BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF011C12

Length=279
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAF65513.1|  GTP-binding protein                                   93.2    2e-20   Capsicum annuum
ref|XP_004231561.1|  PREDICTED: obg-like ATPase 1                     93.2    2e-20   Solanum lycopersicum
ref|XP_001776504.1|  predicted protein                                93.2    2e-20   
ref|XP_006360314.1|  PREDICTED: obg-like ATPase 1-like                91.7    9e-20   Solanum tuberosum [potatoes]
ref|XP_010098556.1|  Obg-like ATPase 1                                90.9    2e-19   Morus notabilis
ref|XP_006448885.1|  hypothetical protein CICLE_v10015175mg           91.3    2e-19   
ref|XP_011015196.1|  PREDICTED: obg-like ATPase 1                     90.5    2e-19   Populus euphratica
ref|XP_004293982.1|  PREDICTED: obg-like ATPase 1                     90.1    3e-19   Fragaria vesca subsp. vesca
ref|XP_007022926.1|  GTP binding                                      90.1    3e-19   Theobroma cacao [chocolate]
ref|XP_002523184.1|  GTP-dependent nucleic acid-binding protein e...  90.1    3e-19   Ricinus communis
gb|KJB69092.1|  hypothetical protein B456_011G005000                  89.7    3e-19   Gossypium raimondii
gb|AFK48623.1|  unknown                                               90.1    3e-19   Lotus japonicus
gb|KCW75747.1|  hypothetical protein EUGRSUZ_D00127                   89.4    4e-19   Eucalyptus grandis [rose gum]
gb|KHF97630.1|  Obg-like ATPase 1                                     89.7    4e-19   Gossypium arboreum [tree cotton]
gb|KJB69089.1|  hypothetical protein B456_011G005000                  89.7    4e-19   Gossypium raimondii
gb|KJB69091.1|  hypothetical protein B456_011G005000                  89.4    4e-19   Gossypium raimondii
ref|XP_010051911.1|  PREDICTED: obg-like ATPase 1                     89.7    4e-19   Eucalyptus grandis [rose gum]
emb|CDP17295.1|  unnamed protein product                              89.4    6e-19   Coffea canephora [robusta coffee]
ref|XP_011085197.1|  PREDICTED: obg-like ATPase 1                     89.4    6e-19   Sesamum indicum [beniseed]
ref|XP_011037748.1|  PREDICTED: obg-like ATPase 1                     89.0    7e-19   Populus euphratica
ref|XP_006377958.1|  hypothetical protein POPTR_0011s16690g           89.0    7e-19   Populus trichocarpa [western balsam poplar]
gb|KDO75237.1|  hypothetical protein CISIN_1g015465mg                 88.2    9e-19   Citrus sinensis [apfelsine]
gb|KDP34925.1|  hypothetical protein JCGZ_09213                       88.6    1e-18   Jatropha curcas
ref|NP_001242520.1|  uncharacterized protein LOC100793501             88.6    1e-18   Glycine max [soybeans]
ref|XP_003546267.1|  PREDICTED: obg-like ATPase 1-like                88.6    1e-18   Glycine max [soybeans]
ref|XP_004135546.1|  PREDICTED: obg-like ATPase 1-like                88.6    1e-18   Cucumis sativus [cucumbers]
gb|KDO75236.1|  hypothetical protein CISIN_1g015465mg                 88.6    1e-18   Citrus sinensis [apfelsine]
ref|XP_010245345.1|  PREDICTED: obg-like ATPase 1                     88.6    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_008445378.1|  PREDICTED: obg-like ATPase 1                     88.6    1e-18   Cucumis melo [Oriental melon]
emb|CAN63158.1|  hypothetical protein VITISV_035841                   84.7    1e-18   Vitis vinifera
ref|XP_009603694.1|  PREDICTED: obg-like ATPase 1 {ECO:0000255|HA...  88.2    1e-18   Nicotiana tomentosiformis
gb|KJB69090.1|  hypothetical protein B456_011G005000                  87.8    1e-18   Gossypium raimondii
ref|XP_002300568.1|  hypothetical protein POPTR_0001s47010g           88.2    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009362223.1|  PREDICTED: obg-like ATPase 1                     88.2    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_008225608.1|  PREDICTED: obg-like ATPase 1                     88.2    2e-18   Prunus mume [ume]
gb|EYU43227.1|  hypothetical protein MIMGU_mgv1a007827mg              88.2    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_008383389.1|  PREDICTED: obg-like ATPase 1                     87.8    2e-18   Malus domestica [apple tree]
gb|KDO75234.1|  hypothetical protein CISIN_1g015465mg                 87.8    2e-18   Citrus sinensis [apfelsine]
ref|XP_008372236.1|  PREDICTED: obg-like ATPase 1                     87.8    2e-18   Malus domestica [apple tree]
ref|XP_006468322.1|  PREDICTED: obg-like ATPase 1-like                87.8    2e-18   Citrus sinensis [apfelsine]
ref|XP_006448884.1|  hypothetical protein CICLE_v10015175mg           87.8    2e-18   
ref|XP_004486463.1|  PREDICTED: obg-like ATPase 1-like                87.8    2e-18   Cicer arietinum [garbanzo]
ref|XP_007211399.1|  hypothetical protein PRUPE_ppa006821mg           87.8    2e-18   Prunus persica
gb|KDO75238.1|  hypothetical protein CISIN_1g015465mg                 86.7    2e-18   Citrus sinensis [apfelsine]
ref|XP_011039799.1|  PREDICTED: obg-like ATPase 1                     87.4    3e-18   Populus euphratica
ref|XP_002263885.1|  PREDICTED: obg-like ATPase 1                     87.4    3e-18   Vitis vinifera
ref|XP_007147477.1|  hypothetical protein PHAVU_006G127800g           87.0    4e-18   Phaseolus vulgaris [French bean]
ref|XP_006845995.1|  hypothetical protein AMTR_s00155p00051130        85.9    4e-18   
ref|XP_010687083.1|  PREDICTED: obg-like ATPase 1                     87.0    5e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009803590.1|  PREDICTED: obg-like ATPase 1                     86.7    6e-18   Nicotiana sylvestris
ref|XP_003594539.1|  Obg-like ATPase                                  86.3    7e-18   Medicago truncatula
gb|KEH37060.1|  50S ribosome-binding GTPase                           84.7    7e-18   Medicago truncatula
gb|ACJ85184.1|  unknown                                               86.3    9e-18   Medicago truncatula
gb|AFK49195.1|  unknown                                               86.3    9e-18   Medicago truncatula
ref|XP_008812127.1|  PREDICTED: obg-like ATPase 1                     85.1    2e-17   
ref|XP_010519060.1|  PREDICTED: obg-like ATPase 1                     84.7    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_008777315.1|  PREDICTED: obg-like ATPase 1                     80.9    1e-16   
ref|XP_009412029.1|  PREDICTED: obg-like ATPase 1                     82.8    1e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799072.1|  PREDICTED: obg-like ATPase 1                     82.8    2e-16   Phoenix dactylifera
ref|XP_010941555.1|  PREDICTED: obg-like ATPase 1                     82.8    2e-16   
gb|EPS61253.1|  hypothetical protein M569_13545                       81.3    2e-16   Genlisea aurea
ref|XP_010926935.1|  PREDICTED: obg-like ATPase 1                     80.9    8e-16   Elaeis guineensis
gb|ABK25108.1|  unknown                                               80.9    8e-16   Picea sitchensis
gb|EEC83063.1|  hypothetical protein OsI_28170                        79.7    2e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001061206.2|  Os08g0199300                                     79.3    3e-15   
gb|EMT28525.1|  Obg-like ATPase 1                                     79.0    4e-15   
ref|XP_006659204.1|  PREDICTED: obg-like ATPase 1-like                79.0    4e-15   Oryza brachyantha
gb|EMS48297.1|  Obg-like ATPase 1                                     79.0    4e-15   Triticum urartu
emb|CDM85617.1|  unnamed protein product                              78.6    5e-15   Triticum aestivum [Canadian hard winter wheat]
gb|KFK44867.1|  hypothetical protein AALP_AA1G312800                  78.6    6e-15   Arabis alpina [alpine rockcress]
ref|XP_010478480.1|  PREDICTED: obg-like ATPase 1                     77.8    1e-14   Camelina sativa [gold-of-pleasure]
ref|NP_174346.1|  GTP-binding protein                                 77.8    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305006.1|  hypothetical protein CARUB_v10009370mg           77.8    1e-14   Capsella rubella
gb|AAM63059.1|  putative GTP-binding protein                          77.8    1e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CDX77584.1|  BnaA07g07220D                                        77.4    1e-14   
emb|CDY12460.1|  BnaC08g09490D                                        77.4    1e-14   Brassica napus [oilseed rape]
ref|XP_006415450.1|  hypothetical protein EUTSA_v10007733mg           77.8    1e-14   
emb|CDX98216.1|  BnaC07g08820D                                        77.4    1e-14   
ref|XP_009107765.1|  PREDICTED: obg-like ATPase 1                     77.4    1e-14   Brassica rapa
ref|XP_002893634.1|  GTP binding protein                              77.4    1e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_010499597.1|  PREDICTED: obg-like ATPase 1                     77.4    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009115125.1|  PREDICTED: obg-like ATPase 1                     77.0    2e-14   Brassica rapa
ref|XP_010460862.1|  PREDICTED: obg-like ATPase 1                     75.9    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_003573525.1|  PREDICTED: obg-like ATPase 1                     75.5    7e-14   Brachypodium distachyon [annual false brome]
emb|CDY02308.1|  BnaA09g25940D                                        75.5    7e-14   
ref|XP_004972629.1|  PREDICTED: obg-like ATPase 1-like                74.7    1e-13   Setaria italica
ref|XP_002445191.1|  hypothetical protein SORBIDRAFT_07g005700        73.9    3e-13   Sorghum bicolor [broomcorn]
ref|XP_009144765.1|  PREDICTED: obg-like ATPase 1                     73.2    5e-13   Brassica rapa
gb|AFW56960.1|  hypothetical protein ZEAMMB73_810066                  72.8    5e-13   
ref|XP_005650863.1|  flagellar associated protein                     73.2    6e-13   Coccomyxa subellipsoidea C-169
ref|NP_001150211.1|  GTP-binding protein PTD004                       73.2    6e-13   Zea mays [maize]
emb|CDY09558.1|  BnaC05g23610D                                        69.3    1e-11   Brassica napus [oilseed rape]
ref|XP_010538270.1|  PREDICTED: obg-like ATPase 1                     67.8    5e-11   Tarenaya hassleriana [spider flower]
gb|KDD75506.1|  DUF933 hypothetical protein                           67.0    8e-11   Helicosporidium sp. ATCC 50920
gb|AGF69175.1|  putative GTP-binding protein                          65.5    8e-11   Triticum aestivum [Canadian hard winter wheat]
gb|EMT28526.1|  Obg-like ATPase 1                                     65.9    2e-10   
ref|XP_002985543.1|  hypothetical protein SELMODRAFT_234816           65.9    2e-10   Selaginella moellendorffii
ref|XP_001699763.1|  flagellar associated protein                     65.5    3e-10   Chlamydomonas reinhardtii
ref|XP_002953429.1|  hypothetical protein VOLCADRAFT_105955           65.5    3e-10   Volvox carteri f. nagariensis
gb|KIY94771.1|  hypothetical protein MNEG_13192                       61.6    4e-10   Monoraphidium neglectum
ref|XP_008397269.1|  PREDICTED: obg-like ATPase 1 isoform X1          63.9    1e-09   Poecilia reticulata
ref|XP_008397279.1|  PREDICTED: obg-like ATPase 1 isoform X2          63.5    1e-09   
ref|XP_007546548.1|  PREDICTED: obg-like ATPase 1                     63.5    1e-09   Poecilia formosa
ref|XP_005716907.1|  GTP-binding protein of Obg family                63.2    2e-09   Chondrus crispus [carageen]
ref|XP_006636566.1|  PREDICTED: obg-like ATPase 1-like isoform X1     63.2    2e-09   Lepisosteus oculatus
ref|XP_006788528.1|  PREDICTED: obg-like ATPase 1-like                63.2    2e-09   Neolamprologus brichardi [lyretail cichlid]
ref|XP_003961956.1|  PREDICTED: obg-like ATPase 1-like                62.8    3e-09   Takifugu rubripes [tiger puffer]
ref|XP_008297045.1|  PREDICTED: obg-like ATPase 1                     62.4    4e-09   Stegastes partitus
ref|XP_005723544.1|  PREDICTED: obg-like ATPase 1-like isoform X1     62.4    4e-09   Pundamilia nyererei
gb|KII61429.1|  Obg-like ATPase 1                                     59.3    8e-09   Thelohanellus kitauei
ref|XP_010884736.1|  PREDICTED: obg-like ATPase 1                     61.2    8e-09   
ref|NP_001008044.1|  obg-like ATPase 1                                61.2    1e-08   Xenopus tropicalis [western clawed frog]
emb|CAJ83205.1|  novel protein similar to GTP-binding protein PTD004  61.2    1e-08   Xenopus tropicalis [western clawed frog]
ref|XP_006003587.1|  PREDICTED: obg-like ATPase 1 isoform X1          60.8    1e-08   Latimeria chalumnae
ref|NP_001079680.1|  obg-like ATPase 1                                60.8    1e-08   Xenopus laevis [clawed frog]
ref|NP_999865.1|  obg-like ATPase 1 isoform 1                         60.5    1e-08   Danio rerio [leopard danio]
ref|XP_001186941.1|  PREDICTED: obg-like ATPase 1-like                59.7    2e-08   
ref|XP_797209.1|  PREDICTED: obg-like ATPase 1-like                   60.1    2e-08   
ref|XP_009296560.1|  PREDICTED: obg-like ATPase 1                     57.4    2e-08   
ref|XP_006003588.1|  PREDICTED: obg-like ATPase 1 isoform X2          60.1    2e-08   Latimeria chalumnae
gb|EMS17306.1|  GTP-binding protein                                   60.1    2e-08   Entamoeba histolytica HM-3:IMSS
ref|XP_008310339.1|  PREDICTED: obg-like ATPase 1                     60.1    2e-08   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_657513.1|  GTP-binding protein                                 59.7    3e-08   Entamoeba histolytica HM-1:IMSS
ref|XP_001741184.1|  hypothetical protein                             59.7    3e-08   Entamoeba dispar SAW760
ref|XP_008860136.1|  GTP-binding protein YchF protein                 59.7    3e-08   Entamoeba nuttalli P19
ref|XP_005535678.1|  GTP-binding protein of Obg family                59.3    4e-08   Cyanidioschyzon merolae strain 10D
gb|KFO72251.1|  Obg-like ATPase 1                                     59.3    4e-08   Cuculus canorus
ref|NP_001158828.1|  obg-like ATPase 1                                59.3    5e-08   Salmo salar
gb|AAH77496.1|  Ola1 protein                                          58.2    5e-08   Xenopus laevis [clawed frog]
ref|XP_010793340.1|  PREDICTED: obg-like ATPase 1                     58.9    6e-08   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007576845.1|  PREDICTED: obg-like ATPase 1                     58.9    6e-08   Poecilia formosa
ref|XP_006798459.1|  PREDICTED: obg-like ATPase 1-like                58.9    6e-08   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005798398.1|  PREDICTED: obg-like ATPase 1-like                58.9    6e-08   Xiphophorus maculatus
ref|XP_005723778.1|  PREDICTED: obg-like ATPase 1-like                58.9    6e-08   Pundamilia nyererei
ref|XP_003442972.1|  PREDICTED: obg-like ATPase 1-like                58.9    6e-08   Oreochromis niloticus
ref|XP_008275154.1|  PREDICTED: obg-like ATPase 1                     58.9    6e-08   Stegastes partitus
ref|XP_008397950.1|  PREDICTED: obg-like ATPase 1                     58.9    6e-08   Poecilia reticulata
gb|KFP77737.1|  Obg-like ATPase 1                                     58.2    7e-08   Acanthisitta chloris
ref|XP_010736092.1|  PREDICTED: obg-like ATPase 1 isoform X1          58.5    7e-08   Larimichthys crocea [croceine croaker]
ref|XP_008326510.1|  PREDICTED: obg-like ATPase 1 isoform X2          58.5    7e-08   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005452973.1|  PREDICTED: obg-like ATPase 1-like isoform X4     58.5    8e-08   Oreochromis niloticus
ref|XP_009553897.1|  PREDICTED: obg-like ATPase 1                     58.5    8e-08   Cuculus canorus
ref|XP_001728946.1|  hypothetical protein MGL_3940                    58.5    9e-08   Malassezia globosa CBS 7966
ref|XP_002198993.1|  PREDICTED: obg-like ATPase 1 isoform 1           58.5    9e-08   Taeniopygia guttata
ref|XP_007512524.1|  predicted protein                                58.5    9e-08   Bathycoccus prasinos
ref|XP_003962811.1|  PREDICTED: obg-like ATPase 1-like                58.2    1e-07   Takifugu rubripes [tiger puffer]
ref|XP_005703761.1|  GTP-binding protein                              58.2    1e-07   Galdieria sulphuraria
ref|XP_004557801.1|  PREDICTED: obg-like ATPase 1-like isoform X1     58.2    1e-07   Maylandia zebra
ref|XP_011488562.1|  PREDICTED: obg-like ATPase 1                     56.2    1e-07   
ref|XP_002396842.1|  hypothetical protein MPER_02840                  55.1    1e-07   
ref|XP_010564826.1|  PREDICTED: obg-like ATPase 1                     58.2    1e-07   Haliaeetus leucocephalus
ref|XP_009680050.1|  PREDICTED: obg-like ATPase 1                     58.2    1e-07   Struthio camelus australis
ref|XP_005519864.1|  PREDICTED: obg-like ATPase 1 isoform X1          58.2    1e-07   
ref|XP_005152654.1|  PREDICTED: obg-like ATPase 1                     58.2    1e-07   Melopsittacus undulatus
ref|XP_008503320.1|  PREDICTED: obg-like ATPase 1                     57.8    1e-07   Calypte anna
emb|CAG09966.1|  unnamed protein product                              57.8    1e-07   Tetraodon nigroviridis
ref|XP_009070315.1|  PREDICTED: obg-like ATPase 1                     57.8    1e-07   Acanthisitta chloris
ref|XP_005049114.1|  PREDICTED: obg-like ATPase 1                     57.8    1e-07   Ficedula albicollis
ref|XP_009639084.1|  PREDICTED: obg-like ATPase 1                     57.8    2e-07   Egretta garzetta
ref|XP_007430998.1|  PREDICTED: obg-like ATPase 1-like isoform X1     57.8    2e-07   Python bivittatus
gb|ELK32737.1|  Obg-like ATPase 1                                     57.8    2e-07   Myotis davidii
ref|XP_009955691.1|  PREDICTED: obg-like ATPase 1                     55.1    2e-07   Leptosomus discolor
ref|XP_003764019.1|  PREDICTED: obg-like ATPase 1                     57.4    2e-07   Sarcophilus harrisii
ref|XP_005723545.1|  PREDICTED: obg-like ATPase 1-like isoform X2     57.4    2e-07   
gb|EKF26595.1|  GTP-binding protein, putative                         57.4    2e-07   Trypanosoma cruzi marinkellei
ref|XP_005300475.1|  PREDICTED: obg-like ATPase 1 isoform X2          57.4    2e-07   Chrysemys picta bellii
emb|CDQ81805.1|  unnamed protein product                              57.4    2e-07   Oncorhynchus mykiss
ref|XP_006825853.1|  PREDICTED: obg-like ATPase 1-like                57.0    2e-07   Saccoglossus kowalevskii
gb|ACO09273.1|  GTP-binding protein PTD004                            57.0    2e-07   Osmerus mordax
ref|NP_001040339.1|  GTP binding protein                              57.0    3e-07   Bombyx mori [silk moth]
ref|XP_010878191.1|  PREDICTED: obg-like ATPase 1 isoform X3          57.0    3e-07   Esox lucius
ref|XP_004577108.1|  PREDICTED: obg-like ATPase 1 isoform X3          56.6    3e-07   
emb|CDQ57167.1|  unnamed protein product                              57.0    3e-07   Oncorhynchus mykiss
ref|XP_008933239.1|  PREDICTED: obg-like ATPase 1                     57.0    3e-07   Merops nubicus
ref|XP_007248906.1|  PREDICTED: obg-like ATPase 1-like                57.0    3e-07   Astyanax mexicanus [blind cave fish]
ref|XP_006275602.1|  PREDICTED: obg-like ATPase 1-like isoform X2     56.6    3e-07   Alligator mississippiensis
gb|AAO26205.1|  GTP-binding protein                                   56.6    3e-07   Trypanosoma cruzi
ref|XP_008685352.1|  PREDICTED: obg-like ATPase 1                     56.6    3e-07   Ursus maritimus [white bear]
ref|XP_006020859.1|  PREDICTED: obg-like ATPase 1                     56.6    3e-07   Alligator sinensis
ref|XP_002407922.1|  GTP-binding protein, putative                    56.6    3e-07   Ixodes scapularis [blacklegged tick]
emb|CEI98922.1|  Putative GTP-binding protein YchF                    56.6    3e-07   Rhizopus microsporus
ref|XP_010226941.1|  PREDICTED: obg-like ATPase 1                     55.5    3e-07   Tinamus guttatus
ref|XP_010291164.1|  PREDICTED: obg-like ATPase 1                     55.5    3e-07   Phaethon lepturus
gb|EHJ68331.1|  GTP binding protein                                   57.4    4e-07   
ref|XP_008216612.1|  PREDICTED: obg-like ATPase 1                     56.6    4e-07   Nasonia vitripennis
ref|XP_010747153.1|  PREDICTED: obg-like ATPase 1                     56.6    4e-07   
ref|XP_003372802.1|  GTP-dependent nucleic acid-binding protein EngD  56.6    4e-07   Trichinella spiralis
ref|XP_006116548.1|  PREDICTED: obg-like ATPase 1 isoform X3          56.6    4e-07   
ref|XP_005818302.1|  hypothetical protein GUITHDRAFT_159055           56.2    4e-07   Guillardia theta CCMP2712
ref|XP_011307687.1|  PREDICTED: obg-like ATPase 1                     56.2    4e-07   Fopius arisanus
gb|EFB23886.1|  hypothetical protein PANDA_008995                     55.1    4e-07   Ailuropoda melanoleuca
ref|XP_001515633.1|  PREDICTED: obg-like ATPase 1 isoform X1          56.2    5e-07   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_010159477.1|  PREDICTED: obg-like ATPase 1                     55.1    5e-07   Eurypyga helias
ref|XP_001368232.1|  PREDICTED: Obg-like ATPase 1                     56.2    5e-07   Monodelphis domestica
ref|XP_007430999.1|  PREDICTED: obg-like ATPase 1-like isoform X2     56.2    5e-07   Python bivittatus
ref|XP_817773.1|  GTP-binding protein                                 56.2    5e-07   Trypanosoma cruzi strain CL Brener
gb|ESS62262.1|  GTP-binding protein                                   56.2    5e-07   Trypanosoma cruzi Dm28c
gb|EKG08395.1|  hypothetical protein TCSYLVIO_000468                  56.2    5e-07   Trypanosoma cruzi
ref|XP_813495.1|  GTP-binding protein                                 56.2    5e-07   Trypanosoma cruzi strain CL Brener
ref|XP_004004627.1|  PREDICTED: obg-like ATPase 1                     56.2    5e-07   
ref|XP_003225685.1|  PREDICTED: obg-like ATPase 1 isoform X1          56.2    6e-07   Anolis carolinensis [Carolina anole]
ref|XP_005182762.2|  PREDICTED: obg-like ATPase 1                     56.2    6e-07   Musca domestica
ref|XP_009050807.1|  hypothetical protein LOTGIDRAFT_151663           55.8    6e-07   Lottia gigantea
gb|EPY89072.1|  hypothetical protein CB1_000138040                    53.5    6e-07   Camelus ferus
ref|XP_005099946.1|  PREDICTED: obg-like ATPase 1-like isoform X1     55.8    6e-07   
ref|XP_004703788.1|  PREDICTED: obg-like ATPase 1 isoform X2          55.8    6e-07   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004375552.1|  PREDICTED: obg-like ATPase 1                     55.8    6e-07   
ref|XP_005857658.1|  PREDICTED: obg-like ATPase 1                     55.8    6e-07   
ref|XP_010350251.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...  56.2    6e-07   Saimiri boliviensis boliviensis
ref|XP_008136765.1|  PREDICTED: obg-like ATPase 1 isoform X1          55.8    6e-07   Eptesicus fuscus
ref|XP_004703787.1|  PREDICTED: obg-like ATPase 1 isoform X1          55.8    7e-07   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004634806.1|  PREDICTED: obg-like ATPase 1 isoform X2          55.8    7e-07   
ref|XP_001421839.1|  predicted protein                                55.8    7e-07   Ostreococcus lucimarinus CCE9901
ref|XP_006878885.1|  PREDICTED: obg-like ATPase 1-like                55.8    7e-07   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006204987.1|  PREDICTED: obg-like ATPase 1-like                53.5    7e-07   Vicugna pacos
ref|NP_001029099.1|  obg-like ATPase 1                                55.8    7e-07   Rattus norvegicus [brown rat]
gb|ELR47977.1|  Obg-like ATPase 1                                     55.8    7e-07   Bos mutus
gb|EGV95685.1|  Obg-like ATPase 1                                     55.1    7e-07   Cricetulus griseus [Chinese hamsters]
ref|XP_004634805.1|  PREDICTED: obg-like ATPase 1 isoform X1          55.8    7e-07   Octodon degus
gb|EFX64851.1|  hypothetical protein DAPPUDRAFT_333762                55.8    7e-07   Daphnia pulex
dbj|BAB27201.1|  unnamed protein product                              55.8    7e-07   Mus musculus [mouse]
ref|XP_005300476.1|  PREDICTED: obg-like ATPase 1 isoform X3          55.8    7e-07   Chrysemys picta bellii
ref|XP_004601223.1|  PREDICTED: obg-like ATPase 1 isoform X2          55.5    7e-07   Sorex araneus [Eurasian shrew]
ref|XP_005324665.1|  PREDICTED: obg-like ATPase 1 isoform X2          55.5    8e-07   
ref|XP_004409047.1|  PREDICTED: obg-like ATPase 1 isoform 2           55.5    8e-07   Odobenus rosmarus divergens
ref|XP_006116549.1|  PREDICTED: obg-like ATPase 1 isoform X4          55.8    8e-07   
ref|XP_006866713.1|  PREDICTED: obg-like ATPase 1 isoform X1          55.5    8e-07   Chrysochloris asiatica
ref|XP_005907299.1|  PREDICTED: obg-like ATPase 1                     55.5    8e-07   Bos mutus
ref|NP_001153863.1|  Obg-like ATPase 1                                55.5    8e-07   Acyrthosiphon pisum
ref|XP_007183357.1|  PREDICTED: obg-like ATPase 1                     55.5    8e-07   Balaenoptera acutorostrata scammoni
dbj|BAE39543.1|  unnamed protein product                              55.5    8e-07   Mus musculus [mouse]
tpg|DAA13236.1|  TPA: Obg-like ATPase 1-like                          55.5    8e-07   Bos taurus [bovine]
gb|EDL79133.1|  similar to RIKEN cDNA 2810409H07, isoform CRA_a       55.5    8e-07   Rattus norvegicus [brown rat]
ref|XP_004674579.1|  PREDICTED: obg-like ATPase 1 isoform X2          55.5    8e-07   
ref|XP_011355667.1|  PREDICTED: obg-like ATPase 1 isoform X1          55.5    8e-07   Pteropus vampyrus
ref|XP_007527277.1|  PREDICTED: obg-like ATPase 1 isoform X1          55.5    8e-07   Erinaceus europaeus [common hedgehog]
ref|NP_080218.1|  obg-like ATPase 1 isoform a                         55.5    8e-07   Mus musculus [mouse]
gb|ELW67716.1|  Myosin regulatory light polypeptide 9                 55.1    8e-07   Tupaia chinensis
ref|NP_001039510.1|  obg-like ATPase 1                                55.5    8e-07   Bos taurus [bovine]
ref|XP_007451126.1|  PREDICTED: obg-like ATPase 1 isoform X1          55.5    8e-07   Lipotes vexillifer [baiji]
ref|XP_005676004.1|  PREDICTED: obg-like ATPase 1                     55.5    8e-07   
ref|XP_004601222.1|  PREDICTED: obg-like ATPase 1 isoform X1          55.5    8e-07   Sorex araneus [Eurasian shrew]
ref|XP_003406265.1|  PREDICTED: obg-like ATPase 1                     55.5    8e-07   Loxodonta africana [African bush elephant]
emb|CAB66481.1|  hypothetical protein                                 55.5    8e-07   Homo sapiens [man]
ref|XP_004341541.1|  GTP binding protein                              55.5    8e-07   Acanthamoeba castellanii str. Neff
gb|AAD44500.1|  homologous yeast-44.2 protein                         55.5    8e-07   Homo sapiens [man]
ref|XP_004674578.1|  PREDICTED: obg-like ATPase 1 isoform X1          55.5    8e-07   Condylura cristata
ref|NP_037473.3|  obg-like ATPase 1 isoform 1                         55.5    8e-07   Homo sapiens [man]
ref|XP_003478641.1|  PREDICTED: obg-like ATPase 1                     55.5    8e-07   Cavia porcellus [guinea pig]
ref|XP_003474516.1|  PREDICTED: obg-like ATPase 1-like                55.5    8e-07   
ref|XP_003253776.1|  PREDICTED: obg-like ATPase 1 isoform 1           55.5    8e-07   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_001499403.1|  PREDICTED: Obg-like ATPase 1 isoformX1           55.5    8e-07   Equus caballus [domestic horse]
ref|XP_010831175.1|  PREDICTED: obg-like ATPase 1                     55.5    9e-07   Bison bison bison
gb|KFO22378.1|  Obg-like ATPase 1                                     55.5    9e-07   Fukomys damarensis [Damara mole rat]
ref|XP_008853504.1|  PREDICTED: obg-like ATPase 1                     55.5    9e-07   Nannospalax galili
ref|XP_005346631.1|  PREDICTED: obg-like ATPase 1                     55.5    9e-07   Microtus ochrogaster [prairie voles]
ref|XP_004857751.1|  PREDICTED: obg-like ATPase 1-like                55.5    9e-07   Heterocephalus glaber [naked mole rat]
ref|XP_004476856.1|  PREDICTED: obg-like ATPase 1 isoform 2           55.5    9e-07   Dasypus novemcinctus
dbj|BAE35446.1|  unnamed protein product                              55.5    9e-07   Mus musculus [mouse]
ref|XP_010605331.1|  PREDICTED: obg-like ATPase 1 isoform X1          55.5    9e-07   Fukomys damarensis [Damara mole rat]
ref|XP_008996931.1|  PREDICTED: obg-like ATPase 1 isoform X1          55.5    9e-07   
ref|XP_006972493.1|  PREDICTED: obg-like ATPase 1                     55.5    9e-07   Peromyscus maniculatus bairdii
ref|XP_850320.2|  PREDICTED: LOW QUALITY PROTEIN: Obg-like ATPase...  55.5    9e-07   
ref|NP_001127505.1|  obg-like ATPase 1                                55.5    9e-07   Pongo abelii [orang utan]
ref|NP_001270427.1|  uncharacterized protein LOC101926459             55.5    9e-07   Macaca fascicularis [crab eating macaque]
ref|XP_004092019.1|  PREDICTED: obg-like ATPase 1 isoform 3           55.5    9e-07   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_007060593.1|  PREDICTED: obg-like ATPase 1                     55.5    9e-07   
emb|CDH53583.1|  gtp-binding protein                                  55.5    9e-07   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_010858116.1|  PREDICTED: obg-like ATPase 1 isoform X2          55.5    1e-06   Bison bison bison
ref|XP_001466463.1|  putative GTP binding protein                     55.5    1e-06   Leishmania infantum JPCM5
ref|XP_004908585.1|  PREDICTED: obg-like ATPase 1-like                53.1    1e-06   
gb|ERE71974.1|  obg-like ATPase 1-like protein                        55.5    1e-06   Cricetulus griseus [Chinese hamsters]
gb|EKC37590.1|  Obg-like ATPase 1                                     55.5    1e-06   Crassostrea gigas
gb|EHH54959.1|  hypothetical protein EGM_04072                        55.5    1e-06   Macaca fascicularis [crab eating macaque]
ref|XP_002920288.2|  PREDICTED: obg-like ATPase 1 isoform X1          53.9    1e-06   Ailuropoda melanoleuca
gb|AEH16630.1|  GTPase                                                55.1    1e-06   Helicoverpa armigera [American bollworm]
gb|ABG67106.1|  GTP-binding protein PTD004                            52.8    1e-06   Bos taurus [bovine]
ref|XP_004267372.1|  PREDICTED: obg-like ATPase 1 isoform 1           55.1    1e-06   Orcinus orca [Orca]
ref|XP_004032861.1|  PREDICTED: obg-like ATPase 1-like isoform 1      55.1    1e-06   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_011213430.1|  PREDICTED: obg-like ATPase 1                     55.1    1e-06   
ref|XP_002605213.1|  hypothetical protein BRAFLDRAFT_114616           55.1    1e-06   
ref|XP_002023062.1|  GL16374                                          54.7    1e-06   
emb|CEG00523.1|  P-loop containing nucleoside triphosphate hydrolase  54.7    2e-06   
gb|AAY14779.1|  unknown                                               52.8    2e-06   
gb|EFN60680.1|  Uncharacterized protein C6orf224                      55.5    2e-06   
ref|XP_004032863.1|  PREDICTED: obg-like ATPase 1-like isoform 3      54.7    2e-06   
ref|XP_004476855.1|  PREDICTED: obg-like ATPase 1 isoform 1           54.7    2e-06   
ref|XP_008526497.1|  PREDICTED: obg-like ATPase 1                     52.8    2e-06   
gb|ERE71973.1|  obg-like ATPase 1-like protein                        55.5    2e-06   
gb|KFM79040.1|  GTP-binding protein                                   54.3    2e-06   
gb|KDN53278.1|  hypothetical protein K437DRAFT_253298                 54.7    2e-06   
gb|ETE71660.1|  Obg-like ATPase 1                                     54.3    2e-06   
ref|XP_011267424.1|  PREDICTED: obg-like ATPase 1                     54.3    2e-06   
ref|XP_001354398.2|  GA12352                                          54.3    2e-06   
ref|XP_010959009.1|  PREDICTED: obg-like ATPase 1                     54.3    2e-06   
ref|XP_011436819.1|  PREDICTED: obg-like ATPase 1                     54.3    2e-06   
emb|CEP12926.1|  hypothetical protein                                 54.3    2e-06   
ref|XP_010712062.1|  PREDICTED: obg-like ATPase 1                     52.0    2e-06   
ref|XP_006174828.1|  PREDICTED: obg-like ATPase 1 isoform X1          54.3    2e-06   
gb|EST07406.1|  hypothetical protein PSEUBRA_SCAF20g03165             54.3    2e-06   
ref|XP_010988428.1|  PREDICTED: obg-like ATPase 1                     54.3    2e-06   
emb|CAG10349.1|  unnamed protein product                              53.9    2e-06   
ref|XP_002429861.1|  conserved hypothetical protein                   53.9    2e-06   
ref|XP_006636567.1|  PREDICTED: obg-like ATPase 1-like isoform X2     53.9    2e-06   
gb|AEE61569.1|  unknown                                               54.3    2e-06   
ref|XP_002116391.1|  hypothetical protein TRIADDRAFT_30808            54.3    2e-06   
ref|XP_003722043.1|  putative GTP binding protein                     54.3    3e-06   
dbj|GAN04407.1|  GTP-binding protein                                  54.3    3e-06   
ref|XP_001880771.1|  predicted protein                                53.9    3e-06   
ref|XP_011498533.1|  PREDICTED: obg-like ATPase 1                     53.9    3e-06   
ref|XP_007888200.1|  PREDICTED: obg-like ATPase 1                     53.9    3e-06   
gb|EPB88277.1|  obg-like ATPase 1                                     53.9    3e-06   
ref|XP_005847323.1|  hypothetical protein CHLNCDRAFT_56178            53.9    3e-06   
ref|XP_003876812.1|  putative GTP binding protein                     53.9    3e-06   
gb|EGI59773.1|  GTP-binding protein                                   51.6    3e-06   
dbj|BAB55174.1|  unnamed protein product                              53.9    3e-06   
emb|CEP19285.1|  hypothetical protein                                 53.9    3e-06   
ref|XP_011162955.1|  PREDICTED: obg-like ATPase 1                     53.9    3e-06   
ref|XP_001846952.1|  GTP-binding protein                              52.0    3e-06   
ref|NP_001026425.1|  obg-like ATPase 1                                53.9    3e-06   
dbj|BAM19435.1|  GTP-binding protein                                  53.9    3e-06   
ref|XP_003400207.1|  PREDICTED: GTP-binding protein CG1354-like       53.9    3e-06   
ref|XP_003494408.1|  PREDICTED: GTP-binding protein CG1354-like       53.9    3e-06   
ref|XP_011063639.1|  PREDICTED: obg-like ATPase 1 isoform X2          53.9    3e-06   
ref|XP_011063638.1|  PREDICTED: obg-like ATPase 1 isoform X1          53.9    3e-06   
ref|XP_011148752.1|  PREDICTED: obg-like ATPase 1                     53.9    3e-06   
ref|XP_006116547.1|  PREDICTED: obg-like ATPase 1 isoform X2          53.9    3e-06   
emb|CCV00472.1|  unnamed protein product                              53.9    3e-06   
ref|XP_004426694.1|  PREDICTED: obg-like ATPase 1 isoform 2           53.5    3e-06   
gb|AIC56285.1|  OLA1                                                  53.9    3e-06   
ref|XP_002055571.1|  GJ18714                                          53.9    3e-06   
ref|XP_011329428.1|  PREDICTED: obg-like ATPase 1                     53.9    3e-06   
ref|XP_003447358.1|  PREDICTED: obg-like ATPase 1-like isoform X1     53.9    3e-06   
gb|EZA60179.1|  GTP-binding protein                                   50.8    4e-06   
ref|XP_004426693.1|  PREDICTED: obg-like ATPase 1 isoform 1           53.5    4e-06   
ref|XP_004521628.1|  PREDICTED: obg-like ATPase 1-like isoform X1     53.5    4e-06   
ref|XP_003695060.1|  PREDICTED: GTP-binding protein CG1354-like       53.5    4e-06   
ref|XP_006116546.1|  PREDICTED: obg-like ATPase 1 isoform X1          53.9    4e-06   
ref|XP_002010541.1|  GI15984                                          53.5    4e-06   
ref|XP_003704224.1|  PREDICTED: GTP-binding protein CG1354-like       53.5    4e-06   
ref|XP_396711.3|  PREDICTED: obg-like ATPase 1-like isoformX1         53.5    4e-06   
emb|CBH09562.1|  GTP binding protein, putative                        53.5    4e-06   
ref|XP_006616484.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...  53.5    4e-06   
ref|XP_008326509.1|  PREDICTED: obg-like ATPase 1 isoform X1          53.5    4e-06   
ref|XP_951682.1|  GTP binding protein                                 53.5    4e-06   
ref|XP_969865.2|  PREDICTED: obg-like ATPase 1                        53.5    4e-06   
gb|KIM64260.1|  hypothetical protein SCLCIDRAFT_15274                 53.5    4e-06   
emb|CEI96573.1|  Putative Obg-like ATPase 1                           53.5    4e-06   
ref|XP_001956259.1|  GF25119                                          53.5    4e-06   
gb|KIO15045.1|  hypothetical protein M404DRAFT_991745                 53.5    4e-06   
dbj|BAG59026.1|  unnamed protein product                              52.8    5e-06   
gb|KIK10341.1|  hypothetical protein K443DRAFT_127101                 53.5    5e-06   
ref|XP_002076931.1|  GD24779                                          53.1    5e-06   
dbj|BAB31566.1|  unnamed protein product                              52.8    5e-06   
ref|NP_084367.1|  obg-like ATPase 1 isoform b                         52.8    5e-06   
ref|XP_001977300.1|  GG18324                                          53.5    5e-06   
ref|XP_006683298.1|  hypothetical protein BATDEDRAFT_33861            53.5    5e-06   
gb|AAY18927.1|  DKFZp761C10121                                        53.5    5e-06   
emb|CEG70465.1|  Putative Obg-like ATPase 1                           53.1    5e-06   
ref|NP_572580.1|  CG1354, isoform A                                   53.1    5e-06   
ref|XP_007393236.1|  hypothetical protein PHACADRAFT_251809           53.1    5e-06   
ref|XP_002041803.1|  GM11387                                          53.1    5e-06   
emb|CCC46753.1|  putative GTP binding protein                         53.1    5e-06   
ref|XP_009311370.1|  GTP-binding protein                              53.1    5e-06   
ref|XP_004258887.1|  hypothetical protein EIN_380430                  51.2    5e-06   
ref|XP_011185359.1|  PREDICTED: obg-like ATPase 1                     53.1    5e-06   
gb|KIH55129.1|  GTP-binding protein YchF                              53.1    5e-06   
emb|CBN75206.1|  OLA1, Obg-like ATPase 1 (YchF-related GTPase)        53.1    5e-06   
ref|XP_005723546.1|  PREDICTED: obg-like ATPase 1-like isoform X3     53.1    5e-06   
ref|XP_002101766.1|  GE17809                                          53.1    5e-06   
gb|KIK28906.1|  hypothetical protein PISMIDRAFT_27366                 53.1    6e-06   
ref|XP_008256981.1|  PREDICTED: obg-like ATPase 1 isoform X2          52.8    6e-06   
gb|AAH13925.1|  OLA1 protein                                          52.4    6e-06   
gb|EFA09581.1|  hypothetical protein TcasGA2_TC011698                 51.2    6e-06   
gb|EIE82570.1|  GTP-binding protein YchF                              53.1    6e-06   
ref|XP_005452971.1|  PREDICTED: obg-like ATPase 1-like isoform X2     53.1    6e-06   
emb|CDS09858.1|  Putative GTP-binding protein YchF                    53.1    6e-06   
ref|XP_002646525.1|  C. briggsae CBR-TAG-210 protein                  53.1    6e-06   
ref|XP_001901357.1|  GTP-binding protein W08E3.3                      53.1    6e-06   
emb|CDH52754.1|  gtp-binding protein                                  52.8    7e-06   
emb|CDQ02627.1|  Protein BM-TAG-210, isoform c                        52.8    7e-06   
gb|ESA10852.1|  hypothetical protein GLOINDRAFT_348023                52.8    7e-06   
ref|XP_003115069.1|  CRE-TAG-210 protein                              52.8    7e-06   
ref|XP_007877623.1|  hypothetical protein PFL1_01921                  52.8    7e-06   
emb|CDW53501.1|  GTP binding protein CG1354                           52.8    7e-06   
ref|XP_003330516.2|  GTP-binding protein YchF                         53.1    7e-06   
ref|XP_515918.2|  PREDICTED: obg-like ATPase 1 isoform X1             53.1    7e-06   
ref|XP_003824289.1|  PREDICTED: obg-like ATPase 1 isoform X1          53.1    7e-06   
ref|XP_010878190.1|  PREDICTED: obg-like ATPase 1 isoform X2          52.8    8e-06   
ref|XP_010878189.1|  PREDICTED: obg-like ATPase 1 isoform X1          52.8    8e-06   
ref|XP_009236111.1|  PREDICTED: obg-like ATPase 1 isoform X1          52.8    8e-06   
emb|CCW70456.1|  unnamed protein product                              52.8    9e-06   
ref|XP_010878192.1|  PREDICTED: obg-like ATPase 1 isoform X4          52.8    9e-06   
gb|KDR79051.1|  hypothetical protein GALMADRAFT_244801                52.4    9e-06   
dbj|GAC76234.1|  predicted GTP-binding protein                        52.8    9e-06   
gb|ETS60332.1|  hypothetical protein PaG_05530                        52.8    9e-06   
ref|XP_001566005.1|  putative GTP binding protein                     52.4    1e-05   
gb|EPY30421.1|  GTP binding protein                                   52.4    1e-05   
ref|XP_007867475.1|  hypothetical protein GLOTRDRAFT_100492           52.4    1e-05   
ref|NP_001254006.1|  Protein OLA-1, isoform a                         52.4    1e-05   
ref|XP_007513696.1|  predicted protein                                52.4    1e-05   
gb|EPY39657.1|  GTP binding protein                                   52.4    1e-05   
gb|KII89623.1|  hypothetical protein PLICRDRAFT_39737                 52.4    1e-05   
gb|AGG11697.1|  hypothetical protein                                  52.4    1e-05   
gb|KDQ24560.1|  hypothetical protein PLEOSDRAFT_1046650               52.4    1e-05   
ref|XP_003064009.1|  predicted protein                                52.4    1e-05   
emb|CCC89543.1|  putative GTP binding protein                         52.0    1e-05   
ref|XP_010793747.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...  52.0    1e-05   
gb|EYC24730.1|  hypothetical protein Y032_0013g2079                   52.0    1e-05   
gb|ETN73871.1|  GTP-binding protein YchF                              52.0    1e-05   
ref|XP_010180112.1|  PREDICTED: obg-like ATPase 1                     49.7    1e-05   
ref|XP_001991915.1|  GH11803                                          52.0    1e-05   
gb|EJW81490.1|  GTP-binding protein YchF                              52.0    1e-05   
ref|XP_311198.2|  AGAP000672-PA                                       52.0    1e-05   
gb|KIM28647.1|  hypothetical protein M408DRAFT_137703                 52.0    1e-05   
ref|XP_006174829.1|  PREDICTED: obg-like ATPase 1 isoform X2          51.6    1e-05   
gb|KHJ93893.1|  GTP-binding protein YchF                              52.0    1e-05   
ref|XP_007765948.1|  hypothetical protein CONPUDRAFT_88471            52.0    1e-05   
ref|XP_007370743.1|  cytoplasmic protein                              52.0    1e-05   
ref|NP_001268915.1|  obg-like ATPase 1 isoform 2                      51.6    1e-05   
ref|XP_001654823.1|  AAEL002160-PA                                    52.0    1e-05   
ref|XP_007403597.1|  hypothetical protein MELLADRAFT_41455            52.0    1e-05   
dbj|GAN04316.1|  GTP binding protein                                  52.0    2e-05   
gb|EFX64850.1|  hypothetical protein DAPPUDRAFT_219469                52.0    2e-05   
ref|XP_004347436.1|  GTP-binding protein                              52.0    2e-05   
ref|XP_001836147.2|  cytoplasmic protein                              51.6    2e-05   
gb|ELU40735.1|  cytoplasm protein                                     52.0    2e-05   
gb|KHJ90518.1|  GTP-binding protein YchF                              51.6    2e-05   
gb|KHN83895.1|  Obg-like ATPase 1                                     52.0    2e-05   
ref|XP_005416153.1|  PREDICTED: obg-like ATPase 1                     52.0    2e-05   
gb|ERG79748.1|  gtp-binding protein                                   51.6    2e-05   
gb|EJU04665.1|  GTP-dependent nucleic acid-binding protein engD       51.6    2e-05   
gb|KIM84778.1|  hypothetical protein PILCRDRAFT_817575                51.6    2e-05   
ref|XP_009024324.1|  hypothetical protein HELRODRAFT_187336           51.6    2e-05   
ref|XP_007318634.1|  hypothetical protein SERLADRAFT_468188           51.2    2e-05   
ref|XP_003745114.1|  PREDICTED: GTP-binding protein CG1354-like       51.2    2e-05   
ref|XP_007342239.1|  cytoplasmic protein                              51.2    2e-05   
ref|XP_007299959.1|  hypothetical protein STEHIDRAFT_91176            51.2    2e-05   
gb|KDO21130.1|  GTP-binding protein YchF                              51.2    2e-05   
emb|CDI56682.1|  related to YLF2-putative glycogen phosphorylase,...  51.2    3e-05   
ref|XP_011488211.1|  PREDICTED: obg-like ATPase 1                     48.9    3e-05   
ref|XP_008616943.1|  GTP-binding protein YchF                         51.2    3e-05   
ref|XP_002953657.1|  hypothetical protein VOLCADRAFT_82356            51.2    3e-05   
ref|XP_007851384.1|  gtp binding protein                              50.8    3e-05   
emb|CCO28665.1|  hypothetical protein BN14_02663                      50.8    3e-05   
ref|XP_002502254.1|  predicted protein                                50.8    3e-05   
gb|EUC54657.1|  GTP-binding protein YchF                              50.8    3e-05   
gb|KIJ66804.1|  hypothetical protein HYDPIDRAFT_26226                 50.8    3e-05   
gb|KEP46752.1|  GTP-binding protein YchF                              50.8    3e-05   
gb|KIP10981.1|  hypothetical protein PHLGIDRAFT_100248                50.8    3e-05   
gb|KJA13331.1|  hypothetical protein HYPSUDRAFT_49902                 50.8    4e-05   
gb|KDE07259.1|  cytoplasm protein                                     50.4    4e-05   
gb|EPY31725.1|  GTP binding protein                                   50.4    4e-05   
ref|XP_011392463.1|  hypothetical protein UMAG_06117                  50.4    4e-05   
gb|EGT58351.1|  hypothetical protein CAEBREN_10889                    50.4    4e-05   
gb|EPY37092.1|  GTP binding protein                                   50.4    5e-05   
gb|EWM27290.1|  protein of unknown function DUF933                    50.4    5e-05   
ref|XP_007387865.1|  cytoplasmic protein                              50.4    5e-05   
emb|CEJ02012.1|  Putative GTP-binding protein YchF                    49.7    5e-05   
ref|XP_002071025.1|  GK25358                                          50.4    5e-05   
emb|CCF49066.1|  related to YLF2-putative glycogen phosphorylase,...  50.4    5e-05   
ref|XP_009545259.1|  hypothetical protein HETIRDRAFT_433700           50.1    6e-05   
dbj|GAK67480.1|  GTP-binding protein YchF                             50.4    6e-05   
ref|XP_008878069.1|  GTP-binding protein YchF, variant 1              50.1    6e-05   
gb|KIK81179.1|  hypothetical protein PAXRUDRAFT_833035                50.1    6e-05   
gb|KIL67453.1|  hypothetical protein M378DRAFT_73640                  50.1    6e-05   
gb|KDQ59200.1|  hypothetical protein JAAARDRAFT_33932                 50.1    7e-05   
gb|KIM40454.1|  hypothetical protein M413DRAFT_445912                 50.1    7e-05   
ref|XP_006957622.1|  hypothetical protein WALSEDRAFT_32059            50.1    7e-05   
emb|CDS05214.1|  hypothetical protein LRAMOSA07743                    49.7    8e-05   
ref|XP_006459209.1|  hypothetical protein AGABI2DRAFT_134686          49.7    8e-05   
ref|XP_008878070.1|  GTP-binding protein YchF, variant 2              49.7    8e-05   
ref|XP_007330451.1|  hypothetical protein AGABI1DRAFT_85507           49.7    8e-05   
ref|XP_008472913.1|  PREDICTED: obg-like ATPase 1 isoform X2          49.7    8e-05   
ref|XP_008472912.1|  PREDICTED: obg-like ATPase 1 isoform X1          49.7    8e-05   
emb|CEG64981.1|  Putative GTP-binding protein YchF                    49.7    9e-05   
emb|CCA15473.1|  Rab1 family GTPase (PiYpt1) putative                 50.1    9e-05   
ref|XP_010700320.1|  GTP binding protein, putative                    49.7    9e-05   
gb|KIK63189.1|  hypothetical protein GYMLUDRAFT_242240                49.7    1e-04   
ref|NP_593965.1|  mitochondrial NTPase Ylf2 (predicted)               49.7    1e-04   
gb|EPY29725.1|  GTP binding protein                                   48.9    1e-04   
ref|XP_005452974.1|  PREDICTED: obg-like ATPase 1-like isoform X5     49.3    1e-04   
ref|XP_003388006.1|  PREDICTED: obg-like ATPase 1                     49.3    1e-04   
ref|XP_009269581.1|  hypothetical protein J056_001678                 49.3    1e-04   
gb|KIJ12000.1|  hypothetical protein PAXINDRAFT_171504                49.3    1e-04   
ref|XP_004557802.1|  PREDICTED: obg-like ATPase 1-like isoform X2     49.3    1e-04   
gb|KGB37524.1|  Obg-like ATPase 1                                     49.3    1e-04   
emb|CCD81858.1|  GTP-binding protein-related                          49.3    1e-04   
emb|CBK21211.2|  unnamed protein product                              49.3    1e-04   
ref|XP_009515545.1|  hypothetical protein PHYSODRAFT_551993           48.9    1e-04   
emb|CBQ71413.1|  related to YLF2-putative glycogen phosphorylase,...  49.3    1e-04   
gb|KIY43956.1|  hypothetical protein FISHEDRAFT_67701                 48.9    1e-04   
ref|XP_002370768.1|  GTP binding protein, putative                    48.9    1e-04   
ref|XP_007263355.1|  cytoplasmic protein                              48.9    2e-04   
gb|EMD33303.1|  hypothetical protein CERSUDRAFT_117926                48.9    2e-04   
gb|KFD67365.1|  hypothetical protein M514_20401                       48.9    2e-04   
ref|XP_011128728.1|  putative GTP-binding protein                     48.5    2e-04   
emb|CEF67024.1|  Obg-like ATPase 1                                    48.9    2e-04   
ref|XP_003884761.1|  putative GTP binding protein                     48.5    2e-04   
ref|XP_009351070.1|  PREDICTED: obg-like ATPase 1                     48.5    2e-04   



>gb|AAF65513.1| GTP-binding protein [Capsicum annuum]
Length=394

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_004231561.1| PREDICTED: obg-like ATPase 1 [Solanum lycopersicum]
Length=394

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_001776504.1| predicted protein [Physcomitrella patens]
 gb|EDQ58637.1| predicted protein [Physcomitrella patens]
Length=394

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAKGKE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKGKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_006360314.1| PREDICTED: obg-like ATPase 1-like [Solanum tuberosum]
Length=394

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_010098556.1| Obg-like ATPase 1 [Morus notabilis]
 gb|EXB75216.1| Obg-like ATPase 1 [Morus notabilis]
Length=394

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAKGKE P+ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKGKEAPSERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_006448885.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
 gb|ESR62125.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
Length=460

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +2

Query  134  AAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            ++K+MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  63   SSKQMPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  110



>ref|XP_011015196.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=392

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_004293982.1| PREDICTED: obg-like ATPase 1 [Fragaria vesca subsp. vesca]
Length=394

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AKGKE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKGKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_007022926.1| GTP binding [Theobroma cacao]
 gb|EOY25548.1| GTP binding [Theobroma cacao]
Length=394

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_002523184.1| GTP-dependent nucleic acid-binding protein engD, putative [Ricinus 
communis]
 gb|EEF39215.1| GTP-dependent nucleic acid-binding protein engD, putative [Ricinus 
communis]
Length=394

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|KJB69092.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=354

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|AFK48623.1| unknown [Lotus japonicus]
Length=394

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|KCW75747.1| hypothetical protein EUGRSUZ_D00127 [Eucalyptus grandis]
Length=322

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|KHF97630.1| Obg-like ATPase 1 [Gossypium arboreum]
Length=394

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|KJB69089.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=394

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|KJB69091.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=357

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_010051911.1| PREDICTED: obg-like ATPase 1 [Eucalyptus grandis]
 gb|KCW75746.1| hypothetical protein EUGRSUZ_D00127 [Eucalyptus grandis]
Length=394

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>emb|CDP17295.1| unnamed protein product [Coffea canephora]
Length=394

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_011085197.1| PREDICTED: obg-like ATPase 1 [Sesamum indicum]
Length=394

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK KE PAERPILGRFSSHLK+GIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKVGIVGLPNVGKSTLFNTL  44



>ref|XP_011037748.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=394

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_006377958.1| hypothetical protein POPTR_0011s16690g [Populus trichocarpa]
 gb|ERP55755.1| hypothetical protein POPTR_0011s16690g [Populus trichocarpa]
Length=394

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|KDO75237.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=350

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|KDP34925.1| hypothetical protein JCGZ_09213 [Jatropha curcas]
Length=394

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|NP_001242520.1| uncharacterized protein LOC100793501 [Glycine max]
 gb|ACU21485.1| unknown [Glycine max]
Length=394

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_003546267.1| PREDICTED: obg-like ATPase 1-like [Glycine max]
 gb|KHN14324.1| Obg-like ATPase 1 [Glycine soja]
Length=394

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_004135546.1| PREDICTED: obg-like ATPase 1-like [Cucumis sativus]
 ref|XP_004158075.1| PREDICTED: obg-like ATPase 1-like [Cucumis sativus]
 gb|KGN65918.1| hypothetical protein Csa_1G538160 [Cucumis sativus]
Length=395

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|KDO75236.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=406

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_010245345.1| PREDICTED: obg-like ATPase 1 [Nelumbo nucifera]
Length=394

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK K+ PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKDAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_008445378.1| PREDICTED: obg-like ATPase 1 [Cucumis melo]
Length=395

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>emb|CAN63158.1| hypothetical protein VITISV_035841 [Vitis vinifera]
Length=120

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK++K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSSKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_009603694.1| PREDICTED: obg-like ATPase 1 {ECO:0000255|HAMAP-Rule:MF_03167} 
[Nicotiana tomentosiformis]
Length=394

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAKGKE P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKGKEAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|KJB69090.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=361

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_002300568.1| hypothetical protein POPTR_0001s47010g [Populus trichocarpa]
 gb|EEE85373.1| hypothetical protein POPTR_0001s47010g [Populus trichocarpa]
Length=394

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE P+ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPSERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_009362223.1| PREDICTED: obg-like ATPase 1 [Pyrus x bretschneideri]
Length=394

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_008225608.1| PREDICTED: obg-like ATPase 1 [Prunus mume]
Length=394

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKAKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|EYU43227.1| hypothetical protein MIMGU_mgv1a007827mg [Erythranthe guttata]
Length=394

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_008383389.1| PREDICTED: obg-like ATPase 1 [Malus domestica]
Length=394

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|KDO75234.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=374

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_008372236.1| PREDICTED: obg-like ATPase 1 [Malus domestica]
Length=394

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_006468322.1| PREDICTED: obg-like ATPase 1-like [Citrus sinensis]
 gb|KDO75235.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=394

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_006448884.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
 gb|ESR62124.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
Length=394

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_004486463.1| PREDICTED: obg-like ATPase 1-like [Cicer arietinum]
Length=394

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_007211399.1| hypothetical protein PRUPE_ppa006821mg [Prunus persica]
 gb|EMJ12598.1| hypothetical protein PRUPE_ppa006821mg [Prunus persica]
Length=394

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|KDO75238.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=263

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_011039799.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=394

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE P+ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAPSERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_002263885.1| PREDICTED: obg-like ATPase 1 [Vitis vinifera]
 emb|CBI31027.3| unnamed protein product [Vitis vinifera]
Length=394

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK++K KE PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSSKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_007147477.1| hypothetical protein PHAVU_006G127800g [Phaseolus vulgaris]
 gb|ESW19471.1| hypothetical protein PHAVU_006G127800g [Phaseolus vulgaris]
Length=394

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE PAERPI GRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKSKEAPAERPIFGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_006845995.1| hypothetical protein AMTR_s00155p00051130 [Amborella trichopoda]
 gb|ERN07670.1| hypothetical protein AMTR_s00155p00051130 [Amborella trichopoda]
Length=248

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K K+ PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKAKDTPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_010687083.1| PREDICTED: obg-like ATPase 1 [Beta vulgaris subsp. vulgaris]
Length=394

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK K+ PAERP+LGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKSKDAPAERPVLGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_009803590.1| PREDICTED: obg-like ATPase 1 [Nicotiana sylvestris]
Length=394

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA KGKE P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKATKGKEAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_003594539.1| Obg-like ATPase [Medicago truncatula]
 gb|AES64790.1| GTP-binding protein [Medicago truncatula]
Length=394

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKSKEAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|KEH37060.1| 50S ribosome-binding GTPase [Medicago truncatula]
Length=209

 Score = 84.7 bits (208),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKSKEAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|ACJ85184.1| unknown [Medicago truncatula]
Length=394

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKSKEAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|AFK49195.1| unknown [Medicago truncatula]
Length=401

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAKSKEAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_008812127.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
Length=412

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/44 (89%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K KE   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKASKSKEAAPERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_010519060.1| PREDICTED: obg-like ATPase 1 [Tarenaya hassleriana]
Length=395

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/45 (91%), Positives = 42/45 (93%), Gaps = 1/45 (2%)
 Frame = +2

Query  146  MPPKAAKGKEV-PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK K+  PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKDAAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  45



>ref|XP_008777315.1| PREDICTED: obg-like ATPase 1, partial [Phoenix dactylifera]
Length=190

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK K+   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKDAAPERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_009412029.1| PREDICTED: obg-like ATPase 1 [Musa acuminata subsp. malaccensis]
Length=394

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/44 (89%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK K+   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKDAVTERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_008799072.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799073.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799075.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799076.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799077.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
Length=394

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/44 (89%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK K+   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKDAAPERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_010941555.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
Length=394

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/44 (89%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKAAK K+   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAAKSKDAAPERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|EPS61253.1| hypothetical protein M569_13545, partial [Genlisea aurea]
Length=250

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK AK KE  AERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKGAKSKEGVAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_010926935.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
 ref|XP_010926936.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
 ref|XP_010926937.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
Length=394

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK++K K+   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSSKSKDAAPERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|ABK25108.1| unknown [Picea sitchensis]
Length=392

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 1/44 (2%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK+AK KE PAER ILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKSAK-KEAPAERAILGRFSSHLKIGIVGLPNVGKSTLFNTL  43



>gb|EEC83063.1| hypothetical protein OsI_28170 [Oryza sativa Indica Group]
Length=394

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +
Sbjct  1    MPPKASKKDAAPAERPILGRFSSHLKIGIVGLPNVGKSTFFNIV  44



>ref|NP_001061206.2| Os08g0199300 [Oryza sativa Japonica Group]
 dbj|BAD03576.1| putative GTP-binding protein [Oryza sativa Japonica Group]
 dbj|BAG88257.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93810.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68206.1| hypothetical protein OsJ_26368 [Oryza sativa Japonica Group]
 dbj|BAF23120.2| Os08g0199300 [Oryza sativa Japonica Group]
Length=394

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +
Sbjct  1    MPPKASKKDAAPAERPILGRFSSHLKIGIVGLPNVGKSTFFNIV  44



>gb|EMT28525.1| Obg-like ATPase 1 [Aegilops tauschii]
Length=397

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +
Sbjct  1    MPPKASKKDAEPAERPILGRFSSHLKIGIVGLPNVGKSTFFNIV  44



>ref|XP_006659204.1| PREDICTED: obg-like ATPase 1-like [Oryza brachyantha]
Length=394

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K    PAERP+LGRFSSHLKIGIVGLPNVGKST FN +
Sbjct  1    MPPKASKKDAAPAERPLLGRFSSHLKIGIVGLPNVGKSTFFNIV  44



>gb|EMS48297.1| Obg-like ATPase 1 [Triticum urartu]
Length=397

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +
Sbjct  1    MPPKASKKDAEPAERPILGRFSSHLKIGIVGLPNVGKSTFFNIV  44



>emb|CDM85617.1| unnamed protein product [Triticum aestivum]
Length=394

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA+K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +
Sbjct  1    MPPKASKKDAEPAERPILGRFSSHLKIGIVGLPNVGKSTFFNIV  44



>gb|KFK44867.1| hypothetical protein AALP_AA1G312800 [Arabis alpina]
Length=394

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKDGAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_010478480.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA   +  P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKEAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|NP_174346.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AAD25745.1|AC007060_3 Similar to WO8E3.3 gi|3880615 putative GTP-binding protein from 
C. elegans cosmid gb|Z92773. EST gb|AA597331 comes from this 
gene [Arabidopsis thaliana]
 gb|ABG25054.1| At1g30580 [Arabidopsis thaliana]
 gb|AEE31246.1| GTP-binding protein [Arabidopsis thaliana]
Length=394

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_006305006.1| hypothetical protein CARUB_v10009370mg [Capsella rubella]
 gb|EOA37904.1| hypothetical protein CARUB_v10009370mg [Capsella rubella]
Length=394

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>gb|AAM63059.1| putative GTP-binding protein [Arabidopsis thaliana]
Length=394

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>emb|CDX77584.1| BnaA07g07220D [Brassica napus]
Length=394

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>emb|CDY12460.1| BnaC08g09490D [Brassica napus]
Length=394

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_006415450.1| hypothetical protein EUTSA_v10007733mg [Eutrema salsugineum]
 gb|ESQ33803.1| hypothetical protein EUTSA_v10007733mg [Eutrema salsugineum]
Length=419

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = +2

Query  122  LIFSA--AKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            L+F A   ++MPPK+      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  16   LLFQARHWRKMPPKSKAKDGAPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  69



>emb|CDX98216.1| BnaC07g08820D [Brassica napus]
Length=394

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_009107765.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
 emb|CDY47157.1| BnaA08g05260D [Brassica napus]
Length=394

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_002893634.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69893.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=394

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_010499597.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_009115125.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
Length=395

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/45 (87%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +2

Query  146  MPPKA-AKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA AK    P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKDAAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  45



>ref|XP_010460862.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK       P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKGKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_003573525.1| PREDICTED: obg-like ATPase 1 [Brachypodium distachyon]
Length=394

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK++K    P ERPILGRFSSHLKIGIVGLPNVGKST FN +
Sbjct  1    MPPKSSKKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTFFNIV  44



>emb|CDY02308.1| BnaA09g25940D [Brassica napus]
Length=394

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA      P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  44



>ref|XP_004972629.1| PREDICTED: obg-like ATPase 1-like [Setaria italica]
Length=393

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +
Sbjct  1    MPPKAKK-DAAPAERPILGRFSSHLKIGIVGLPNVGKSTFFNIV  43



>ref|XP_002445191.1| hypothetical protein SORBIDRAFT_07g005700 [Sorghum bicolor]
 gb|EES14686.1| hypothetical protein SORBIDRAFT_07g005700 [Sorghum bicolor]
Length=393

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA K    PAERPILGRFSSHLKIGIVGLPNVGKST FN +
Sbjct  1    MPPKAKK-DAAPAERPILGRFSSHLKIGIVGLPNVGKSTFFNIV  43



>ref|XP_009144765.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
Length=394

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA      P ERPILGRFSS LKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKDAGPVERPILGRFSSLLKIGIVGLPNVGKSTLFNTL  44



>gb|AFW56960.1| hypothetical protein ZEAMMB73_810066 [Zea mays]
Length=369

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA K    P+ERPILGRFSSHLKIGIVGLPNVGKST FN +
Sbjct  1    MPPKAKK-DAAPSERPILGRFSSHLKIGIVGLPNVGKSTFFNIV  43



>ref|XP_005650863.1| flagellar associated protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26319.1| flagellar associated protein [Coccomyxa subellipsoidea C-169]
Length=392

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  K KE P ERPILGRF ++LKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPK--KAKEEPKERPILGRFRTNLKIGIVGLPNVGKSTLFNTL  42



>ref|NP_001150211.1| GTP-binding protein PTD004 [Zea mays]
 gb|ACF85733.1| unknown [Zea mays]
 gb|ACG38260.1| GTP-binding protein PTD004 [Zea mays]
 gb|AFW56961.1| GTP-binding protein PTD004 [Zea mays]
Length=393

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA K    P+ERPILGRFSSHLKIGIVGLPNVGKST FN +
Sbjct  1    MPPKAKK-DAAPSERPILGRFSSHLKIGIVGLPNVGKSTFFNIV  43



>emb|CDY09558.1| BnaC05g23610D [Brassica napus]
Length=397

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 38/47 (81%), Gaps = 3/47 (6%)
 Frame = +2

Query  146  MPPKAAKGKEV---PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPKA    +    P ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  1    MPPKAKAKAKDAAGPVERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  47



>ref|XP_010538270.1| PREDICTED: obg-like ATPase 1 [Tarenaya hassleriana]
Length=395

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  185  ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  15   ERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  45



>gb|KDD75506.1| DUF933 hypothetical protein [Helicosporidium sp. ATCC 50920]
Length=398

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 3/47 (6%)
 Frame = +2

Query  137  AKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
             ++MPPK    KE   ERPILGRF S+LK+GIVGLPNVGKSTLFN+L
Sbjct  5    GEDMPPKK---KEEVKERPILGRFKSNLKVGIVGLPNVGKSTLFNSL  48



>gb|AGF69175.1| putative GTP-binding protein, partial [Triticum aestivum]
Length=257

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  179  PAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            PAERPILGRFSSHLKIGIVGLPNVGKST FN +
Sbjct  6    PAERPILGRFSSHLKIGIVGLPNVGKSTFFNIV  38



>gb|EMT28526.1| Obg-like ATPase 1 [Aegilops tauschii]
Length=377

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  155  KAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            KA+K    PAERPILGRFSS LKIGIVGLPNVGKST FN +
Sbjct  62   KASKKDGEPAERPILGRFSSPLKIGIVGLPNVGKSTFFNIV  102



>ref|XP_002985543.1| hypothetical protein SELMODRAFT_234816 [Selaginella moellendorffii]
 ref|XP_002987026.1| hypothetical protein SELMODRAFT_158442 [Selaginella moellendorffii]
 gb|EFJ11869.1| hypothetical protein SELMODRAFT_158442 [Selaginella moellendorffii]
 gb|EFJ13417.1| hypothetical protein SELMODRAFT_234816 [Selaginella moellendorffii]
Length=389

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/32 (97%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  182  AERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            AER ILGRFSSHLKIGIVGLPNVGKSTLFNTL
Sbjct  16   AERQILGRFSSHLKIGIVGLPNVGKSTLFNTL  47



>ref|XP_001699763.1| flagellar associated protein [Chlamydomonas reinhardtii]
 gb|EDP07459.1| flagellar associated protein [Chlamydomonas reinhardtii]
Length=391

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  158  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            A K +E P ERP+LGRF S+LKIG+VG+PNVGKSTLFN L
Sbjct  2    APKKQEAPKERPLLGRFKSNLKIGLVGMPNVGKSTLFNLL  41



>ref|XP_002953429.1| hypothetical protein VOLCADRAFT_105955 [Volvox carteri f. nagariensis]
 gb|EFJ45402.1| hypothetical protein VOLCADRAFT_105955 [Volvox carteri f. nagariensis]
Length=391

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  158  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            A K +E P ERP+LGRF S+LK+GIVG+PNVGKSTLFN L
Sbjct  2    APKKQEAPKERPLLGRFKSNLKMGIVGMPNVGKSTLFNLL  41



>gb|KIY94771.1| hypothetical protein MNEG_13192 [Monoraphidium neglectum]
Length=90

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  158  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            A K KE   ERPILGRF ++LK+GIVG+PNVGKSTLFNTL
Sbjct  2    APKKKEEVKERPILGRFKTNLKMGIVGMPNVGKSTLFNTL  41



>ref|XP_008397269.1| PREDICTED: obg-like ATPase 1 isoform X1 [Poecilia reticulata]
Length=398

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK AKG + P   P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MAPKKAKGDDAPKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  44



>ref|XP_008397279.1| PREDICTED: obg-like ATPase 1 isoform X2 [Poecilia reticulata]
Length=391

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK AKG + P   P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MAPKKAKGDDAPKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  44



>ref|XP_007546548.1| PREDICTED: obg-like ATPase 1 [Poecilia formosa]
Length=398

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK AKG + P   P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MAPKKAKGDDAPKPPPLIGRFGTALKIGIVGLPNVGKSTFFNVL  44



>ref|XP_005716907.1| GTP-binding protein of Obg family [Chondrus crispus]
 emb|CDF37088.1| GTP-binding protein of Obg family [Chondrus crispus]
Length=398

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = +2

Query  146  MPPKAAKG-KEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK   G  + P+ER +LGRF+ +LK+GIVG+PNVGKST FNTL
Sbjct  1    MPPKKKGGASDAPSERLMLGRFTHNLKMGIVGMPNVGKSTFFNTL  45



>ref|XP_006636566.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Lepisosteus oculatus]
Length=401

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = +2

Query  134  AAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            A K+MPPK  KG E P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  2    APKKMPPK--KGGEAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  47



>ref|XP_006788528.1| PREDICTED: obg-like ATPase 1-like [Neolamprologus brichardi]
Length=398

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK  KG + P   P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MAPKKGKGADAPKSPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  44



>ref|XP_003961956.1| PREDICTED: obg-like ATPase 1-like [Takifugu rubripes]
Length=398

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK  KG++ P   P++GRF + LKIG+VGLPNVGKST FN L
Sbjct  1    MAPKKGKGEDAPKPAPLIGRFGTSLKIGVVGLPNVGKSTFFNVL  44



>ref|XP_008297045.1| PREDICTED: obg-like ATPase 1 [Stegastes partitus]
Length=398

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK  KG + P   P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MAPKKGKGDDAPKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  44



>ref|XP_005723544.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Pundamilia nyererei]
 ref|XP_005921547.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Haplochromis burtoni]
Length=398

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK  KG + P   P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MAPKKGKGADAPKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  44



>gb|KII61429.1| Obg-like ATPase 1 [Thelohanellus kitauei]
Length=184

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  158  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            A K K V  + P+LGRF++ LKIGIVGLPNVGKS+ FNTL
Sbjct  2    ATKSKTVEEDLPLLGRFTTQLKIGIVGLPNVGKSSFFNTL  41



>ref|XP_010884736.1| PREDICTED: obg-like ATPase 1 [Esox lucius]
 ref|XP_010884737.1| PREDICTED: obg-like ATPase 1 [Esox lucius]
 ref|XP_010884739.1| PREDICTED: obg-like ATPase 1 [Esox lucius]
Length=397

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG E P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGEGPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|NP_001008044.1| obg-like ATPase 1 [Xenopus (Silurana) tropicalis]
 sp|Q66JG0.1|OLA1_XENTR RecName: Full=Obg-like ATPase 1 [Xenopus (Silurana) tropicalis]
 gb|AAH80929.1| MGC79585 protein [Xenopus (Silurana) tropicalis]
Length=396

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  K  + P + PI+GRF + LKIGIVGLPN+GKST FN L
Sbjct  1    MPPK--KADDGPKQHPIIGRFGTSLKIGIVGLPNIGKSTFFNVL  42



>emb|CAJ83205.1| novel protein similar to GTP-binding protein PTD004 [Xenopus 
(Silurana) tropicalis]
Length=396

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  K  + P + PI+GRF + LKIGIVGLPN+GKST FN L
Sbjct  1    MPPK--KADDGPKQHPIIGRFGTSLKIGIVGLPNIGKSTFFNVL  42



>ref|XP_006003587.1| PREDICTED: obg-like ATPase 1 isoform X1 [Latimeria chalumnae]
Length=401

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 2/48 (4%)
 Frame = +2

Query  134  AAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            + K+MPPK  K  + P + PI+GRF + L+IGIVGLPNVGKST FN L
Sbjct  2    SPKKMPPK--KADDGPKQHPIIGRFGTSLRIGIVGLPNVGKSTFFNVL  47



>ref|NP_001079680.1| obg-like ATPase 1 [Xenopus laevis]
 sp|Q7ZWM6.1|OLA1_XENLA RecName: Full=Obg-like ATPase 1 [Xenopus laevis]
 gb|AAH46937.1| Ola1 protein [Xenopus laevis]
Length=396

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  K  + P + PI+GRF + LKIGIVGLPN+GKST FN L
Sbjct  1    MPPK--KADDGPKQHPIIGRFGTSLKIGIVGLPNIGKSTFFNVL  42



>ref|NP_999865.1| obg-like ATPase 1 isoform 1 [Danio rerio]
 sp|Q7ZU42.1|OLA1_DANRE RecName: Full=Obg-like ATPase 1 [Danio rerio]
 gb|AAH51155.1| Zgc:55768 [Danio rerio]
 gb|AAH67579.1| Zgc:55768 [Danio rerio]
Length=396

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG + P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_001186941.1| PREDICTED: obg-like ATPase 1-like [Strongylocentrotus purpuratus]
Length=353

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KGKE P ++ + GR  + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGKEAPPKKVLFGRVGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_797209.1| PREDICTED: obg-like ATPase 1-like [Strongylocentrotus purpuratus]
Length=394

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KGKE P ++ + GR  + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGKEAPPKKVLFGRVGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_009296560.1| PREDICTED: obg-like ATPase 1, partial [Danio rerio]
Length=124

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG + P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_006003588.1| PREDICTED: obg-like ATPase 1 isoform X2 [Latimeria chalumnae]
 ref|XP_006003589.1| PREDICTED: obg-like ATPase 1 isoform X3 [Latimeria chalumnae]
 ref|XP_006003590.1| PREDICTED: obg-like ATPase 1 isoform X4 [Latimeria chalumnae]
Length=396

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  K  + P + PI+GRF + L+IGIVGLPNVGKST FN L
Sbjct  1    MPPK--KADDGPKQHPIIGRFGTSLRIGIVGLPNVGKSTFFNVL  42



>gb|EMS17306.1| GTP-binding protein [Entamoeba histolytica HM-3:IMSS]
Length=396

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  170  KEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            K+ P ER ILGR ++HL++GIVGLPNVGKSTLFN L
Sbjct  4    KQEPKERVILGRLTNHLRMGIVGLPNVGKSTLFNAL  39



>ref|XP_008310339.1| PREDICTED: obg-like ATPase 1 [Cynoglossus semilaevis]
Length=396

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK A   E P   P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKA---EAPTAPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  41



>ref|XP_657513.1| GTP-binding protein [Entamoeba histolytica HM-1:IMSS]
 gb|EAL52123.1| GTP-binding protein, putative [Entamoeba histolytica HM-1:IMSS]
 gb|EMD48435.1| GTP-binding protein, putative [Entamoeba histolytica KU27]
 gb|EMH77110.1| GTP-binding protein YchF, putative [Entamoeba histolytica HM-1:IMSS-B]
 gb|ENY61633.1| GTP-binding protein, putative [Entamoeba histolytica HM-1:IMSS-A]
Length=396

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  170  KEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            K+ P ER ILGR ++HL++GIVGLPNVGKSTLFN L
Sbjct  4    KQEPKERVILGRLTNHLRMGIVGLPNVGKSTLFNAL  39



>ref|XP_001741184.1| hypothetical protein [Entamoeba dispar SAW760]
 gb|EDR22344.1| hypothetical protein, conserved [Entamoeba dispar SAW760]
Length=396

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  170  KEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            K+ P ER ILGR ++HL++GIVGLPNVGKSTLFN L
Sbjct  4    KQEPKERVILGRLTNHLRMGIVGLPNVGKSTLFNAL  39



>ref|XP_008860136.1| GTP-binding protein YchF protein [Entamoeba nuttalli P19]
 gb|EKE37527.1| GTP-binding protein YchF protein [Entamoeba nuttalli P19]
Length=396

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  170  KEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            K+ P ER ILGR ++HL++GIVGLPNVGKSTLFN L
Sbjct  4    KQEPKERVILGRITNHLRMGIVGLPNVGKSTLFNAL  39



>ref|XP_005535678.1| GTP-binding protein of Obg family [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM79392.1| GTP-binding protein of Obg family [Cyanidioschyzon merolae strain 
10D]
Length=400

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK  K  +    RPILGRFS +LK+GIVGLPNVGKST FNTL
Sbjct  1    MAPK--KRTDEGERRPILGRFSHNLKMGIVGLPNVGKSTFFNTL  42



>gb|KFO72251.1| Obg-like ATPase 1 [Cuculus canorus]
Length=404

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGSDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|NP_001158828.1| obg-like ATPase 1 [Salmo salar]
 gb|ACN10563.1| Obg-like ATPase 1 [Salmo salar]
 emb|CDQ78712.1| unnamed protein product [Oncorhynchus mykiss]
Length=397

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  +G   P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKGEG---PKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  41



>gb|AAH77496.1| Ola1 protein [Xenopus laevis]
Length=281

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  K  + P + PI+GRF + LKIGIVGLPN+GKST FN L
Sbjct  1    MPPK--KADDGPKQHPIIGRFGTSLKIGIVGLPNIGKSTFFNVL  42



>ref|XP_010793340.1| PREDICTED: obg-like ATPase 1 [Notothenia coriiceps]
Length=397

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P + PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKP---EAPKQPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  41



>ref|XP_007576845.1| PREDICTED: obg-like ATPase 1 [Poecilia formosa]
Length=395

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  41



>ref|XP_006798459.1| PREDICTED: obg-like ATPase 1-like [Neolamprologus brichardi]
Length=395

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  41



>ref|XP_005798398.1| PREDICTED: obg-like ATPase 1-like [Xiphophorus maculatus]
Length=395

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  41



>ref|XP_005723778.1| PREDICTED: obg-like ATPase 1-like [Pundamilia nyererei]
 ref|XP_005934395.1| PREDICTED: obg-like ATPase 1-like [Haplochromis burtoni]
Length=395

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  41



>ref|XP_003442972.1| PREDICTED: obg-like ATPase 1-like [Oreochromis niloticus]
 ref|XP_004540365.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Maylandia zebra]
 ref|XP_004540366.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Maylandia zebra]
Length=395

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  41



>ref|XP_008275154.1| PREDICTED: obg-like ATPase 1 [Stegastes partitus]
Length=395

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG E P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KG-EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  41



>ref|XP_008397950.1| PREDICTED: obg-like ATPase 1 [Poecilia reticulata]
Length=395

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  41



>gb|KFP77737.1| Obg-like ATPase 1, partial [Acanthisitta chloris]
Length=322

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_010736092.1| PREDICTED: obg-like ATPase 1 isoform X1 [Larimichthys crocea]
Length=398

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK  KG +     P++GRF + LKIG+VGLPNVGKST FN L
Sbjct  1    MAPKKGKGDDASKPPPLIGRFGTSLKIGVVGLPNVGKSTFFNVL  44



>ref|XP_008326510.1| PREDICTED: obg-like ATPase 1 isoform X2 [Cynoglossus semilaevis]
Length=398

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK  KG +     P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MSPKKGKGDDALKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  44



>ref|XP_005452973.1| PREDICTED: obg-like ATPase 1-like isoform X4 [Oreochromis niloticus]
Length=398

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK  KG +     P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MAPKKGKGADALKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  44



>ref|XP_009553897.1| PREDICTED: obg-like ATPase 1 [Cuculus canorus]
Length=396

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGSDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_001728946.1| hypothetical protein MGL_3940 [Malassezia globosa CBS 7966]
 gb|EDP41732.1| hypothetical protein MGL_3940 [Malassezia globosa CBS 7966]
Length=433

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 40/46 (87%), Gaps = 3/46 (7%)
 Frame = +2

Query  140  KEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            ++MPPK  KG++  +E+P LGR S++LK+GIVGLPNVGKSTLFNT+
Sbjct  36   RKMPPK--KGQQT-SEKPRLGRPSNNLKMGIVGLPNVGKSTLFNTI  78



>ref|XP_002198993.1| PREDICTED: obg-like ATPase 1 isoform 1 [Taeniopygia guttata]
 ref|XP_004176777.1| PREDICTED: obg-like ATPase 1 isoform 2 [Taeniopygia guttata]
Length=396

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGSDGIKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_007512524.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17124.1| predicted protein [Bathycoccus prasinos]
Length=400

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  + +E P     LGRFSS+LK+GIVG+PNVGKSTL+N L
Sbjct  1    MPPKKKEVEEEPLGPWSLGRFSSNLKVGIVGMPNVGKSTLYNAL  44



>ref|XP_003962811.1| PREDICTED: obg-like ATPase 1-like [Takifugu rubripes]
Length=396

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKG---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  41



>ref|XP_005703761.1| GTP-binding protein [Galdieria sulphuraria]
 gb|EME27241.1| GTP-binding protein [Galdieria sulphuraria]
Length=398

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  158  AAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            A K KE   +R +LGRFS +LK+GI+GLPNVGKST FNTL
Sbjct  2    APKKKEEEPQRAVLGRFSHNLKMGILGLPNVGKSTFFNTL  41



>ref|XP_004557801.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Maylandia zebra]
Length=398

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK  KG +     P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MAPKKGKGADALKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  44



>ref|XP_011488562.1| PREDICTED: obg-like ATPase 1 [Oryzias latipes]
 ref|XP_011488563.1| PREDICTED: obg-like ATPase 1 [Oryzias latipes]
Length=219

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKT---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  41



>ref|XP_002396842.1| hypothetical protein MPER_02840 [Moniliophthora perniciosa FA553]
 gb|EEB97772.1| hypothetical protein MPER_02840 [Moniliophthora perniciosa FA553]
Length=101

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 7/62 (11%)
 Frame = +2

Query  104  SSSLC---LLIFSAAKE-MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFN  271
            S+S+C   L + SA K  MPPK A G E   ++ +LGR  ++LKIGIVGLPNVGKS+ FN
Sbjct  7    STSVCHRRLDLHSAKKRGMPPKKATGAE---KKTLLGRPGNNLKIGIVGLPNVGKSSFFN  63

Query  272  TL  277
             L
Sbjct  64   AL  65



>ref|XP_010564826.1| PREDICTED: obg-like ATPase 1 [Haliaeetus leucocephalus]
Length=396

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_009680050.1| PREDICTED: obg-like ATPase 1 [Struthio camelus australis]
 gb|KFV84859.1| Obg-like ATPase 1 [Struthio camelus australis]
Length=396

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_005519864.1| PREDICTED: obg-like ATPase 1 isoform X1 [Pseudopodoces humilis]
 ref|XP_005519865.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pseudopodoces humilis]
 ref|XP_005519866.1| PREDICTED: obg-like ATPase 1 isoform X3 [Pseudopodoces humilis]
 ref|XP_008632970.1| PREDICTED: obg-like ATPase 1 isoform X1 [Corvus brachyrhynchos]
 ref|XP_008632971.1| PREDICTED: obg-like ATPase 1 isoform X1 [Corvus brachyrhynchos]
 gb|KFO59967.1| Obg-like ATPase 1 [Corvus brachyrhynchos]
Length=396

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_005152654.1| PREDICTED: obg-like ATPase 1 [Melopsittacus undulatus]
 ref|XP_009086251.1| PREDICTED: obg-like ATPase 1 isoform X1 [Serinus canaria]
 ref|XP_009086252.1| PREDICTED: obg-like ATPase 1 isoform X1 [Serinus canaria]
 ref|XP_009460338.1| PREDICTED: obg-like ATPase 1 [Nipponia nippon]
 ref|XP_009703255.1| PREDICTED: obg-like ATPase 1 [Cariama cristata]
 ref|XP_009863599.1| PREDICTED: obg-like ATPase 1 [Apaloderma vittatum]
 ref|XP_009904955.1| PREDICTED: obg-like ATPase 1 [Picoides pubescens]
 ref|XP_009994461.1| PREDICTED: obg-like ATPase 1 [Chaetura pelagica]
 gb|KFP67376.1| Obg-like ATPase 1 [Cariama cristata]
 gb|KFP84928.1| Obg-like ATPase 1 [Apaloderma vittatum]
 gb|KFQ94658.1| Obg-like ATPase 1 [Nipponia nippon]
 gb|KFU88570.1| Obg-like ATPase 1 [Chaetura pelagica]
 gb|KFV72142.1| Obg-like ATPase 1 [Picoides pubescens]
Length=396

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_008503320.1| PREDICTED: obg-like ATPase 1 [Calypte anna]
 gb|KFO97058.1| Obg-like ATPase 1 [Calypte anna]
Length=396

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>emb|CAG09966.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=346

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  164  KGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            KG++ P   P++GRF + LKIG+VGLPNVGKST FN L
Sbjct  1    KGEDAPKPAPLIGRFGTSLKIGVVGLPNVGKSTFFNVL  38



>ref|XP_009070315.1| PREDICTED: obg-like ATPase 1 [Acanthisitta chloris]
Length=396

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_005049114.1| PREDICTED: obg-like ATPase 1 [Ficedula albicollis]
Length=396

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKAHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_009639084.1| PREDICTED: obg-like ATPase 1 [Egretta garzetta]
 gb|KFP17586.1| Obg-like ATPase 1 [Egretta garzetta]
Length=396

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKAHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_007430998.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Python bivittatus]
Length=401

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = +2

Query  134  AAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            A K+MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  2    APKKMPPK--KGGDGIKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  47



>gb|ELK32737.1| Obg-like ATPase 1 [Myotis davidii]
Length=408

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +2

Query  125  IFSAAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            IF    +MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  6    IFVLIFQMPPK--KGGDGIKPLPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  54



>ref|XP_009955691.1| PREDICTED: obg-like ATPase 1, partial [Leptosomus discolor]
 ref|XP_010143384.1| PREDICTED: obg-like ATPase 1, partial [Buceros rhinoceros silvestris]
 ref|XP_010203828.1| PREDICTED: obg-like ATPase 1, partial [Colius striatus]
Length=124

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_003764019.1| PREDICTED: obg-like ATPase 1 [Sarcophilus harrisii]
Length=396

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG E     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGEGIKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_005723545.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Pundamilia nyererei]
 ref|XP_005921548.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Haplochromis burtoni]
Length=396

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK  KG + P   P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MAPK--KGADAPKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>gb|EKF26595.1| GTP-binding protein, putative [Trypanosoma cruzi marinkellei]
Length=394

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK    K  P+   +LGR  S+LK+GIVGLPNVGKST FN L
Sbjct  1    MPPKKKDEKSQPSHTILLGRPGSNLKVGIVGLPNVGKSTFFNVL  44



>ref|XP_005300475.1| PREDICTED: obg-like ATPase 1 isoform X2 [Chrysemys picta bellii]
Length=402

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +2

Query  134  AAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            A ++MPPK   G +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  2    APRKMPPKKG-GDDGVKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  48



>emb|CDQ81805.1| unnamed protein product [Oncorhynchus mykiss]
Length=473

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  +G   P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  77   MPPKKGEG---PKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  117



>ref|XP_006825853.1| PREDICTED: obg-like ATPase 1-like [Saccoglossus kowalevskii]
Length=353

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK    KE P  +P++GR  + LK GIVGLPNVGKST FN L
Sbjct  1    MPPKK---KEAPTSKPLIGRVGTSLKCGIVGLPNVGKSTFFNVL  41



>gb|ACO09273.1| GTP-binding protein PTD004 [Osmerus mordax]
Length=395

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK +   + P + P++GRF + LKIGIVG+PNVGKST FN L
Sbjct  1    MPPKKS---DAPKQPPLIGRFGTSLKIGIVGIPNVGKSTFFNVL  41



>ref|NP_001040339.1| GTP binding protein [Bombyx mori]
 gb|ABF51217.1| GTP binding protein [Bombyx mori]
Length=397

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  +G   P ++P++GR  ++LK+GIVG+PNVGKST FN L
Sbjct  1    MPPKKVEG---PEKKPLIGRVGTNLKVGIVGVPNVGKSTFFNVL  41



>ref|XP_010878191.1| PREDICTED: obg-like ATPase 1 isoform X3 [Esox lucius]
Length=399

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK  KG +     P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MAPKKQKGGDGQQPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  44



>ref|XP_004577108.1| PREDICTED: obg-like ATPase 1 isoform X3 [Ochotona princeps]
Length=321

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>emb|CDQ57167.1| unnamed protein product [Oncorhynchus mykiss]
Length=399

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            M PK  KG +     P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MAPKKQKGGDGQQPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  44



>ref|XP_008933239.1| PREDICTED: obg-like ATPase 1 [Merops nubicus]
 gb|KFQ24822.1| Obg-like ATPase 1 [Merops nubicus]
Length=396

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKSFPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_007248906.1| PREDICTED: obg-like ATPase 1-like [Astyanax mexicanus]
Length=396

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  K  + P   P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KAGDGPKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_006275602.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Alligator mississippiensis]
Length=396

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LK+GIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDEAKPHPIIGRFGTSLKVGIVGLPNVGKSTFFNVL  42



>gb|AAO26205.1| GTP-binding protein [Trypanosoma cruzi]
Length=394

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK    K  P    +LGR  S+LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKKDEKSQPPRTILLGRPGSNLKIGIVGLPNVGKSTFFNVL  44



>ref|XP_008685352.1| PREDICTED: obg-like ATPase 1 [Ursus maritimus]
Length=396

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDAIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_006020859.1| PREDICTED: obg-like ATPase 1 [Alligator sinensis]
Length=396

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LK+GIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDEAKPHPIIGRFGTSLKVGIVGLPNVGKSTFFNVL  42



>ref|XP_002407922.1| GTP-binding protein, putative [Ixodes scapularis]
 gb|EEC10587.1| GTP-binding protein, putative [Ixodes scapularis]
Length=397

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 4/45 (9%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPIL-GRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK    KE   ERP+L GR  ++LK+GIVGLPNVGKST FN L
Sbjct  1    MPPKK---KEDECERPVLIGRVGTNLKVGIVGLPNVGKSTFFNVL  42



>emb|CEI98922.1| Putative GTP-binding protein YchF [Rhizopus microsporus]
Length=398

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  125  IFSAAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            +F+++ +   K    KE+  E+ ILGR S++L++GIVGLPN+GKS+LFNTL
Sbjct  6    LFTSSIQFAKKKVAKKEIVKEKAILGRPSNNLRMGIVGLPNIGKSSLFNTL  56



>ref|XP_010226941.1| PREDICTED: obg-like ATPase 1 [Tinamus guttatus]
 gb|KGL72436.1| Obg-like ATPase 1 [Tinamus guttatus]
Length=243

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_010291164.1| PREDICTED: obg-like ATPase 1 [Phaethon lepturus]
 gb|KFQ80651.1| Obg-like ATPase 1 [Phaethon lepturus]
Length=243

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKSHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>gb|EHJ68331.1| GTP binding protein [Danaus plexippus]
Length=2193

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P ++P++GR  ++LK+GIVG+PNVGKST FN L
Sbjct  1    MPPKKV---EEPEKKPLIGRVGTNLKVGIVGVPNVGKSTFFNVL  41



>ref|XP_008216612.1| PREDICTED: obg-like ATPase 1 [Nasonia vitripennis]
 ref|XP_008216613.1| PREDICTED: obg-like ATPase 1 [Nasonia vitripennis]
 ref|XP_008216614.1| PREDICTED: obg-like ATPase 1 [Nasonia vitripennis]
 ref|XP_008216615.1| PREDICTED: obg-like ATPase 1 [Nasonia vitripennis]
Length=397

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P ++P++GR  ++LK+GIVG+PNVGKST FN L
Sbjct  1    MPPKKV---EEPEKKPLIGRVGTNLKVGIVGIPNVGKSTFFNVL  41



>ref|XP_010747153.1| PREDICTED: obg-like ATPase 1 [Larimichthys crocea]
Length=404

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P + P++GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKV---EAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVL  41



>ref|XP_003372802.1| GTP-dependent nucleic acid-binding protein EngD [Trichinella 
spiralis]
 gb|EFV53035.1| GTP-dependent nucleic acid-binding protein EngD [Trichinella 
spiralis]
Length=376

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  +  + P    I+GR  S+LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKQKESVQAPNR--IIGRIGSNLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_006116548.1| PREDICTED: obg-like ATPase 1 isoform X3 [Pelodiscus sinensis]
Length=425

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = +2

Query  134  AAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            A ++MPPK  KG +     PI+GRF + LK+GIVGLPNVGKST FN L
Sbjct  20   ARRKMPPK--KGVDGVKPHPIIGRFGTSLKVGIVGLPNVGKSTFFNVL  65



>ref|XP_005818302.1| hypothetical protein GUITHDRAFT_159055 [Guillardia theta CCMP2712]
 gb|EKX31322.1| hypothetical protein GUITHDRAFT_159055 [Guillardia theta CCMP2712]
Length=339

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 34/47 (72%), Gaps = 7/47 (15%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERP---ILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK    KE   ER     LGRFS+ LK+GIVGLPNVGKSTL+NTL
Sbjct  1    MPPK----KEETTERLGAWALGRFSNRLKVGIVGLPNVGKSTLYNTL  43



>ref|XP_011307687.1| PREDICTED: obg-like ATPase 1 [Fopius arisanus]
Length=397

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P  +P++GR  ++LK+GIVG+PNVGKST FN L
Sbjct  1    MPPKKV---EEPERKPLIGRVGTNLKVGIVGIPNVGKSTFFNVL  41



>gb|EFB23886.1| hypothetical protein PANDA_008995 [Ailuropoda melanoleuca]
Length=245

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +2

Query  143  EMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            +MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  2    QMPPK--KGGDAIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  44



>ref|XP_001515633.1| PREDICTED: obg-like ATPase 1 isoform X1 [Ornithorhynchus anatinus]
 ref|XP_007669441.1| PREDICTED: obg-like ATPase 1 isoform X1 [Ornithorhynchus anatinus]
 ref|XP_007669442.1| PREDICTED: obg-like ATPase 1 isoform X2 [Ornithorhynchus anatinus]
Length=396

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_010159477.1| PREDICTED: obg-like ATPase 1 [Eurypyga helias]
Length=243

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKAHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_001368232.1| PREDICTED: Obg-like ATPase 1 [Monodelphis domestica]
Length=396

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_007430999.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Python bivittatus]
Length=396

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_817773.1| GTP-binding protein [Trypanosoma cruzi strain CL Brener]
 gb|EAN95922.1| GTP-binding protein, putative [Trypanosoma cruzi]
Length=394

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK    K  P    +LGR  S+LK+GIVGLPNVGKST FN L
Sbjct  1    MPPKKKDEKSQPPRTILLGRPGSNLKVGIVGLPNVGKSTFFNVL  44



>gb|ESS62262.1| GTP-binding protein [Trypanosoma cruzi Dm28c]
Length=394

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK    K  P    +LGR  S+LK+GIVGLPNVGKST FN L
Sbjct  1    MPPKKKDEKSQPPRTILLGRPGSNLKVGIVGLPNVGKSTFFNVL  44



>gb|EKG08395.1| hypothetical protein TCSYLVIO_000468 [Trypanosoma cruzi]
Length=394

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK    K  P    +LGR  S+LK+GIVGLPNVGKST FN L
Sbjct  1    MPPKKKDEKSQPPRTILLGRPGSNLKVGIVGLPNVGKSTFFNVL  44



>ref|XP_813495.1| GTP-binding protein [Trypanosoma cruzi strain CL Brener]
 gb|EAN91644.1| GTP-binding protein, putative [Trypanosoma cruzi]
Length=394

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK    K  P    +LGR  S+LK+GIVGLPNVGKST FN L
Sbjct  1    MPPKKKDEKSQPPRTILLGRPGSNLKVGIVGLPNVGKSTFFNVL  44



>ref|XP_004004627.1| PREDICTED: obg-like ATPase 1 [Ovis aries]
Length=425

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +2

Query  140  KEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            +EMPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  28   REMPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  71



>ref|XP_003225685.1| PREDICTED: obg-like ATPase 1 isoform X1 [Anolis carolinensis]
 ref|XP_008116319.1| PREDICTED: obg-like ATPase 1 isoform X1 [Anolis carolinensis]
Length=396

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_005182762.2| PREDICTED: obg-like ATPase 1 [Musca domestica]
Length=397

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK    +E P  +P++GR  ++L+IGIVG+PNVGKST FN L
Sbjct  1    MPPKK---QEEPERKPLIGRIGTNLRIGIVGVPNVGKSTFFNVL  41



>ref|XP_009050807.1| hypothetical protein LOTGIDRAFT_151663 [Lottia gigantea]
 gb|ESO98500.1| hypothetical protein LOTGIDRAFT_151663 [Lottia gigantea]
Length=399

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK    KEV    P++GR  + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKK---KEVDKPPPLIGRVGTSLKIGIVGLPNVGKSTFFNVL  41



>gb|EPY89072.1| hypothetical protein CB1_000138040 [Camelus ferus]
Length=122

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGSDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_005099946.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Aplysia californica]
 ref|XP_005099947.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Aplysia californica]
 ref|XP_005099948.1| PREDICTED: obg-like ATPase 1-like isoform X3 [Aplysia californica]
Length=399

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     P++GR  ++LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKK-KGDDADKPPPLIGRVGTNLKIGIVGLPNVGKSTFFNCL  43



>ref|XP_004703788.1| PREDICTED: obg-like ATPase 1 isoform X2 [Echinops telfairi]
Length=375

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPLPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_004375552.1| PREDICTED: obg-like ATPase 1 [Trichechus manatus latirostris]
Length=396

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKAPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_005857658.1| PREDICTED: obg-like ATPase 1 [Myotis brandtii]
 ref|XP_006083169.1| PREDICTED: obg-like ATPase 1 isoform X1 [Myotis lucifugus]
 ref|XP_006083170.1| PREDICTED: obg-like ATPase 1 isoform X2 [Myotis lucifugus]
 ref|XP_006083171.1| PREDICTED: obg-like ATPase 1 isoform X3 [Myotis lucifugus]
 ref|XP_006760667.1| PREDICTED: obg-like ATPase 1 isoform X1 [Myotis davidii]
 ref|XP_006760668.1| PREDICTED: obg-like ATPase 1 isoform X2 [Myotis davidii]
 ref|XP_006760669.1| PREDICTED: obg-like ATPase 1 isoform X3 [Myotis davidii]
Length=396

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPLPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_010350251.1| PREDICTED: LOW QUALITY PROTEIN: obg-like ATPase 1 [Saimiri boliviensis 
boliviensis]
Length=472

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  77   MPPK--KGSDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  118



>ref|XP_008136765.1| PREDICTED: obg-like ATPase 1 isoform X1 [Eptesicus fuscus]
Length=396

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPLPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_004703787.1| PREDICTED: obg-like ATPase 1 isoform X1 [Echinops telfairi]
Length=396

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPLPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_004634806.1| PREDICTED: obg-like ATPase 1 isoform X2 [Octodon degus]
Length=375

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_001421839.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00133.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=400

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK    +EV      LGRFSS+LK+GIVG+PNVGKSTL+N L
Sbjct  1    MPPKKVVQEEVLGPWS-LGRFSSNLKVGIVGMPNVGKSTLYNAL  43



>ref|XP_006878885.1| PREDICTED: obg-like ATPase 1-like [Elephantulus edwardii]
Length=396

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_006204987.1| PREDICTED: obg-like ATPase 1-like [Vicugna pacos]
Length=139

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGSDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|NP_001029099.1| obg-like ATPase 1 [Rattus norvegicus]
 sp|A0JPJ7.1|OLA1_RAT RecName: Full=Obg-like ATPase 1 [Rattus norvegicus]
 gb|AAI27458.1| Obg-like ATPase 1 [Rattus norvegicus]
Length=396

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGLKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>gb|ELR47977.1| Obg-like ATPase 1, partial [Bos mutus]
Length=407

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +2

Query  143  EMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            +MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  2    QMPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  44



>gb|EGV95685.1| Obg-like ATPase 1 [Cricetulus griseus]
Length=290

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = +2

Query  131  SAAKEMPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            SA   MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  62   SALCTMPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  108



>ref|XP_004634805.1| PREDICTED: obg-like ATPase 1 isoform X1 [Octodon degus]
 ref|XP_005393249.1| PREDICTED: obg-like ATPase 1 [Chinchilla lanigera]
Length=396

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGVKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>gb|EFX64851.1| hypothetical protein DAPPUDRAFT_333762 [Daphnia pulex]
Length=398

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK    +  P  +P++GR  + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKK---EAAPEPKPLIGRVGTSLKIGIVGLPNVGKSTFFNIL  41



>dbj|BAB27201.1| unnamed protein product [Mus musculus]
Length=396

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_005300476.1| PREDICTED: obg-like ATPase 1 isoform X3 [Chrysemys picta bellii]
Length=397

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK   G +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPKKG-GDDGVKPHPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  43



>ref|XP_004601223.1| PREDICTED: obg-like ATPase 1 isoform X2 [Sorex araneus]
Length=375

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_005324665.1| PREDICTED: obg-like ATPase 1 isoform X2 [Ictidomys tridecemlineatus]
Length=375

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_004409047.1| PREDICTED: obg-like ATPase 1 isoform 2 [Odobenus rosmarus divergens]
 ref|XP_004577107.1| PREDICTED: obg-like ATPase 1 isoform X2 [Ochotona princeps]
Length=375

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_006116549.1| PREDICTED: obg-like ATPase 1 isoform X4 [Pelodiscus sinensis]
Length=402

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LK+GIVGLPNVGKST FN L
Sbjct  1    MPPK--KGVDGVKPHPIIGRFGTSLKVGIVGLPNVGKSTFFNVL  42



>ref|XP_006866713.1| PREDICTED: obg-like ATPase 1 isoform X1 [Chrysochloris asiatica]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGMKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_005907299.1| PREDICTED: obg-like ATPase 1 [Bos mutus]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|NP_001153863.1| Obg-like ATPase 1 [Acyrthosiphon pisum]
 dbj|BAH70819.1| ACYPI52009 [Acyrthosiphon pisum]
 dbj|BAH70820.1| ACYPI52009 [Acyrthosiphon pisum]
 dbj|BAH70821.1| ACYPI52009 [Acyrthosiphon pisum]
 dbj|BAH70822.1| ACYPI52009 [Acyrthosiphon pisum]
 dbj|BAH70823.1| ACYPI52009 [Acyrthosiphon pisum]
 dbj|BAH70824.1| ACYPI52009 [Acyrthosiphon pisum]
Length=397

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 3/44 (7%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK     E P ++P++GR  ++LK+GIVG+PNVGKST FN L
Sbjct  1    MPPKKV---EEPEKKPLIGRVGTNLKVGIVGIPNVGKSTFFNVL  41



>ref|XP_007183357.1| PREDICTED: obg-like ATPase 1 [Balaenoptera acutorostrata scammoni]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>dbj|BAE39543.1| unnamed protein product [Mus musculus]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>tpg|DAA13236.1| TPA: Obg-like ATPase 1-like [Bos taurus]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>gb|EDL79133.1| similar to RIKEN cDNA 2810409H07, isoform CRA_a [Rattus norvegicus]
 gb|EDL79134.1| similar to RIKEN cDNA 2810409H07, isoform CRA_a [Rattus norvegicus]
Length=388

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGLKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_004674579.1| PREDICTED: obg-like ATPase 1 isoform X2 [Condylura cristata]
Length=375

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_011355667.1| PREDICTED: obg-like ATPase 1 isoform X1 [Pteropus vampyrus]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_007527277.1| PREDICTED: obg-like ATPase 1 isoform X1 [Erinaceus europaeus]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|NP_080218.1| obg-like ATPase 1 isoform a [Mus musculus]
 sp|Q9CZ30.1|OLA1_MOUSE RecName: Full=Obg-like ATPase 1; AltName: Full=GTP-binding protein 
9 [Mus musculus]
 dbj|BAB28624.1| unnamed protein product [Mus musculus]
 gb|AAH11318.1| Obg-like ATPase 1 [Mus musculus]
 gb|AAH29207.1| Obg-like ATPase 1 [Mus musculus]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>gb|ELW67716.1| Myosin regulatory light polypeptide 9 [Tupaia chinensis]
Length=309

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 30/43 (70%), Gaps = 3/43 (7%)
 Frame = +2

Query  149  PPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            P K   G + P   PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  3    PKKEGDGIKSP---PIIGRFGTSLKIGIVGLPNVGKSTFFNAL  42



>ref|NP_001039510.1| obg-like ATPase 1 [Bos taurus]
 ref|XP_010858115.1| PREDICTED: obg-like ATPase 1 isoform X1 [Bison bison bison]
 sp|Q2HJ33.1|OLA1_BOVIN RecName: Full=Obg-like ATPase 1 [Bos taurus]
 gb|AAI13337.1| Obg-like ATPase 1 [Bos taurus]
 tpg|DAA32812.1| TPA: Obg-like ATPase 1 [Bos taurus]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_007451126.1| PREDICTED: obg-like ATPase 1 isoform X1 [Lipotes vexillifer]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_005676004.1| PREDICTED: obg-like ATPase 1 [Capra hircus]
 ref|XP_005973730.1| PREDICTED: obg-like ATPase 1 [Pantholops hodgsonii]
 ref|XP_006063099.1| PREDICTED: obg-like ATPase 1-like [Bubalus bubalis]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_004601222.1| PREDICTED: obg-like ATPase 1 isoform X1 [Sorex araneus]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_003406265.1| PREDICTED: obg-like ATPase 1 [Loxodonta africana]
 ref|XP_007938890.1| PREDICTED: obg-like ATPase 1 isoform X1 [Orycteropus afer afer]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>emb|CAB66481.1| hypothetical protein [Homo sapiens]
 emb|CAL38332.1| hypothetical protein [synthetic construct]
 dbj|BAG72666.1| Obg-like ATPase 1 [synthetic construct]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_004341541.1| GTP binding protein [Acanthamoeba castellanii str. Neff]
 gb|ELR19455.1| GTP binding protein [Acanthamoeba castellanii str. Neff]
Length=395

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  164  KGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            KGKE    +P+LGR +++LK+GIVGLPNVGKSTL+N L
Sbjct  3    KGKEDATPKPLLGRPTANLKMGIVGLPNVGKSTLYNAL  40



>gb|AAD44500.1| homologous yeast-44.2 protein [Homo sapiens]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_004674578.1| PREDICTED: obg-like ATPase 1 isoform X1 [Condylura cristata]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|NP_037473.3| obg-like ATPase 1 isoform 1 [Homo sapiens]
 ref|NP_001253557.1| obg-like ATPase 1 [Macaca mulatta]
 ref|XP_002712341.1| PREDICTED: obg-like ATPase 1 isoform X1 [Oryctolagus cuniculus]
 ref|XP_003496010.1| PREDICTED: obg-like ATPase 1-like [Cricetulus griseus]
 ref|XP_003791556.1| PREDICTED: obg-like ATPase 1 [Otolemur garnettii]
 ref|XP_003907676.1| PREDICTED: obg-like ATPase 1 [Papio anubis]
 ref|XP_004409046.1| PREDICTED: obg-like ATPase 1 isoform 1 [Odobenus rosmarus divergens]
 ref|XP_004577106.1| PREDICTED: obg-like ATPase 1 isoform X1 [Ochotona princeps]
 ref|XP_004660388.1| PREDICTED: obg-like ATPase 1 [Jaculus jaculus]
 ref|XP_004774420.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Mustela putorius 
furo]
 ref|XP_004790975.1| PREDICTED: obg-like ATPase 1 isoform X1 [Mustela putorius furo]
 ref|XP_005065212.1| PREDICTED: obg-like ATPase 1 [Mesocricetus auratus]
 ref|XP_005573572.1| PREDICTED: uncharacterized LOC101926459 isoform X3 [Macaca fascicularis]
 ref|XP_006151186.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Tupaia chinensis]
 ref|XP_006151187.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Tupaia chinensis]
 ref|XP_006744647.1| PREDICTED: obg-like ATPase 1 isoform X1 [Leptonychotes weddellii]
 ref|XP_006921272.1| PREDICTED: obg-like ATPase 1 [Pteropus alecto]
 ref|XP_007074627.1| PREDICTED: obg-like ATPase 1 [Panthera tigris altaica]
 ref|XP_007609907.1| PREDICTED: obg-like ATPase 1 [Cricetulus griseus]
 ref|XP_007963585.1| PREDICTED: obg-like ATPase 1 isoform X2 [Chlorocebus sabaeus]
 ref|XP_002749373.2| PREDICTED: obg-like ATPase 1 isoform X2 [Callithrix jacchus]
 ref|XP_010356769.1| PREDICTED: obg-like ATPase 1 isoform X2 [Rhinopithecus roxellana]
 ref|XP_011283606.1| PREDICTED: obg-like ATPase 1 isoform X1 [Felis catus]
 sp|Q9NTK5.2|OLA1_HUMAN RecName: Full=Obg-like ATPase 1; AltName: Full=DNA damage-regulated 
overexpressed in cancer 45; Short=DOC45; AltName: Full=GTP-binding 
protein 9 [Homo sapiens]
 pdb|2OHF|A Chain A, Crystal Structure Of Human Ola1 In Complex With Amppcp
 gb|AAP97255.1|AF134478_1 GTP-binding protein [Homo sapiens]
 gb|AAD44491.1| PTD004 [Homo sapiens]
 gb|AAH12842.1| Obg-like ATPase 1 [Homo sapiens]
 gb|AAH29376.1| Obg-like ATPase 1 [Homo sapiens]
 gb|AAH91522.1| Obg-like ATPase 1 [Homo sapiens]
 gb|ABB72766.1| DNA damage-regulated overexpressed in cancer 45 protein [Homo 
sapiens]
 gb|EAX11151.1| GTP-binding protein PTD004, isoform CRA_c [Homo sapiens]
 dbj|BAK62803.1| putative GTP-binding protein PTD004 [Pan troglodytes]
 gb|ELK04710.1| Obg-like ATPase 1 [Pteropus alecto]
 gb|ERE71975.1| obg-like ATPase 1-like protein [Cricetulus griseus]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_003478641.1| PREDICTED: obg-like ATPase 1 [Cavia porcellus]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



>ref|XP_003474516.1| PREDICTED: obg-like ATPase 1-like [Cavia porcellus]
Length=396

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  146  MPPKAAKGKEVPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTL  277
            MPPK  KG +     PI+GRF + LKIGIVGLPNVGKST FN L
Sbjct  1    MPPK--KGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVL  42



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557915310750