSSWNINGSPCDGSFEGVACNENGQVANISLQGKGLNGKVS-PAITGLKYLTGLYL  97

Query  348  GFNSL  362
             +NSL
Sbjct  98   HYNSL  102



>ref|XP_009420699.1| PREDICTED: receptor-like protein kinase HAIKU2 [Musa acuminata 
subsp. malaccensis]
Length=995

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPF  305
            +A+L  + +  F++W+A    C F GV CDS GSV EI+L+  G+SG + F
Sbjct  31   RASLTAAKSSTFESWDAGSPACGFVGVRCDSTGSVSEIDLTDAGISGEISF  81



>ref|XP_002985490.1| hypothetical protein SELMODRAFT_122408 [Selaginella moellendorffii]
 gb|EFJ13364.1| hypothetical protein SELMODRAFT_122408 [Selaginella moellendorffii]
Length=724

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 36/66 (55%), Gaps = 5/66 (8%)
 Frame = +3

Query  180  KIFDTWNARHSPCD----FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSL  347
            ++  +W A   PC     F GV CDS G V  + L  RGL GS+P  +I  L SL  L L
Sbjct  45   EVLASWVAGKDPCGAEDGFVGVACDSRGRVTNVSLQGRGLEGSIP-AAIGELSSLTALYL  103

Query  348  GFNSLS  365
             +NSLS
Sbjct  104  HYNSLS  109



>ref|XP_010023353.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 isoform X2 [Eucalyptus grandis]
Length=1000

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 6/76 (8%)
 Frame = +3

Query  150  IKAA-LQNSDTKIFDTW--NARHSPCDFPGVTCDS-NGSVKEIELSRRGLSGSVPFDSIC  317
            +KAA L++ D ++ D W  NA  SPC++ GVTC++ N SV  I+LS   ++G  P+D  C
Sbjct  50   VKAAQLEDPDGQLAD-WAPNADRSPCNWTGVTCETRNRSVVAIDLSGLNVAGRFPYD-FC  107

Query  318  SLKSLEKLSLGFNSLS  365
             +++L KL LG NS +
Sbjct  108  RIRTLRKLLLGDNSFN  123



>ref|XP_010023354.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 isoform X3 [Eucalyptus grandis]
 gb|KCW59610.1| hypothetical protein EUGRSUZ_H02353 [Eucalyptus grandis]
Length=999

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 6/76 (8%)
 Frame = +3

Query  150  IKAA-LQNSDTKIFDTW--NARHSPCDFPGVTCDS-NGSVKEIELSRRGLSGSVPFDSIC  317
            +KAA L++ D ++ D W  NA  SPC++ GVTC++ N SV  I+LS   ++G  P+D  C
Sbjct  50   VKAAQLEDPDGQLAD-WAPNADRSPCNWTGVTCETRNRSVVAIDLSGLNVAGRFPYD-FC  107

Query  318  SLKSLEKLSLGFNSLS  365
             +++L KL LG NS +
Sbjct  108  RIRTLRKLLLGDNSFN  123



>gb|KCW59611.1| hypothetical protein EUGRSUZ_H02353 [Eucalyptus grandis]
Length=906

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 6/76 (8%)
 Frame = +3

Query  150  IKAA-LQNSDTKIFDTW--NARHSPCDFPGVTCDS-NGSVKEIELSRRGLSGSVPFDSIC  317
            +KAA L++ D ++ D W  NA  SPC++ GVTC++ N SV  I+LS   ++G  P+D  C
Sbjct  50   VKAAQLEDPDGQLAD-WAPNADRSPCNWTGVTCETRNRSVVAIDLSGLNVAGRFPYD-FC  107

Query  318  SLKSLEKLSLGFNSLS  365
             +++L KL LG NS +
Sbjct  108  RIRTLRKLLLGDNSFN  123



>ref|XP_010680110.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2 [Beta 
vulgaris subsp. vulgaris]
Length=1118

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWN-ARHSP-CDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLK  326
            K  + N  TK+ ++W  ++++P C + GV C S+G V +++LS R L+G++ FD+  SL 
Sbjct  46   KKMIDNDPTKVLESWEMSKNNPLCTWQGVNCSSDGRVAQLDLSWRFLTGNITFDAFSSLD  105

Query  327  SLEKLSLGFNSL  362
             L  L L  NS 
Sbjct  106  MLVSLDLSGNSF  117



>ref|XP_004964453.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Setaria italica]
Length=676

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = +3

Query  180  KIFDTWNARHSPC--DFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGF  353
            ++  +WN    PC   F GVTCD+ G V  + L  RGLSGS+P  ++  L+ L+ L L +
Sbjct  43   RVLGSWNPSGDPCGGSFVGVTCDTAGRVTAVSLQGRGLSGSLP-PAVAGLRRLQGLYLHY  101

Query  354  NSL  362
            N +
Sbjct  102  NGI  104



>ref|XP_011081744.1| PREDICTED: receptor-like protein kinase 5 [Sesamum indicum]
Length=730

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +3

Query  186  FDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
             D+WN+  SPCD+P + C S G+V  + LS + LSG++P  +IC LK+L  ++L  N++S
Sbjct  45   LDSWNSTSSPCDWPEIECIS-GTVTALHLSGKDLSGTIP-STICQLKNLVSINLFDNNIS  102



>ref|XP_006445272.1| hypothetical protein CICLE_v10019056mg [Citrus clementina]
 ref|XP_006490913.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Citrus sinensis]
 gb|ESR58512.1| hypothetical protein CICLE_v10019056mg [Citrus clementina]
 gb|KDO85808.1| hypothetical protein CISIN_1g005859mg [Citrus sinensis]
Length=673

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 4/67 (6%)
 Frame = +3

Query  174  DTKIFDTWNARHSPCD---FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLS  344
            + ++  +W     PC    F GV CD NG V  I L  +GLSG +P  ++  LKSL  L 
Sbjct  37   ENRLLTSWAPNADPCSSDSFDGVACDENGRVANISLQGKGLSGEIP-AAVGGLKSLTGLY  95

Query  345  LGFNSLS  365
            L FN+L+
Sbjct  96   LHFNALN  102



>ref|XP_006445273.1| hypothetical protein CICLE_v10019056mg [Citrus clementina]
 gb|ESR58513.1| hypothetical protein CICLE_v10019056mg [Citrus clementina]
Length=714

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 4/67 (6%)
 Frame = +3

Query  174  DTKIFDTWNARHSPCD---FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLS  344
            + ++  +W     PC    F GV CD NG V  I L  +GLSG +P  ++  LKSL  L 
Sbjct  37   ENRLLTSWAPNADPCSSDSFDGVACDENGRVANISLQGKGLSGEIP-AAVGGLKSLTGLY  95

Query  345  LGFNSLS  365
            L FN+L+
Sbjct  96   LHFNALN  102



>gb|KHG09358.1| Leucine-rich repeat receptor protein kinase EXS [Gossypium arboreum]
Length=672

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IKA+L + D +   +W  +  PC F G+ C+  G V  I L  +GLSG +   +I  L++
Sbjct  35   IKASL-DPDNQYLTSWTTKSDPCSFEGLACNEQGQVANISLQGKGLSGKIS-PAIAELQN  92

Query  330  LEKLSLGFNSL  362
            L  L L +NSL
Sbjct  93   LTGLFLHYNSL  103



>gb|KJB28083.1| hypothetical protein B456_005G026500 [Gossypium raimondii]
Length=747

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +3

Query  186  FDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            FD W+     C + GVTCD+ G V  I+LS R LSGS  F SI +L  L++L+L  N+ +
Sbjct  30   FDLWDVNTDCCSWEGVTCDAYGHVVGIDLSYRNLSGS--FHSIFNLHRLQRLNLAGNNFN  87



>ref|XP_008236947.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Prunus mume]
Length=991

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 47/75 (63%), Gaps = 5/75 (7%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNG-SVKEIELSRRGLSGSVPFDSICS  320
            +KA L + D K+ D W  N+ H+PC++ G+TC+ N  +V  + +S  G++G  PF   C 
Sbjct  36   VKAKLSDPDGKL-DDWVPNSDHNPCNWTGITCEPNTYTVLAVNISGLGIAGGFPF-GFCH  93

Query  321  LKSLEKLSLGFNSLS  365
            +++L  LSL  NS++
Sbjct  94   IRTLRNLSLSGNSIN  108



>ref|XP_003530064.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Glycine 
max]
Length=684

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +3

Query  195  WNARH-SPCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            WNA   SPC +PGV CD +N SV E+ L    LSG +P     +LK+L  LSL  NSLS
Sbjct  49   WNATAPSPCAWPGVQCDVANASVVELHLPAVALSGELPAGVFPALKNLHTLSLRVNSLS  107



>ref|XP_006645116.1| PREDICTED: receptor-like protein kinase HSL1-like [Oryza brachyantha]
Length=964

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSN-GSVKEIELSRRGLSGSVPFDSICSLK  326
            IK+ L++    +   W+  HSPC F GVTCD N G V  I LS   LSG++   S   L+
Sbjct  35   IKSHLEDPQNYL-KNWDDSHSPCQFYGVTCDQNSGGVIGISLSNASLSGTIS-SSFSLLR  92

Query  327  SLEKLSLGFNSLS  365
             L  L LG NS+S
Sbjct  93   QLRTLELGANSIS  105



>gb|KJB24815.1| hypothetical protein B456_004G162200 [Gossypium raimondii]
Length=674

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 41/75 (55%), Gaps = 5/75 (7%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD---FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICS  320
            IKA+L + D +   +W     PC    F GV C+  G V  I L  +GLSG +P  ++  
Sbjct  28   IKASL-DPDNRFLSSWTPYSDPCSTGSFDGVACNGQGRVVNISLQGKGLSGQIP-PALGG  85

Query  321  LKSLEKLSLGFNSLS  365
            LKSL  L L FN+LS
Sbjct  86   LKSLTGLYLHFNALS  100



>gb|KJB24814.1| hypothetical protein B456_004G162200 [Gossypium raimondii]
Length=631

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 41/75 (55%), Gaps = 5/75 (7%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD---FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICS  320
            IKA+L + D +   +W     PC    F GV C+  G V  I L  +GLSG +P  ++  
Sbjct  28   IKASL-DPDNRFLSSWTPYSDPCSTGSFDGVACNGQGRVVNISLQGKGLSGQIP-PALGG  85

Query  321  LKSLEKLSLGFNSLS  365
            LKSL  L L FN+LS
Sbjct  86   LKSLTGLYLHFNALS  100



>ref|XP_007038448.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY22949.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=636

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 39/73 (53%), Gaps = 4/73 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KAAL + D K   +W     PCD  F GV C+  G +  I L  +GLSG V   +I  L
Sbjct  32   MKAAL-DPDDKYLSSWTINGDPCDRSFEGVGCNQKGQIANISLQGKGLSGKVS-SAITGL  89

Query  324  KSLEKLSLGFNSL  362
            K L  L L +NSL
Sbjct  90   KHLTGLYLHYNSL  102



>ref|XP_010322765.1| PREDICTED: receptor-like protein kinase HAIKU2 [Solanum lycopersicum]
Length=977

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 37/67 (55%), Gaps = 2/67 (3%)
 Frame = +3

Query  168  NSDTKIFDTWNARHSPCDFPGVTCDSN-GSVKEIELSRRGLSGSVPFDSICSLKSLEKLS  344
            N      D+W    SPC F G+TCD N G V EI L  + LSG +   SI SLKSL  L 
Sbjct  45   NDPLNYLDSWKDSESPCKFYGITCDKNTGLVIEISLDNKSLSGVIS-PSIFSLKSLTSLV  103

Query  345  LGFNSLS  365
            L  N+LS
Sbjct  104  LPSNALS  110



>ref|XP_009382934.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=677

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 4/74 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPC--DFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KAAL   D +I  +W +   PC  +F GV C+ +G V  I L  +GL+GS+   ++  L
Sbjct  34   VKAALDPED-RILSSWTSEGDPCRGNFEGVACNEHGKVANISLQGKGLTGSIS-PAVAGL  91

Query  324  KSLEKLSLGFNSLS  365
            K L  L L +N++S
Sbjct  92   KCLSGLYLHYNAIS  105



>ref|XP_007038447.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY22948.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=678

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 39/73 (53%), Gaps = 4/73 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KAAL + D K   +W     PCD  F GV C+  G +  I L  +GLSG V   +I  L
Sbjct  32   MKAAL-DPDDKYLSSWTINGDPCDRSFEGVGCNQKGQIANISLQGKGLSGKVS-SAITGL  89

Query  324  KSLEKLSLGFNSL  362
            K L  L L +NSL
Sbjct  90   KHLTGLYLHYNSL  102



>ref|XP_008794535.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Phoenix dactylifera]
Length=672

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPC--DFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KAAL +   +I  TW +   PC   F GV C+ NG V  I L  +GL+GS+   ++  L
Sbjct  35   VKAAL-DPGGRILSTWTSDGDPCGGSFEGVACNENGKVANISLQGKGLAGSIS-PAVAEL  92

Query  324  KSLEKLSLGFNSLS  365
            + L  L L +N+LS
Sbjct  93   RYLSGLYLHYNALS  106



>ref|XP_009780300.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana sylvestris]
Length=1001

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 37/67 (55%), Gaps = 2/67 (3%)
 Frame = +3

Query  168  NSDTKIFDTWNARHSPCDFPGVTCDSN-GSVKEIELSRRGLSGSVPFDSICSLKSLEKLS  344
            N      D+W    +PC F G+TCD N G V EI L  + +SG +   SI SLKSL  L 
Sbjct  69   NDPLSYLDSWKDSETPCKFNGITCDQNTGLVTEISLDNKSISGVIS-PSIFSLKSLTSLV  127

Query  345  LGFNSLS  365
            L  NSLS
Sbjct  128  LPSNSLS  134



>ref|XP_004506369.1| PREDICTED: receptor-like protein kinase HAIKU2-like isoform X1 
[Cicer arietinum]
 ref|XP_004506370.1| PREDICTED: receptor-like protein kinase HAIKU2-like isoform X2 
[Cicer arietinum]
Length=989

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = +3

Query  186  FDTWN-ARHSPCD-FPGVTCDS-NGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFN  356
              +WN + +SPC+ F G+TCDS +G V EI L  + LSG + F SI  L SL+ LSL  N
Sbjct  56   LSSWNESNYSPCNGFHGITCDSFSGKVTEITLDNKSLSGEI-FRSISVLHSLQVLSLPSN  114

Query  357  SLS  365
            S+S
Sbjct  115  SIS  117



>ref|XP_002511706.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
 gb|EEF50375.1| leucine rich repeat receptor kinase, putative [Ricinus communis]
Length=627

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 4/74 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            IKA+L + + +   +W    +PC   F GV C+  G+V  I L  +GLSG +P  ++  L
Sbjct  31   IKASL-DPNNRFLTSWEPNTNPCSGSFEGVACNGQGNVANISLQGKGLSGQIP-AALGGL  88

Query  324  KSLEKLSLGFNSLS  365
            KSL  L L FN+L+
Sbjct  89   KSLTGLYLHFNALN  102



>ref|XP_006374656.1| hypothetical protein POPTR_0015s14480g [Populus trichocarpa]
 gb|ERP52453.1| hypothetical protein POPTR_0015s14480g [Populus trichocarpa]
Length=546

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 39/73 (53%), Gaps = 4/73 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KAAL + + +   +W    SPCD  F GV C+  G V  I L  +GL G V   +I  L
Sbjct  32   MKAAL-DPENRYLTSWTINGSPCDGSFEGVACNEKGQVANISLQGKGLYGKVS-PAIAGL  89

Query  324  KSLEKLSLGFNSL  362
            K L  L L FNSL
Sbjct  90   KHLTGLYLHFNSL  102



>ref|XP_004133916.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Cucumis sativus]
 ref|XP_004155789.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Cucumis sativus]
 gb|KGN56604.1| hypothetical protein Csa_3G126190 [Cucumis sativus]
Length=691

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            IKA+L    T +  +WN   +PC   F GV C+  G V  I L   GLSG++P  ++  L
Sbjct  35   IKASLDPHST-LLTSWNPSSNPCGGYFEGVACNEQGKVVNISLQGMGLSGNIP-SAVAGL  92

Query  324  KSLEKLSLGFNSL  362
            +SL  L L FN+L
Sbjct  93   RSLTGLYLHFNAL  105



>ref|XP_002456732.1| hypothetical protein SORBIDRAFT_03g041570 [Sorghum bicolor]
 gb|EES01852.1| hypothetical protein SORBIDRAFT_03g041570 [Sorghum bicolor]
Length=962

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSN-GSVKEIELSRRGLSGSVPFDSICSLK  326
            IK  L++    + + W+  HSPC F GVTCD N G V  I LS   LSG++   S   L+
Sbjct  35   IKGYLKDPQNYLHN-WDESHSPCQFYGVTCDRNSGDVIGISLSNISLSGTIS-SSFSLLE  92

Query  327  SLEKLSLGFNSLS  365
             L  L LG NS+S
Sbjct  93   QLRNLELGANSIS  105



>ref|XP_002443241.1| hypothetical protein SORBIDRAFT_08g016220 [Sorghum bicolor]
 gb|EES17079.1| hypothetical protein SORBIDRAFT_08g016220 [Sorghum bicolor]
Length=723

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = +3

Query  171  SDTKIFDTW-NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSL  347
            S T + +TW N+  S C + GVTCD NG+V E+ L  RGL G++   S+ +L  L +L L
Sbjct  88   SHTLLSETWRNSTASCCAWEGVTCDGNGTVTELLLPSRGLEGNIS-ASLGNLTGLRRLDL  146

Query  348  GFNSLS  365
              NSLS
Sbjct  147  SRNSLS  152



>ref|XP_010098918.1| LRR receptor-like serine/threonine-protein kinase RCH1 [Morus 
notabilis]
 gb|EXB76220.1| LRR receptor-like serine/threonine-protein kinase RCH1 [Morus 
notabilis]
Length=691

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPC--DFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KA+L +   +   +W    +PC  DF GV CD  G V  I L  +GL G +P  ++  L
Sbjct  36   LKASL-DPQNQFLTSWTRSANPCGGDFEGVACDERGRVVNISLQGKGLWGRIP-AAVGGL  93

Query  324  KSLEKLSLGFNSLS  365
            KSL  L L FNSL+
Sbjct  94   KSLTGLYLHFNSLN  107



>ref|XP_002453322.1| hypothetical protein SORBIDRAFT_04g003840 [Sorghum bicolor]
 gb|EES06298.1| hypothetical protein SORBIDRAFT_04g003840 [Sorghum bicolor]
Length=1060

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +3

Query  174  DTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGF  353
            D+ +  +W      C + GVTC+ N +V E+ L  RGL GS+   S+ +L SL+ L+L +
Sbjct  55   DSGLAKSWQEGTDCCKWEGVTCNGNKTVVEVSLPSRGLEGSI--TSLGNLTSLQHLNLSY  112

Query  354  NSLS  365
            NSLS
Sbjct  113  NSLS  116



>gb|AGT16770.1| hypothetical protein SHCRBa_022_K23_R_30 [Saccharum hybrid cultivar 
R570]
Length=962

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSN-GSVKEIELSRRGLSGSVPFDSICSLK  326
            IK  L++    + + W+  HSPC F GVTCD N G V  I LS   LSG++   S   L+
Sbjct  35   IKGYLKDPQNYLHN-WDESHSPCQFYGVTCDHNSGDVIGISLSNISLSGTIS-SSFSLLE  92

Query  327  SLEKLSLGFNSLS  365
             L  L LG NS+S
Sbjct  93   QLRTLELGANSIS  105



>ref|XP_010255622.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Nelumbo 
nucifera]
Length=681

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KAAL + + +   +W +   PC   F GV C+  G V  I L  +GL+G +P  ++  L
Sbjct  34   MKAAL-DPENRFLSSWTSDGEPCSGSFEGVACNELGKVANISLVGKGLTGRLP-PAVAGL  91

Query  324  KSLEKLSLGFNSLS  365
            KSL  L L FNSLS
Sbjct  92   KSLSGLYLHFNSLS  105



>ref|XP_010932563.1| PREDICTED: probable inactive receptor kinase At1g48480 [Elaeis 
guineensis]
Length=671

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  195  WNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            WNA  +PC + GV CD  G V ++ L   GL G +P  ++ +L +L+ +SL FN+LS
Sbjct  54   WNASATPCSWVGVKCDG-GRVTQLHLPGSGLIGQIPAGTLGNLTALQSVSLRFNALS  109



>ref|XP_008811220.1| PREDICTED: probable inactive receptor kinase At5g10020 [Phoenix 
dactylifera]
Length=1059

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (58%), Gaps = 5/76 (7%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNA---RHSPC--DFPGVTCDSNGSVKEIELSRRGLSGSVPFDSIC  317
            K  ++   + + D+W A    +S C  D+ G++CD +G+V  + L R GL+G + F ++ 
Sbjct  38   KKGIRADPSGVVDSWKAPPEGYSACPRDWRGISCDDSGAVVSLALDRLGLTGELKFTTLT  97

Query  318  SLKSLEKLSLGFNSLS  365
             LKSL  L+L  N+ S
Sbjct  98   GLKSLRNLTLSDNAFS  113



>ref|XP_008227225.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Prunus mume]
Length=1111

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 41/79 (52%), Gaps = 9/79 (11%)
 Frame = +3

Query  153  KAALQNSDTKIFDTW------NARHSP---CDFPGVTCDSNGSVKEIELSRRGLSGSVPF  305
            KA LQN       +W      NA ++P   C + GV+C++ GSV EI L+  GL G++  
Sbjct  47   KATLQNQAQNNLSSWAYPPSNNATNNPKIPCTWAGVSCNAAGSVIEINLTESGLQGTLNA  106

Query  306  DSICSLKSLEKLSLGFNSL  362
             S  S   LE L L FN L
Sbjct  107  FSFLSFPDLEYLDLSFNKL  125



>ref|XP_006441549.1| hypothetical protein CICLE_v10018710mg [Citrus clementina]
 gb|ESR54789.1| hypothetical protein CICLE_v10018710mg [Citrus clementina]
Length=973

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = +3

Query  183  IFDTW-NARHSPCDFPGVTCDS-NGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFN  356
            + D+W  +  SPC F G+TCDS  G V EI    + LSG +   SI +L+SL  LSL FN
Sbjct  49   VLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSLSGEIS-SSISALQSLTVLSLPFN  107

Query  357  SLS  365
             LS
Sbjct  108  VLS  110



>ref|XP_006478192.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Citrus sinensis]
Length=973

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = +3

Query  183  IFDTW-NARHSPCDFPGVTCDS-NGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFN  356
            + D+W  +  SPC F G+TCDS  G V EI    + LSG +   SI +L+SL  LSL FN
Sbjct  49   VLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSLSGEIS-SSISALQSLAVLSLPFN  107

Query  357  SLS  365
             LS
Sbjct  108  VLS  110



>gb|KDO45819.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
 gb|KDO45820.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
Length=973

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = +3

Query  183  IFDTW-NARHSPCDFPGVTCDS-NGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFN  356
            + D+W  +  SPC F G+TCDS  G V EI    + LSG +   SI +L+SL  LSL FN
Sbjct  49   VLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSLSGEIS-SSISALQSLTVLSLPFN  107

Query  357  SLS  365
             LS
Sbjct  108  VLS  110



>gb|EAY99548.1| hypothetical protein OsI_21521 [Oryza sativa Indica Group]
 gb|EAZ35739.1| hypothetical protein OsJ_20030 [Oryza sativa Japonica Group]
Length=678

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 3/63 (5%)
 Frame = +3

Query  180  KIFDTWNARHSPC--DFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGF  353
            ++  +W     PC   F GVTCDS G V  I L  RGLSG++P  +I  L+ L  L L +
Sbjct  43   RVLGSWARSGEPCGGSFVGVTCDSGGRVTAISLQGRGLSGTLP-PAIAGLRRLTGLYLHY  101

Query  354  NSL  362
            N +
Sbjct  102  NGI  104



>gb|KDO45821.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
 gb|KDO45822.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
 gb|KDO45823.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
Length=851

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = +3

Query  183  IFDTW-NARHSPCDFPGVTCDS-NGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFN  356
            + D+W  +  SPC F G+TCDS  G V EI    + LSG +   SI +L+SL  LSL FN
Sbjct  49   VLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSLSGEIS-SSISALQSLTVLSLPFN  107

Query  357  SLS  365
             LS
Sbjct  108  VLS  110



>dbj|BAD68873.1| putative somatic embryogenesis protein kinase 1 [Oryza sativa 
Japonica Group]
Length=647

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 3/63 (5%)
 Frame = +3

Query  180  KIFDTWNARHSPC--DFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGF  353
            ++  +W     PC   F GVTCDS G V  I L  RGLSG++P  +I  L+ L  L L +
Sbjct  12   RVLGSWARSGEPCGGSFVGVTCDSGGRVTAISLQGRGLSGTLP-PAIAGLRRLTGLYLHY  70

Query  354  NSL  362
            N +
Sbjct  71   NGI  73



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KAAL +  T    +W  N   SPC + GV C++ G+V  +++S R L+G +P  ++  L
Sbjct  34   VKAALDDP-TGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLPGAALSGL  92

Query  324  KSLEKLSLGFNSLS  365
            + L +L L  N+LS
Sbjct  93   QHLARLDLAANALS  106



>ref|XP_004511799.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2-like [Cicer arietinum]
Length=977

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 10/76 (13%)
 Frame = +3

Query  162  LQNSDTKIFDT------W--NARHSPCDFPGVTCDS-NGSVKEIELSRRGLSGSVPFDSI  314
            LQ  +T+I D       W  N +H+PC++ G+TCDS N SV  I+L+  G+ G  P    
Sbjct  34   LQVKNTQIDDQNKSLKDWLPNTQHNPCNWTGITCDSRNKSVVTIDLTEFGIYGDFP-SGF  92

Query  315  CSLKSLEKLSLGFNSL  362
            C + +L+ LSLG N L
Sbjct  93   CHIPTLQNLSLGTNFL  108



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KAAL +  T    +W  N   SPC + GV C++ G+V  +++S R L+G +P  ++  L
Sbjct  34   VKAALDDP-TGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLPGAALSGL  92

Query  324  KSLEKLSLGFNSLS  365
            + L +L L  N+LS
Sbjct  93   QHLARLDLAANALS  106



>gb|AAF73373.1|AF193835_1 LRK1 protein [Oryza sativa]
Length=970

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KAAL +  T    +W  N   SPC + GV C++ G+V  +++S R L+G +P  ++  L
Sbjct  34   VKAALDDP-TGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLPGAALSGL  92

Query  324  KSLEKLSLGFNSLS  365
            + L +L L  N+LS
Sbjct  93   QHLARLDLAANALS  106



>ref|NP_001058840.2| Os07g0134200 [Oryza sativa Japonica Group]
 dbj|BAF20754.2| Os07g0134200 [Oryza sativa Japonica Group]
Length=883

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KAAL +  T    +W  N   SPC + GV C++ G+V  +++S R L+G +P  ++  L
Sbjct  34   VKAALDDP-TGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLPGAALSGL  92

Query  324  KSLEKLSLGFNSLS  365
            + L +L L  N+LS
Sbjct  93   QHLARLDLAANALS  106



>ref|NP_001056717.1| Os06g0134700 [Oryza sativa Japonica Group]
 dbj|BAF18631.1| Os06g0134700, partial [Oryza sativa Japonica Group]
Length=672

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 3/63 (5%)
 Frame = +3

Query  180  KIFDTWNARHSPC--DFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGF  353
            ++  +W     PC   F GVTCDS G V  I L  RGLSG++P  +I  L+ L  L L +
Sbjct  37   RVLGSWARSGEPCGGSFVGVTCDSGGRVTAISLQGRGLSGTLP-PAIAGLRRLTGLYLHY  95

Query  354  NSL  362
            N +
Sbjct  96   NGI  98



>gb|EDN71345.1| receptor protein kinase [Beggiatoa sp. PS]
Length=3115

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 2/57 (4%)
 Frame = +3

Query  195   WNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
             W A  +PC +PGVTC +NG+V  I+L    L G +P D I +L +LE+L+L  N +S
Sbjct  2494  WKATDTPCQWPGVTC-ANGTVTAIDLPNNNLVGDIP-DQIGALINLEELNLNDNQIS  2548



>ref|XP_006826909.1| hypothetical protein AMTR_s00010p00158940 [Amborella trichopoda]
 gb|ERM94146.1| hypothetical protein AMTR_s00010p00158940 [Amborella trichopoda]
Length=651

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +3

Query  159  ALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEK  338
            +L+NS  +    WN   SPC + GVTC+ N  V  + L   GL+G +P  +  +L  L  
Sbjct  34   SLRNSVGRALQ-WNQSQSPCLWQGVTCEGN-RVTVLRLPGSGLAGQIPVGAFGNLTHLRT  91

Query  339  LSLGFNSLS  365
            LSL FN+LS
Sbjct  92   LSLRFNALS  100



>ref|XP_004305135.1| PREDICTED: receptor-like protein 12 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=1045

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +3

Query  192  TWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVP-FDSICSLKSLEKLSLGFNSLS  365
            +W++R   C +PGV+C +NGSV  +++SR  +SG +    S+  L+ L+ LSL FN+ +
Sbjct  47   SWDSRTDCCSWPGVSCSTNGSVVGLDISRESISGGIYNSSSLFDLQHLQSLSLAFNNFT  105



>ref|XP_011029975.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Populus euphratica]
Length=677

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 3/65 (5%)
 Frame = +3

Query  174  DTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSL  347
            + +   +WN   SPCD  F GV C+  G V  I L  +GL+G V   ++  LK L  L L
Sbjct  39   EARYLSSWNINGSPCDGSFEGVACNEKGQVANISLQGKGLNGKVS-PAVAGLKYLTGLYL  97

Query  348  GFNSL  362
             +NSL
Sbjct  98   HYNSL  102



>ref|XP_006353616.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Solanum 
tuberosum]
Length=977

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 37/67 (55%), Gaps = 2/67 (3%)
 Frame = +3

Query  168  NSDTKIFDTWNARHSPCDFPGVTCDSN-GSVKEIELSRRGLSGSVPFDSICSLKSLEKLS  344
            N      D+W    SPC F G+TCD N G V EI L  + LSG +   SI SL+SL  L 
Sbjct  45   NDPLNYLDSWKDSESPCKFYGITCDKNTGLVIEISLDNKSLSGVIS-PSIFSLQSLTSLV  103

Query  345  LGFNSLS  365
            L  N+LS
Sbjct  104  LPSNALS  110



>ref|XP_007141638.1| hypothetical protein PHAVU_008G212900g [Phaseolus vulgaris]
 gb|ESW13632.1| hypothetical protein PHAVU_008G212900g [Phaseolus vulgaris]
Length=1034

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            KA+L N       +W+   SPC + G+ CD + SV  I L++ GL G++   S  S   L
Sbjct  59   KASLDNQSQVSLSSWSTFTSPCKWKGIVCDESNSVSTINLAKFGLKGTLLNLSFSSFPKL  118

Query  333  EKLSLGFNSLS  365
             +L L +N+L+
Sbjct  119  MRLCLSYNNLN  129



>ref|XP_002882256.1| hypothetical protein ARALYDRAFT_896266 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58515.1| hypothetical protein ARALYDRAFT_896266 [Arabidopsis lyrata subsp. 
lyrata]
Length=626

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +3

Query  195  WN-ARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            WN +  SPC++ GVTCD+ G V  + L   GL GS+P   I +L  L+ LSL FNS+S
Sbjct  47   WNMSASSPCNWHGVTCDA-GRVTALRLPGAGLFGSLPIGGIGNLTQLKTLSLRFNSVS  103



>ref|XP_007140941.1| hypothetical protein PHAVU_008G154200g [Phaseolus vulgaris]
 gb|ESW12935.1| hypothetical protein PHAVU_008G154200g [Phaseolus vulgaris]
Length=661

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +3

Query  174  DTKIFDTWNARHSPCD---FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLS  344
            + ++  +WN+   PC    F GV C+  G V  I L  +GL G+VP  ++ +LKSL  L 
Sbjct  40   ENRVLLSWNSHSDPCSSASFEGVACNEQGLVTNISLQGKGLYGTVPH-ALAALKSLTGLF  98

Query  345  LGFNSL  362
            L FN+L
Sbjct  99   LHFNAL  104



>ref|XP_004308453.2| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1 [Fragaria vesca subsp. vesca]
Length=653

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 4/74 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPC--DFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KA+L +   +   +W     PC  DF GV C+  G V  I L  +GL G +P  S+  L
Sbjct  3    MKASL-DPQNQFLTSWTPLSDPCGDDFEGVACNEQGLVTNISLQGKGLWGQIP-SSVGDL  60

Query  324  KSLEKLSLGFNSLS  365
            KSL  L L FN+LS
Sbjct  61   KSLTGLYLHFNALS  74



>gb|EYU41358.1| hypothetical protein MIMGU_mgv1a000915mg [Erythranthe guttata]
Length=944

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 4/62 (6%)
 Frame = +3

Query  186  FDTW--NARHSPCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFN  356
             D W  + RH+PC++ G+TCD  + +V  I+LS   +SG+ P D  C + SL  L L FN
Sbjct  50   LDDWLESGRHAPCNWTGITCDPVDNAVVSIDLSGADVSGNFPAD-FCRISSLRNLDLSFN  108

Query  357  SL  362
            SL
Sbjct  109  SL  110



>ref|XP_006297231.1| hypothetical protein CARUB_v10013240mg [Capsella rubella]
 gb|EOA30129.1| hypothetical protein CARUB_v10013240mg [Capsella rubella]
Length=617

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = +3

Query  156  AALQNSDTKIFDTWN-ARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
             AL+NS       WN +  SPC++ GV CD+ G V  + L   GL GS+P   I +L  L
Sbjct  35   VALRNSVRGRPLLWNMSASSPCNWHGVHCDA-GRVTALRLPGAGLFGSLPIGGIGNLTEL  93

Query  333  EKLSLGFNSLS  365
            + LSL FNSLS
Sbjct  94   QTLSLRFNSLS  104



>ref|XP_002301282.2| hypothetical protein POPTR_0002s14800g [Populus trichocarpa]
 gb|EEE80555.2| hypothetical protein POPTR_0002s14800g [Populus trichocarpa]
Length=671

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            IKA+L +   ++  +W     PC   F GV C+  G V  I L  +GLSG +P  ++  L
Sbjct  30   IKASL-DPQNRLLTSWEPNKDPCSGAFEGVACNEQGHVANISLQGKGLSGQIP-AALGGL  87

Query  324  KSLEKLSLGFNSLS  365
            KSL  L L FN+L+
Sbjct  88   KSLSGLFLHFNALN  101



>ref|XP_011041704.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Populus euphratica]
Length=677

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 39/73 (53%), Gaps = 4/73 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KAAL + + +   +W    SPCD  F GV C+  G V  I L  +GL G V   +I  L
Sbjct  32   MKAAL-DPENRYLTSWTINGSPCDGSFEGVACNEKGQVANISLQGKGLYGKVS-PAIAGL  89

Query  324  KSLEKLSLGFNSL  362
            + L  L L FNSL
Sbjct  90   RHLTGLYLHFNSL  102



>gb|KFK25298.1| hypothetical protein AALP_AA8G094300 [Arabis alpina]
Length=1050

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  213  PCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            P  +PG++CD  GS+  I L RR LSG + F ++  L SL  L+L  NS S
Sbjct  60   PNTWPGISCDGTGSIIAINLDRRNLSGELKFSTLIGLTSLRNLTLSGNSFS  110



>ref|XP_007213080.1| hypothetical protein PRUPE_ppa021211mg [Prunus persica]
 gb|EMJ14279.1| hypothetical protein PRUPE_ppa021211mg [Prunus persica]
Length=1294

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 41/79 (52%), Gaps = 9/79 (11%)
 Frame = +3

Query  153  KAALQNSDTKIFDTW------NARHSP---CDFPGVTCDSNGSVKEIELSRRGLSGSVPF  305
            KA  QN       +W      NA ++P   C + GV+C++ GSV EI L++ GL G++  
Sbjct  38   KATFQNQTQNNLSSWAYPPSNNATNNPKIPCTWAGVSCNAAGSVIEINLTKSGLQGTLNA  97

Query  306  DSICSLKSLEKLSLGFNSL  362
             S  S   LE L L FN L
Sbjct  98   FSFFSFPDLEYLDLSFNKL  116



>ref|XP_010925124.1| PREDICTED: probable inactive receptor kinase At2g26730 [Elaeis 
guineensis]
Length=652

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = +3

Query  195  WNARHSPCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            WNA  S C + GVTCD SN SV E+ L   GL G +P  ++  L SL  LSL  N LS
Sbjct  45   WNANASACSWVGVTCDASNTSVVELRLPAVGLVGPIPAGTLGRLTSLRVLSLRANRLS  102



>gb|KHG24857.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=1012

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +3

Query  186  FDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSL  362
              +WN+  SPCD+P + C +N SV E+ L  + ++  +P  +IC LK+L  L L FN +
Sbjct  45   LQSWNSSSSPCDWPEINCTAN-SVTEVHLHDKNITTPIP-STICDLKNLTLLDLAFNYI  101



>gb|KJB54767.1| hypothetical protein B456_009G048200 [Gossypium raimondii]
Length=975

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = +3

Query  183  IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSL  362
               +WN+  SPCD+P + C +N SV E+ L  + ++  +P  +IC LK+L  L L FN +
Sbjct  44   FLQSWNSSSSPCDWPEINCTAN-SVTEVHLRDKNITTPIP-STICDLKNLTFLDLAFNYI  101



>ref|XP_011017487.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=671

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            IKA+L +   ++  +W     PC   F GV C+  G V  I L  +GLSG +P  ++  L
Sbjct  30   IKASL-DPQNRLLTSWEPNKDPCSGAFEGVACNEQGHVANISLQGKGLSGQIP-AALGGL  87

Query  324  KSLEKLSLGFNSLS  365
            KSL  L L FN+L+
Sbjct  88   KSLSGLFLHFNALN  101



>gb|KJB54766.1| hypothetical protein B456_009G048200 [Gossypium raimondii]
Length=1012

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = +3

Query  183  IFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSL  362
               +WN+  SPCD+P + C +N SV E+ L  + ++  +P  +IC LK+L  L L FN +
Sbjct  44   FLQSWNSSSSPCDWPEINCTAN-SVTEVHLRDKNITTPIP-STICDLKNLTFLDLAFNYI  101



>ref|XP_010491652.1| PREDICTED: probable inactive receptor kinase At5g10020 [Camelina 
sativa]
Length=1054

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +3

Query  213  PCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            P  +PG++CD   GS+  I L RRGLSG + F+++  L SL  LSL  NS S
Sbjct  61   PNSWPGISCDPQTGSIIAINLDRRGLSGELKFNTLTGLTSLRNLSLSGNSFS  112



>ref|XP_002871400.1| hypothetical protein ARALYDRAFT_487827 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47659.1| hypothetical protein ARALYDRAFT_487827 [Arabidopsis lyrata subsp. 
lyrata]
Length=1051

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +3

Query  213  PCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            P D+PG++CD   GS+  I L RRGLSG + F ++  L  L  LSL  NS S
Sbjct  59   PNDWPGISCDPETGSIIAINLDRRGLSGELKFSTLSGLTRLRNLSLSGNSFS  110



>ref|XP_009390851.1| PREDICTED: probable inactive receptor kinase At1g48480 [Musa 
acuminata subsp. malaccensis]
Length=654

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  195  WNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            WNA  SPC + GV C S G V  + L   GL GS+P  ++ +L +L  LSL +N+LS
Sbjct  51   WNASGSPCSWQGVVCGS-GRVTALRLPGVGLIGSIPAATVGNLSALRVLSLRYNALS  106



>gb|ACK44523.1| AT5G10020-like protein [Arabidopsis arenosa]
Length=1052

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +3

Query  213  PCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            P D+PG++CD   GS+  I L RRGLSG + F ++  L  L  LSL  NS S
Sbjct  59   PNDWPGISCDPETGSIIAINLDRRGLSGELKFSTLSGLTRLRNLSLSGNSFS  110



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            +KA L +    +   W+A    C +PGVTCD  G+V  ++LS R LSG +P  ++  L+S
Sbjct  37   LKAQLSDPGAAL-GPWDATTDHCSWPGVTCDDAGAVVSLDLSGRNLSGLLP-PAVGRLRS  94

Query  330  LEKLSLGFNSLS  365
            L +LS   NS S
Sbjct  95   LLRLSAAANSFS  106



>ref|NP_001078562.1| putative inactive receptor kinase [Arabidopsis thaliana]
 dbj|BAF00390.1| receptor protein kinase -like [Arabidopsis thaliana]
 gb|AED91483.1| putative inactive receptor kinase [Arabidopsis thaliana]
Length=1000

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +3

Query  213  PCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            P D+PG++CD   GS+  I L RRGLSG + F ++  L  L  LSL  NS S
Sbjct  61   PNDWPGISCDPETGSIIAINLDRRGLSGELKFSTLSGLTRLRNLSLSGNSFS  112



>gb|KDP28763.1| hypothetical protein JCGZ_14534 [Jatropha curcas]
Length=673

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 4/74 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPC--DFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            IKA+L +   +   +W     PC   F GV C+  G V  I L  +GLSG +P  ++  L
Sbjct  28   IKASL-DPQNRFLTSWQHNADPCGGSFEGVACNEEGRVANISLQGKGLSGRIP-AALGGL  85

Query  324  KSLEKLSLGFNSLS  365
            KSL  L L FN+L+
Sbjct  86   KSLTGLYLHFNALT  99



>ref|NP_196564.1| putative inactive receptor kinase [Arabidopsis thaliana]
 sp|Q0WR59.2|Y5020_ARATH RecName: Full=Probable inactive receptor kinase At5g10020; Flags: 
Precursor [Arabidopsis thaliana]
 gb|ACN59365.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED91482.1| putative inactive receptor kinase [Arabidopsis thaliana]
Length=1048

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +3

Query  213  PCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            P D+PG++CD   GS+  I L RRGLSG + F ++  L  L  LSL  NS S
Sbjct  61   PNDWPGISCDPETGSIIAINLDRRGLSGELKFSTLSGLTRLRNLSLSGNSFS  112



>gb|AAO00824.1| disease resistance protein - like [Arabidopsis thaliana]
 gb|AAP75809.1| At5g25910 [Arabidopsis thaliana]
Length=448

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = +3

Query  195  WNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            WN   SPC++P +TC + G+V EI    +  +G+VP  +IC+  +L+ L+L FN  +
Sbjct  46   WNDTSSPCNWPRITCTA-GNVTEINFQNQNFTGTVP-TTICNFPNLKSLNLSFNYFA  100



>gb|AAL47484.1| AT5g10020/T31P16_9 [Arabidopsis thaliana]
Length=1048

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +3

Query  213  PCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            P D+PG++CD   GS+  I L RRGLSG + F ++  L  L  LSL  NS S
Sbjct  61   PNDWPGISCDPETGSIIAINLDRRGLSGELKFSTLSGLTRLRNLSLSGNSFS  112



>ref|XP_007156676.1| hypothetical protein PHAVU_002G007800g [Phaseolus vulgaris]
 gb|ESW28670.1| hypothetical protein PHAVU_002G007800g [Phaseolus vulgaris]
Length=974

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 4/75 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTW--NARHSPCDFPGVTCDS-NGSVKEIELSRRGLSGSVPFDSICS  320
            +K        K    W  N  H+PC++ G+TCD+ N S+  I+LS  G+ G  PF   C 
Sbjct  35   VKNTQLEDKNKSLQNWVPNTDHNPCNWTGITCDAQNHSLVSIDLSETGIYGEFPF-GFCH  93

Query  321  LKSLEKLSLGFNSLS  365
            + +L+ LSL  N LS
Sbjct  94   IHTLQNLSLASNFLS  108



>emb|CBI38873.3| unnamed protein product [Vitis vinifera]
Length=316

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 40/73 (55%), Gaps = 4/73 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KA+L + + +   +W + + PC   F GV C+  G V  I L  +GL G +P   I  L
Sbjct  3    MKASL-DPENRFLSSWTSDNDPCSDSFEGVACNEYGHVVNISLQGKGLMGQIP-KEIAEL  60

Query  324  KSLEKLSLGFNSL  362
            KSL  L L FNSL
Sbjct  61   KSLSGLFLHFNSL  73



>emb|CAN72186.1| hypothetical protein VITISV_012898 [Vitis vinifera]
Length=702

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 40/73 (55%), Gaps = 4/73 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KA+L + + +   +W + + PC   F GV C+  G V  I L  +GL G +P   I  L
Sbjct  34   MKASL-DPENRFLSSWTSDNDPCSDSFEGVACNEYGHVVNISLQGKGLMGQIP-KEIAEL  91

Query  324  KSLEKLSLGFNSL  362
            KSL  L L FNSL
Sbjct  92   KSLSGLFLHFNSL  104



>ref|XP_002279998.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Vitis vinifera]
Length=677

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 40/73 (55%), Gaps = 4/73 (5%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSL  323
            +KA+L + + +   +W + + PC   F GV C+  G V  I L  +GL G +P   I  L
Sbjct  34   MKASL-DPENRFLSSWTSDNDPCSDSFEGVACNEYGHVVNISLQGKGLMGQIP-KEIAEL  91

Query  324  KSLEKLSLGFNSL  362
            KSL  L L FNSL
Sbjct  92   KSLSGLFLHFNSL  104



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IK+++ +        WNA  S C +PGVTCDS   V  ++LS   LSG++  D +  L+ 
Sbjct  29   IKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALSPD-VAHLRF  87

Query  330  LEKLSLGFNSLS  365
            L+ LS+  N LS
Sbjct  88   LQNLSVAANQLS  99



>ref|XP_010547240.1| PREDICTED: receptor-like protein kinase 5 [Tarenaya hassleriana]
Length=959

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = +3

Query  186  FDTWNARHSPCDFPGVTCDS-NGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSL  347
             D+WN   SPC F GV CD  +G+V EI L +  LSGS+   +IC+LK+L  L L
Sbjct  53   LDSWNLSTSPCRFRGVKCDPFSGAVTEISLGKTQLSGSIS-PAICALKNLSTLWL  106



>dbj|BAF79981.1| receptor-like kinase [Nitella axillaris]
Length=954

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +3

Query  213  PC-DFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            PC ++ G+TC+ NGSV +++LS R L G +P  ++  LK LE L LGFN+ +
Sbjct  65   PCKNWDGITCNLNGSVTKVDLSGRALKGPLP--NVAELKYLETLELGFNNFT  114



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IK+++ +        WNA  S C +PGVTCDS   V  ++LS   LSG++  D +  L+ 
Sbjct  29   IKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALSPD-VAHLRF  87

Query  330  LEKLSLGFNSLS  365
            L+ LS+  N LS
Sbjct  88   LQNLSVAANQLS  99



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKS  329
            IK+++ +        WNA  S C +PGVTCDS   V  ++LS   LSG++  D +  L+ 
Sbjct  31   IKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALSPD-VAHLRF  89

Query  330  LEKLSLGFNSLS  365
            L+ LS+  N LS
Sbjct  90   LQNLSVAANQLS  101



>ref|XP_011042292.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Populus euphratica]
Length=682

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 3/64 (5%)
 Frame = +3

Query  180  KIFDTWNARHSPCD--FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGF  353
            K   +W +   PC   F GV C+ +G V  I L  +GLSG++   ++  LKSL  L L +
Sbjct  44   KYLQSWTSEGDPCSDLFEGVACNEHGQVANISLQGKGLSGTIS-PAVAELKSLSGLYLHY  102

Query  354  NSLS  365
            NSLS
Sbjct  103  NSLS  106



>ref|XP_007052072.1| Leucine-rich repeat receptor protein kinase [Theobroma cacao]
 gb|EOX96229.1| Leucine-rich repeat receptor protein kinase [Theobroma cacao]
Length=677

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 40/75 (53%), Gaps = 5/75 (7%)
 Frame = +3

Query  150  IKAALQNSDTKIFDTWNARHSPCD---FPGVTCDSNGSVKEIELSRRGLSGSVPFDSICS  320
            IKA+L +   +   +W     PC    F GV C+  G V  I L  +GLSG +P  ++  
Sbjct  30   IKASL-DPQNRFLSSWTPYTDPCSSGSFDGVACNEEGHVANISLQGKGLSGQIP-AALGG  87

Query  321  LKSLEKLSLGFNSLS  365
            LKSL  L L FN+LS
Sbjct  88   LKSLTGLYLHFNALS  102



>ref|XP_003552234.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like isoform X1 [Glycine max]
Length=1074

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +3

Query  153  KAALQNSDTKIFDTWNARHSPCDFPGVTCDSNGSVKEIELSRRGLSGSVPFDSICSLKSL  332
            KA+L N    +  +W   +SPC++ G+ CD   SV  I L+R GL G++   S  SL ++
Sbjct  58   KASLHNQSQALLSSWGG-NSPCNWLGIACDHTKSVSNINLTRIGLRGTLQTLSFSSLPNI  116

Query  333  EKLSLGFNSLS  365
              L +  NSL+
Sbjct  117  LTLDMSNNSLN  127



>ref|NP_001241340.1| receptor-like protein kinase HSL1-like [Glycine max]
 gb|ACM89538.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
 gb|KHN32461.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=955

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = +3

Query  192  TWNARHSPCDFPGVTCD-SNGSVKEIELSRRGLSGSVPFDSICSLKSLEKLSLGFNSLS  365
            +WN   SPC F G+TCD  +G V EI L  + LSG + F S+  L+SL+ LSL  N +S
Sbjct  39   SWNESDSPCKFYGITCDPVSGRVTEISLDNKSLSGDI-FPSLSILQSLQVLSLPSNLIS  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559392177135