BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF011J10

Length=457
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009622125.1|  PREDICTED: probable prolyl 4-hydroxylase 10      72.0    2e-12   Nicotiana tomentosiformis
ref|XP_009776785.1|  PREDICTED: probable prolyl 4-hydroxylase 10      70.5    8e-12   Nicotiana sylvestris
gb|KDO71358.1|  hypothetical protein CISIN_1g023009mg                 58.9    3e-08   Citrus sinensis [apfelsine]
gb|KDO71357.1|  hypothetical protein CISIN_1g023009mg                 58.5    6e-08   Citrus sinensis [apfelsine]
ref|NP_001242522.1|  uncharacterized protein LOC100806046             59.7    7e-08   
gb|KHN35999.1|  Prolyl 4-hydroxylase subunit alpha-1                  59.7    7e-08   Glycine soja [wild soybean]
ref|XP_003612250.1|  Prolyl 4-hydroxylase alpha-2 subunit             58.2    7e-08   
ref|XP_006343343.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  59.3    1e-07   Solanum tuberosum [potatoes]
gb|KDO71356.1|  hypothetical protein CISIN_1g023009mg                 58.5    1e-07   Citrus sinensis [apfelsine]
ref|XP_006425362.1|  hypothetical protein CICLE_v10026208mg           58.5    1e-07   
gb|ACU17088.1|  unknown                                               57.4    2e-07   Glycine max [soybeans]
gb|KDO71351.1|  hypothetical protein CISIN_1g023009mg                 58.5    2e-07   Citrus sinensis [apfelsine]
ref|XP_006425363.1|  hypothetical protein CICLE_v10026208mg           58.5    2e-07   Citrus clementina [clementine]
ref|XP_006467023.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  58.5    2e-07   Citrus sinensis [apfelsine]
ref|XP_003612249.1|  Prolyl 4-hydroxylase alpha-2 subunit             58.2    3e-07   Medicago truncatula
ref|XP_003538892.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1  57.0    5e-07   Glycine max [soybeans]
ref|XP_004234520.1|  PREDICTED: probable prolyl 4-hydroxylase 10      56.6    8e-07   Solanum lycopersicum
gb|KDO71350.1|  hypothetical protein CISIN_1g023009mg                 54.7    3e-06   Citrus sinensis [apfelsine]
ref|XP_006467024.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  54.7    4e-06   Citrus sinensis [apfelsine]
ref|XP_006340784.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  54.7    4e-06   Solanum tuberosum [potatoes]
ref|XP_009587704.1|  PREDICTED: probable prolyl 4-hydroxylase 10      54.3    5e-06   Nicotiana tomentosiformis
gb|KJB43229.1|  hypothetical protein B456_007G190600                  51.6    2e-05   Gossypium raimondii
ref|XP_009801759.1|  PREDICTED: probable prolyl 4-hydroxylase 10      52.4    3e-05   Nicotiana sylvestris
ref|XP_010444842.1|  PREDICTED: probable prolyl 4-hydroxylase 10      52.4    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010465981.1|  PREDICTED: probable prolyl 4-hydroxylase 10 ...  52.4    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006280909.1|  hypothetical protein CARUB_v10026902mg           52.0    3e-05   Capsella rubella
ref|XP_004291329.1|  PREDICTED: probable prolyl 4-hydroxylase 3       51.6    4e-05   Fragaria vesca subsp. vesca
gb|KJB43228.1|  hypothetical protein B456_007G190600                  51.6    4e-05   Gossypium raimondii
gb|KJB43227.1|  hypothetical protein B456_007G190600                  51.6    4e-05   Gossypium raimondii
ref|NP_001190630.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...  51.2    5e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDP01844.1|  unnamed protein product                              51.2    6e-05   Coffea canephora [robusta coffee]
ref|NP_201407.4|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  50.8    7e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10411.1|  prolyl 4-hydroxylase, alpha subunit-like protein     50.8    7e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232524.1|  PREDICTED: probable prolyl 4-hydroxylase 10      50.8    8e-05   Solanum lycopersicum
ref|XP_002866777.1|  oxidoreductase                                   50.4    9e-05   
ref|XP_004512179.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  50.4    1e-04   
gb|EPS63604.1|  iron ion binding / oxidoreductase/ oxidoreductase...  50.1    1e-04   Genlisea aurea
ref|XP_006393794.1|  hypothetical protein EUTSA_v10004714mg           48.1    6e-04   Eutrema salsugineum [saltwater cress]



>ref|XP_009622125.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana tomentosiformis]
Length=291

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  240  KGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  419
            KG++ R  PR++++S         +LS VVL+LLAFGI SIPSSSRGSQKAHDLS+IAHN
Sbjct  4    KGRHSRVGPRKSSNSTLIFGGFI-MLSFVVLILLAFGIFSIPSSSRGSQKAHDLSSIAHN  62

Query  420  TLER  431
            T++R
Sbjct  63   TVQR  66



>ref|XP_009776785.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana sylvestris]
Length=290

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  240  KGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  419
            KG++ R  PR++++S         I S VVL+LLAFGI SIPSS+RGSQKAHDLS+IAHN
Sbjct  4    KGRHSRVGPRKSSNSTLIFGGFIMI-SFVVLILLAFGIFSIPSSTRGSQKAHDLSSIAHN  62

Query  420  TLER  431
            T++R
Sbjct  63   TVQR  66



>gb|KDO71358.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=174

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  413
            MAK +Y R  P R +SS+T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  414  HNTLEREEXEE  446
              ++ER E +E
Sbjct  60   RKSMERSEGDE  70



>gb|KDO71357.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=202

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  413
            MAK +Y R  P R +SS+T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  414  HNTLEREEXEE  446
              ++ER E +E
Sbjct  60   RKSMERSEGDE  70



>ref|NP_001242522.1| uncharacterized protein LOC100806046 [Glycine max]
 gb|ACU24023.1| unknown [Glycine max]
Length=289

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGS-QKAHDLSTI  410
            MAK +Y R  PR+++SS+T    +F + + +VL+LLA GILSIPSSSRG+  K +DL++I
Sbjct  1    MAKPRYSRLPPRKSSSSSTLILTLFLVFTFLVLILLALGILSIPSSSRGNLPKPNDLASI  60

Query  411  AHNTLEREEXEE  446
            A NT+E  + +E
Sbjct  61   ARNTIETSDSDE  72



>gb|KHN35999.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=289

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGS-QKAHDLSTI  410
            MAK +Y R  PR+++SS+T    +F + + +VL+LLA GILSIPSSSRG+  K +DL++I
Sbjct  1    MAKPRYSRLPPRKSSSSSTLILTLFLVFTFLVLILLALGILSIPSSSRGNLPKPNDLASI  60

Query  411  AHNTLEREEXEE  446
            A NT+E  + +E
Sbjct  61   ARNTIETSDSDE  72



>ref|XP_003612250.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AES95208.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=204

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  413
            MAK +Y R   R+++S  T  F++F   + ++L+LL FGILSIPSS++   K +DL++I 
Sbjct  1    MAKSRYSRLPSRKSSSPYTLIFSLFIAFTFLILILLVFGILSIPSSNQNLPKPNDLTSIV  60

Query  414  HNTLEREEXEE  446
            HNT++R + EE
Sbjct  61   HNTVDRNDDEE  71



>ref|XP_006343343.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Solanum 
tuberosum]
Length=289

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = +3

Query  240  KGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  419
            KG++ RGL R++++S           S  VL+LLAFGI SIP +SRGS+K HDLS+IAHN
Sbjct  4    KGRHFRGLSRKSSNSTLLFAVFIG-FSFFVLILLAFGIFSIPFTSRGSRKVHDLSSIAHN  62



>gb|KDO71356.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=265

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  413
            MAK +Y R  P R +SS+T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  414  HNTLEREEXEE  446
              ++ER E +E
Sbjct  60   RKSMERSEGDE  70



>ref|XP_006425362.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38602.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=265

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  413
            MAK +Y R  P R +SS+T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  414  HNTLEREEXEE  446
              ++ER E +E
Sbjct  60   RKSMERSEGDE  70



>gb|ACU17088.1| unknown [Glycine max]
Length=207

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGS-QKAHDLSTI  410
            MAK +Y R  PR+++SS+T    +F + + +VL+LLA GILSIPSSSRG+  K +DL++I
Sbjct  1    MAKPRYSRLPPRKSSSSSTLILTLFLVFTFLVLILLALGILSIPSSSRGNLPKPNDLASI  60

Query  411  AHNTLEREEXEEDDV  455
            A NT+     ++DDV
Sbjct  61   ARNTI--HTSDDDDV  73



>gb|KDO71351.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
 gb|KDO71352.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
 gb|KDO71353.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=288

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  413
            MAK +Y R  P R +SS+T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  414  HNTLEREEXEE  446
              ++ER E +E
Sbjct  60   RKSMERSEGDE  70



>ref|XP_006425363.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 ref|XP_006425364.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38603.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38604.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=288

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  413
            MAK +Y R  P R +SS+T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  414  HNTLEREEXEE  446
              ++ER E +E
Sbjct  60   RKSMERSEGDE  70



>ref|XP_006467023.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Citrus sinensis]
Length=288

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  413
            MAK +Y R  P R +SS+T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  414  HNTLEREEXEE  446
              ++ER E +E
Sbjct  60   RKSMERSEGDE  70



>ref|XP_003612249.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AES95207.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=289

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  413
            MAK +Y R   R+++S  T  F++F   + ++L+LL FGILSIPSS++   K +DL++I 
Sbjct  1    MAKSRYSRLPSRKSSSPYTLIFSLFIAFTFLILILLVFGILSIPSSNQNLPKPNDLTSIV  60

Query  414  HNTLEREEXEE  446
            HNT++R + EE
Sbjct  61   HNTVDRNDDEE  71



>ref|XP_003538892.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 [Glycine max]
 gb|KHN41867.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=290

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGS-QKAHDLSTI  410
            MAK +Y R  PR+++SS+T    +F + + +VL+LLA GILSIPSSSRG+  K +DL++I
Sbjct  1    MAKPRYSRLPPRKSSSSSTLILTLFLVFTFLVLILLALGILSIPSSSRGNLPKPNDLASI  60

Query  411  AHNTLEREEXEEDDV  455
            A NT+     ++DDV
Sbjct  61   ARNTI--HTSDDDDV  73



>ref|XP_004234520.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Solanum lycopersicum]
Length=289

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +3

Query  240  KGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  419
            KG++ RGL R++++S           S  VL+LLAFGI SIP +SRG +K HDLS+IAHN
Sbjct  4    KGRHFRGLSRKSSNSTLIFAVFIG-FSFFVLILLAFGIFSIPFTSRGLRKVHDLSSIAHN  62



>gb|KDO71350.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=287

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  413
            MAK +Y R  P R +SS+T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  414  HNTLEREEXE  443
              ++E E  E
Sbjct  60   RKSMESEGDE  69



>ref|XP_006467024.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Citrus sinensis]
Length=287

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  413
            MAK +Y R  P R +SS+T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  414  HNTLEREEXE  443
              ++E E  E
Sbjct  60   RKSMESEGDE  69



>ref|XP_006340784.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Solanum 
tuberosum]
Length=287

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 46/65 (71%), Gaps = 4/65 (6%)
 Frame = +3

Query  240  KGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  419
            KG++ R  PR++++S      +  +LS   L+LLAF I+SIP   RGSQKAHDL++I HN
Sbjct  4    KGRHSRMGPRKSSNSTLIFGGII-VLSFFALILLAFRIISIP---RGSQKAHDLTSIVHN  59

Query  420  TLERE  434
            T++R+
Sbjct  60   TVQRQ  64



>ref|XP_009587704.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana tomentosiformis]
Length=290

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  342  AFGILSIPSSSRGSQKAHDLSTIAHNTLEREEXE  443
            AFGI SIP SS+GSQKAHDLS+IAHNT+ R + +
Sbjct  38   AFGIFSIPFSSKGSQKAHDLSSIAHNTVGRRDDD  71



>gb|KJB43229.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
Length=225

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSS-SRGSQKAHDLSTI  410
            MAK +  R +P R +SS+T    +  + + +VL+LLA GILSIP+S SR S K +DLS+I
Sbjct  1    MAKPRLSR-VPARRSSSSTMFLTLLIMFTFLVLILLALGILSIPTSNSRSSHKPNDLSSI  59

Query  411  AHNTLEREEXEE  446
             HN +++ + +E
Sbjct  60   VHNVVDKNDYDE  71



>ref|XP_009801759.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana sylvestris]
Length=290

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  342  AFGILSIPSSSRGSQKAHDLSTIAHNTLEREEXE  443
            AFGI SIP SS+GSQKAHDLS+IAHN + R + +
Sbjct  38   AFGIFSIPFSSKGSQKAHDLSSIAHNAVGRRDDD  71



>ref|XP_010444842.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Camelina sativa]
 ref|XP_010444843.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Camelina sativa]
Length=290

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = +3

Query  312  ILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLER---EEXEEDD  452
            + + V+L+LLAFGILS+PS++ GS KA+DL++I   TL+R   ++ + DD
Sbjct  27   MFTFVILILLAFGILSVPSNNAGSSKANDLTSIVRKTLQRSGEDDSKNDD  76



>ref|XP_010465981.1| PREDICTED: probable prolyl 4-hydroxylase 10 isoform X1 [Camelina 
sativa]
 ref|XP_010465989.1| PREDICTED: probable prolyl 4-hydroxylase 10 isoform X1 [Camelina 
sativa]
 ref|XP_010465996.1| PREDICTED: probable prolyl 4-hydroxylase 10 isoform X2 [Camelina 
sativa]
Length=290

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = +3

Query  312  ILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEXEEDD  452
            + + V+L+LLAFGILS+PS++ GS KA+DL++I   TL+R    EDD
Sbjct  27   MFTFVILILLAFGILSVPSNNAGSSKANDLTSIVRKTLQRS--GEDD  71



>ref|XP_006280909.1| hypothetical protein CARUB_v10026902mg [Capsella rubella]
 gb|EOA13807.1| hypothetical protein CARUB_v10026902mg [Capsella rubella]
Length=289

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = +3

Query  318  SLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEXEEDD  452
            + V+L LLAFGILS+PS++ GS KA+DL++I   TLER    EDD
Sbjct  29   TFVILFLLAFGILSVPSNNAGSSKANDLTSIVRKTLERS--GEDD  71



>ref|XP_004291329.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Fragaria vesca subsp. 
vesca]
Length=308

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +3

Query  213  YRAYAVTMAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKA  392
            +RA A TMAKG+YGR L     S+ T   ++  +L++V+LML+AFGI+S+P SS  S   
Sbjct  15   FRARASTMAKGRYGR-LRSSKWSTFTLVLSMLFMLTVVLLMLMAFGIVSLPESSDDS-PP  72

Query  393  HDLSTIAHNTLEREE  437
            +DLS+     +ER E
Sbjct  73   NDLSSFRRRIVERSE  87



>gb|KJB43228.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
Length=266

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSS-SRGSQKAHDLSTI  410
            MAK +  R +P R +SS+T    +  + + +VL+LLA GILSIP+S SR S K +DLS+I
Sbjct  1    MAKPRLSR-VPARRSSSSTMFLTLLIMFTFLVLILLALGILSIPTSNSRSSHKPNDLSSI  59

Query  411  AHNTLEREEXEE  446
             HN +++ + +E
Sbjct  60   VHNVVDKNDYDE  71



>gb|KJB43227.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
 gb|KJB43230.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
 gb|KJB43231.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
Length=289

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSS-SRGSQKAHDLSTI  410
            MAK +  R +P R +SS+T    +  + + +VL+LLA GILSIP+S SR S K +DLS+I
Sbjct  1    MAKPRLSR-VPARRSSSSTMFLTLLIMFTFLVLILLALGILSIPTSNSRSSHKPNDLSSI  59

Query  411  AHNTLEREEXEE  446
             HN +++ + +E
Sbjct  60   VHNVVDKNDYDE  71



>ref|NP_001190630.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
 gb|AED98154.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
Length=243

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 35/45 (78%), Gaps = 2/45 (4%)
 Frame = +3

Query  318  SLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEXEEDD  452
            + V+L+LLAFGILS+PS++ GS KA+DL++I   TL+R    EDD
Sbjct  29   TFVILILLAFGILSVPSNNAGSSKANDLTSIVRKTLQR--SGEDD  71



>emb|CDP01844.1| unnamed protein product [Coffea canephora]
Length=291

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = +3

Query  240  KGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  419
            KG++ RG  R+ TSS+T  FA+F + S  +L++LA G+LS+PS+SR SQKAHDLSTIAHN
Sbjct  4    KGRHLRGPSRKATSSSTLIFAMFIMFSFFLLIMLALGLLSVPSTSRDSQKAHDLSTIAHN  63

Query  420  TLEREEXEEDD  452
            +++R   +EDD
Sbjct  64   SIDR--GDEDD  72



>ref|NP_201407.4| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
 sp|F4JZ24.1|P4H10_ARATH RecName: Full=Probable prolyl 4-hydroxylase 10; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED98153.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
Length=289

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 35/45 (78%), Gaps = 2/45 (4%)
 Frame = +3

Query  318  SLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEXEEDD  452
            + V+L+LLAFGILS+PS++ GS KA+DL++I   TL+R    EDD
Sbjct  29   TFVILILLAFGILSVPSNNAGSSKANDLTSIVRKTLQR--SGEDD  71



>dbj|BAB10411.1| prolyl 4-hydroxylase, alpha subunit-like protein [Arabidopsis 
thaliana]
Length=267

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 35/45 (78%), Gaps = 2/45 (4%)
 Frame = +3

Query  318  SLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEXEEDD  452
            + V+L+LLAFGILS+PS++ GS KA+DL++I   TL+R    EDD
Sbjct  29   TFVILILLAFGILSVPSNNAGSSKANDLTSIVRKTLQR--SGEDD  71



>ref|XP_004232524.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Solanum lycopersicum]
Length=287

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 4/65 (6%)
 Frame = +3

Query  240  KGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  419
            KG++ R  PR++++S      +  +LS   L+LLAF I+S     RGSQKAHDL++IAHN
Sbjct  4    KGRHSRLGPRKSSNSTLIFGGII-VLSFFALILLAFRIISF---HRGSQKAHDLTSIAHN  59

Query  420  TLERE  434
            T++R+
Sbjct  60   TVQRQ  64



>ref|XP_002866777.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43036.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=266

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  318  SLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLER  431
            + V+L+LLAFGILS+PS++ GS KA+DL++I   TL+R
Sbjct  28   TFVILILLAFGILSVPSNNAGSSKANDLTSIVRKTLQR  65



>ref|XP_004512179.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004512180.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Cicer arietinum]
Length=292

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 5/75 (7%)
 Frame = +3

Query  234  MAKGKYGRGLPRRttssattafavfaIL--SLVVLMLLAFGILSIPSSS--RGSQKAHDL  401
            MAK +Y R LP R  SS++        +  + ++L+LL FGILSIP++S  +   K +DL
Sbjct  1    MAKPRYSR-LPYRKPSSSSYTIIFALFIAFTFLILILLVFGILSIPTTSSRQNLPKPNDL  59

Query  402  STIAHNTLEREEXEE  446
            ++IAHNT++R + EE
Sbjct  60   TSIAHNTVDRIDEEE  74



>gb|EPS63604.1| iron ion binding / oxidoreductase/ oxidoreductase protein, partial 
[Genlisea aurea]
Length=283

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 8/75 (11%)
 Frame = +3

Query  225  AVTMAKGKYGRGLPRRttssattafavfaILSLVVLMLLAFGILSIPSSSRGSQKAHDLS  404
            AV   +  YG+  PR+ +           ILS VV + ++ G+LSI SS+  S +AHDL+
Sbjct  2    AVKGTRQFYGKAAPRKVSYGMI-------ILSFVVFVFISLGLLSI-SSTEYSPEAHDLN  53

Query  405  TIAHNTLEREEXEED  449
             IAH ++ R+E EED
Sbjct  54   AIAHGSVLRDELEED  68



>ref|XP_006393794.1| hypothetical protein EUTSA_v10004714mg [Eutrema salsugineum]
 gb|ESQ31080.1| hypothetical protein EUTSA_v10004714mg [Eutrema salsugineum]
Length=289

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  312  ILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLER  431
            + + V+L LLA GILS+PS++ GS KA+DL++I   TL+R
Sbjct  27   MFTFVILFLLALGILSLPSNNAGSSKANDLTSIVRKTLQR  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566299029105