BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF011L01

Length=433
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAE96956.1|  starch branching enzyme I                              199   2e-56   Ipomoea batatas [batate]
dbj|BAE96952.1|  starch branching enzyme I                              199   2e-56   Ipomoea batatas [batate]
dbj|BAE96954.1|  starch branching enzyme I                              199   2e-56   Ipomoea batatas [batate]
dbj|BAE96955.1|  starch branching enzyme I                              199   2e-56   Ipomoea batatas [batate]
dbj|BAE96953.1|  starch branching enzyme I                              199   2e-56   Ipomoea batatas [batate]
ref|XP_006342128.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-gl...  86.7    2e-16   
ref|NP_001275183.1|  1,4-alpha-glucan-branching enzyme                85.5    4e-16   Solanum tuberosum [potatoes]
ref|XP_009631577.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-gl...  78.2    1e-13   
ref|XP_010320454.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-gl...  68.9    1e-10   
ref|XP_010061162.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...  49.7    3e-04   Eucalyptus grandis [rose gum]
gb|KDP36796.1|  hypothetical protein JCGZ_08087                       49.3    3e-04   Jatropha curcas



>dbj|BAE96956.1| starch branching enzyme I [Ipomoea batatas]
Length=875

 Score =   199 bits (506),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 96/100 (96%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +2

Query  134  MQTSCGLLSSPSRGSFIPIPTKNLLRAPRNKRSFASPCTTGAIFESQKLSWDVFSITASR  313
            MQTSC LLSSPSRGSFIPIPTKNLLRA RNKRSFASPCTTGAIFESQKLS DVFSITASR
Sbjct  1    MQTSCALLSSPSRGSFIPIPTKNLLRAARNKRSFASPCTTGAIFESQKLSRDVFSITASR  60

Query  314  LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIHLLGLD  433
            LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIH+LGLD
Sbjct  61   LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIHILGLD  100



>dbj|BAE96952.1| starch branching enzyme I [Ipomoea batatas]
Length=875

 Score =   199 bits (506),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 96/100 (96%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +2

Query  134  MQTSCGLLSSPSRGSFIPIPTKNLLRAPRNKRSFASPCTTGAIFESQKLSWDVFSITASR  313
            MQTSC LLSSPSRGSFIPIPTKNLLRA RNKRSFASPCTTGAIFESQKLS DVFSITASR
Sbjct  1    MQTSCALLSSPSRGSFIPIPTKNLLRAARNKRSFASPCTTGAIFESQKLSRDVFSITASR  60

Query  314  LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIHLLGLD  433
            LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIH+LGLD
Sbjct  61   LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIHILGLD  100



>dbj|BAE96954.1| starch branching enzyme I [Ipomoea batatas]
Length=875

 Score =   199 bits (505),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 96/100 (96%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +2

Query  134  MQTSCGLLSSPSRGSFIPIPTKNLLRAPRNKRSFASPCTTGAIFESQKLSWDVFSITASR  313
            MQTSC LLSSPSRGSFIPIPTKNLLRA RNKRSFASPCTTGAIFESQKLS DVFSITASR
Sbjct  1    MQTSCALLSSPSRGSFIPIPTKNLLRAARNKRSFASPCTTGAIFESQKLSRDVFSITASR  60

Query  314  LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIHLLGLD  433
            LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIH+LGLD
Sbjct  61   LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIHILGLD  100



>dbj|BAE96955.1| starch branching enzyme I [Ipomoea batatas]
Length=875

 Score =   199 bits (505),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 96/100 (96%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +2

Query  134  MQTSCGLLSSPSRGSFIPIPTKNLLRAPRNKRSFASPCTTGAIFESQKLSWDVFSITASR  313
            MQTSC LLSSPSRGSFIPIPTKNLLRA RNKRSFASPCTTGAIFESQKLS DVFSITASR
Sbjct  1    MQTSCALLSSPSRGSFIPIPTKNLLRAARNKRSFASPCTTGAIFESQKLSRDVFSITASR  60

Query  314  LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIHLLGLD  433
            LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIH+LGLD
Sbjct  61   LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIHILGLD  100



>dbj|BAE96953.1| starch branching enzyme I [Ipomoea batatas]
Length=875

 Score =   199 bits (505),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 96/100 (96%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +2

Query  134  MQTSCGLLSSPSRGSFIPIPTKNLLRAPRNKRSFASPCTTGAIFESQKLSWDVFSITASR  313
            MQTSC LLSSPSRGSFIPIPTKNLLRA RNKRSFASPCTTGAIFESQKLS DVFSITASR
Sbjct  1    MQTSCALLSSPSRGSFIPIPTKNLLRAARNKRSFASPCTTGAIFESQKLSRDVFSITASR  60

Query  314  LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIHLLGLD  433
            LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIH+LGLD
Sbjct  61   LRNDRWREHSSNISSVLTDDSSTMADVEKEIENIHILGLD  100



>ref|XP_006342128.1| PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-glucan-branching enzyme-like 
[Solanum tuberosum]
Length=875

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 50/102 (49%), Positives = 64/102 (63%), Gaps = 2/102 (2%)
 Frame = +2

Query  134  MQTSCGLLSSPSRGSFIPIPTKNLLRAPRNKRSFASPCTTGAIFESQKLSWDVFSITASR  313
            M+ +  +LS P RGSF     K    A RNK  F S  +TG  F SQ+ SWD+ S   SR
Sbjct  1    MEINFNVLSKPIRGSFPSFSPKVSSGASRNKICFPSQHSTGLKFGSQERSWDISSTPKSR  60

Query  314  LRNDRWREHSSNISSVLTDDSSTMADVEKEI--ENIHLLGLD  433
            +R D   +HSS IS+VLTDD+STMA +E+++  ENI LL LD
Sbjct  61   VRKDERMKHSSAISAVLTDDNSTMAPLEEDVKTENIGLLNLD  102



>ref|NP_001275183.1| 1,4-alpha-glucan-branching enzyme [Solanum tuberosum]
 sp|P30924.2|GLGB_SOLTU RecName: Full=1,4-alpha-glucan-branching enzyme; AltName: Full=Q-enzyme; 
AltName: Full=Starch-branching enzyme [Solanum tuberosum]
 emb|CAA49463.1| 1,4-alpha-glucan branching enzyme [Solanum tuberosum]
Length=861

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 50/102 (49%), Positives = 64/102 (63%), Gaps = 2/102 (2%)
 Frame = +2

Query  134  MQTSCGLLSSPSRGSFIPIPTKNLLRAPRNKRSFASPCTTGAIFESQKLSWDVFSITASR  313
            M+ +  +LS P RGSF     K    A RNK  F S  +TG  F SQ+ SWD+ S   SR
Sbjct  1    MEINFKVLSKPIRGSFPSFSPKVSSGASRNKICFPSQHSTGLKFGSQERSWDISSTPKSR  60

Query  314  LRNDRWREHSSNISSVLTDDSSTMADVEKEI--ENIHLLGLD  433
            +R D   +HSS IS+VLTDD+STMA +E+++  ENI LL LD
Sbjct  61   VRKDERMKHSSAISAVLTDDNSTMAPLEEDVKTENIGLLNLD  102



>ref|XP_009631577.1| PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-glucan-branching enzyme-like 
[Nicotiana tomentosiformis]
Length=823

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 47/102 (46%), Positives = 62/102 (61%), Gaps = 2/102 (2%)
 Frame = +2

Query  134  MQTSCGLLSSPSRGSFIPIPTKNLLRAPRNKRSFASPCTTGAIFESQKLSWDVFSITASR  313
            M+T+  +LS+  +GSF     +    A RNK  F S  +TG  F  QK SWD+ S   SR
Sbjct  1    METNFNVLSTQIQGSFPSSSPQVFTLASRNKICFPSQHSTGLKFGYQKRSWDICSTPKSR  60

Query  314  LRNDRWREHSSNISSVLTDDSSTMADVEK--EIENIHLLGLD  433
            +R  +  +HSS IS+VLTDD+ST A +E+  E ENI LL LD
Sbjct  61   VRESQRMKHSSAISAVLTDDNSTTASLEEGVETENIGLLNLD  102



>ref|XP_010320454.1| PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-glucan-branching enzyme-like 
[Solanum lycopersicum]
Length=847

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 47/126 (37%), Positives = 65/126 (52%), Gaps = 27/126 (21%)
 Frame = +2

Query  134  MQTSCGLLSSPSRGSFIPIPTKNL------------------------LRAPRNKRSFAS  241
            M+ +  +LS P RGSF P  +  +                        ++A R K  F S
Sbjct  1    MEINFNVLSKPIRGSF-PFSSPRVSPRGQGQSSEQMDMLLALSLDGRGVKASRTKICFPS  59

Query  242  PCTTGAIFESQKLSWDVFSITASRLRNDRWREHSSNISSVLTDDSSTMADVEKEI--ENI  415
              +TG  F S+  SWD+ S   SR+R D   +HSS IS+VLT+D+STMA  E+++  ENI
Sbjct  60   QHSTGLKFGSEGRSWDISSTPKSRVRKDERMKHSSAISAVLTNDNSTMASREEDVKTENI  119

Query  416  HLLGLD  433
             LL LD
Sbjct  120  GLLNLD  125



>ref|XP_010061162.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW68085.1| hypothetical protein EUGRSUZ_F01770 [Eucalyptus grandis]
Length=845

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 35/101 (35%), Positives = 49/101 (49%), Gaps = 1/101 (1%)
 Frame = +2

Query  134  MQTSCGLLS-SPSRGSFIPIPTKNLLRAPRNKRSFASPCTTGAIFESQKLSWDVFSITAS  310
            M +SCG  S  P+ GS  P       +  RN R+ A+    G   +S +L         S
Sbjct  1    MYSSCGFASVPPAVGSSSPSSRTQCAQTSRNSRTVANRQFGGVFSQSSQLFRRHKLHFPS  60

Query  311  RLRNDRWREHSSNISSVLTDDSSTMADVEKEIENIHLLGLD  433
            R++     + +  I  VLTDDSSTM  +E EIE I +L +D
Sbjct  61   RVQRQGRADRNPKILGVLTDDSSTMTPIEDEIERIGILNVD  101



>gb|KDP36796.1| hypothetical protein JCGZ_08087 [Jatropha curcas]
Length=871

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 38/101 (38%), Positives = 51/101 (50%), Gaps = 7/101 (7%)
 Frame = +2

Query  134  MQTSCGLLSSPSRGSFIPIPTKNLLRAPRNKRSFASPCTTGAIFESQKLSWD-VFSITAS  310
            M  S  L  +P+ GS  P   KN  RA  N  +       G  FES+KL     F     
Sbjct  1    MLASLDLFPAPAFGSVSPSLGKNFKRALGN--NLHKQKLIGLTFESRKLHGSPKFYFMPG  58

Query  311  RLRNDRWREHSSNISSVLTDDSSTMADVEKEIENIHLLGLD  433
               N R   H   I++V+TDD++TM + EKE+E+IHLL +D
Sbjct  59   ISTNKR---HGLTITAVMTDDNTTMTN-EKEMEDIHLLSID  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566946208800