BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF011B01

Length=256
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624740.1|  PREDICTED: glutamate--glyoxylate aminotransf...  65.5    3e-10   Nicotiana tomentosiformis
ref|XP_009759837.1|  PREDICTED: glutamate--glyoxylate aminotransf...  65.5    3e-10   Nicotiana sylvestris
ref|XP_009765091.1|  PREDICTED: glutamate--glyoxylate aminotransf...  65.1    4e-10   Nicotiana sylvestris
ref|XP_009623844.1|  PREDICTED: glutamate--glyoxylate aminotransf...  65.1    4e-10   Nicotiana tomentosiformis
ref|XP_006348507.1|  PREDICTED: glutamate--glyoxylate aminotransf...  64.7    5e-10   
gb|EPS68501.1|  hypothetical protein M569_06265                       64.7    5e-10   Genlisea aurea
ref|XP_004239121.1|  PREDICTED: glutamate--glyoxylate aminotransf...  64.7    6e-10   Solanum lycopersicum
ref|XP_006357614.1|  PREDICTED: glutamate--glyoxylate aminotransf...  64.7    6e-10   Solanum tuberosum [potatoes]
ref|XP_011071137.1|  PREDICTED: glutamate--glyoxylate aminotransf...  64.3    8e-10   
ref|XP_011086618.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...  63.9    1e-09   
ref|XP_004228555.1|  PREDICTED: glutamate--glyoxylate aminotransf...  63.5    1e-09   Solanum lycopersicum
gb|EYU28421.1|  hypothetical protein MIMGU_mgv1a005535mg              63.5    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_010552672.1|  PREDICTED: glutamate--glyoxylate aminotransf...  62.0    5e-09   Tarenaya hassleriana [spider flower]
emb|CDP13207.1|  unnamed protein product                              61.6    7e-09   Coffea canephora [robusta coffee]
ref|XP_006307377.1|  hypothetical protein CARUB_v10009003mg           61.2    1e-08   Capsella rubella
ref|XP_010498838.1|  PREDICTED: glutamate--glyoxylate aminotransf...  61.2    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010460118.1|  PREDICTED: glutamate--glyoxylate aminotransf...  61.2    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010682426.1|  PREDICTED: glutamate--glyoxylate aminotransf...  60.8    1e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002893277.1|  alanine-2-oxoglutarate aminotransferase 1        60.8    1e-08   
ref|XP_006658210.1|  PREDICTED: glutamate--glyoxylate aminotransf...  60.8    1e-08   
ref|XP_010477627.1|  PREDICTED: glutamate--glyoxylate aminotransf...  60.8    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009115544.1|  PREDICTED: glutamate--glyoxylate aminotransf...  60.5    1e-08   Brassica rapa
gb|AAO84040.1|  alanine aminotransferase                              60.5    1e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001058716.1|  Os07g0108300                                     60.5    2e-08   
ref|XP_006390865.1|  hypothetical protein EUTSA_v10018474mg           60.5    2e-08   
ref|NP_564192.2|  glutamate:glyoxylate aminotransferase               60.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAK25905.1|AF360195_1  putative alanine aminotransferase           60.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20108.1|  AT1G70580                                            60.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24255.1|  At1g23310/F26F24_4                                    60.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25781.1|  BnaA07g10010D                                        56.6    2e-08   Brassica napus [oilseed rape]
ref|NP_177215.1|  glutamate--glyoxylate aminotransferase 2            60.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61453.1|  putative alanine aminotransferase                     60.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887312.1|  alanine-2-oxoglutarate aminotransferase 2        60.1    2e-08   Arabidopsis lyrata subsp. lyrata
emb|CDY61225.1|  BnaC06g43710D                                        60.1    2e-08   Brassica napus [oilseed rape]
ref|XP_006416099.1|  hypothetical protein EUTSA_v10007514mg           60.1    2e-08   
ref|XP_009105727.1|  PREDICTED: glutamate--glyoxylate aminotransf...  60.1    2e-08   Brassica rapa
emb|CDY66294.1|  BnaAnng22050D                                        60.1    3e-08   Brassica napus [oilseed rape]
ref|XP_009105726.1|  PREDICTED: glutamate--glyoxylate aminotransf...  60.1    3e-08   Brassica rapa
ref|XP_002312679.2|  alanine-2-oxoglutarate aminotransferase 1 fa...  59.7    3e-08   Populus trichocarpa [western balsam poplar]
gb|KDP26646.1|  hypothetical protein JCGZ_17804                       59.7    3e-08   Jatropha curcas
gb|AFK37995.1|  unknown                                               55.8    4e-08   Lotus japonicus
ref|XP_008447004.1|  PREDICTED: glutamate--glyoxylate aminotransf...  58.9    4e-08   
ref|NP_001151209.1|  alanine aminotransferase 2                       59.3    4e-08   
ref|XP_010471056.1|  PREDICTED: glutamate--glyoxylate aminotransf...  59.3    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004309987.1|  PREDICTED: glutamate--glyoxylate aminotransf...  59.3    4e-08   Fragaria vesca subsp. vesca
ref|NP_001031083.1|  glutamate:glyoxylate aminotransferase            58.9    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300456.1|  hypothetical protein CARUB_v10020212mg           59.3    5e-08   
ref|XP_010415743.1|  PREDICTED: glutamate--glyoxylate aminotransf...  59.3    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009103182.1|  PREDICTED: glutamate--glyoxylate aminotransf...  58.9    5e-08   Brassica rapa
ref|XP_010427837.1|  PREDICTED: glutamate--glyoxylate aminotransf...  58.9    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004489786.1|  PREDICTED: glutamate--glyoxylate aminotransf...  58.9    5e-08   
ref|XP_007222799.1|  hypothetical protein PRUPE_ppa005017mg           58.9    5e-08   Prunus persica
gb|AAZ43368.1|  AlaT1                                                 58.9    6e-08   Vitis labrusca [Concord grape]
emb|CBI23368.3|  unnamed protein product                              58.9    6e-08   Vitis vinifera
emb|CAN62302.1|  hypothetical protein VITISV_023686                   58.9    6e-08   Vitis vinifera
ref|XP_008221924.1|  PREDICTED: glutamate--glyoxylate aminotransf...  58.9    6e-08   Prunus mume [ume]
ref|XP_004955317.1|  PREDICTED: glutamate--glyoxylate aminotransf...  58.9    6e-08   Setaria italica
emb|CDY12474.1|  BnaC07g13140D                                        58.9    6e-08   Brassica napus [oilseed rape]
ref|XP_010023477.1|  PREDICTED: glutamate--glyoxylate aminotransf...  58.9    6e-08   Eucalyptus grandis [rose gum]
ref|NP_001268094.1|  uncharacterized protein LOC100261274             58.9    7e-08   Vitis vinifera
ref|XP_011014669.1|  PREDICTED: glutamate--glyoxylate aminotransf...  58.5    7e-08   Populus euphratica
ref|XP_006416098.1|  hypothetical protein EUTSA_v10007514mg           58.2    7e-08   
ref|XP_008340115.1|  PREDICTED: glutamate--glyoxylate aminotransf...  58.5    7e-08   Malus domestica [apple tree]
ref|XP_009359228.1|  PREDICTED: glutamate--glyoxylate aminotransf...  58.5    7e-08   Pyrus x bretschneideri [bai li]
ref|XP_002315675.1|  hypothetical protein POPTR_0010s05530g           58.5    7e-08   Populus trichocarpa [western balsam poplar]
ref|XP_003557680.1|  PREDICTED: glutamate--glyoxylate aminotransf...  58.5    8e-08   Brachypodium distachyon [annual false brome]
ref|XP_004955316.1|  PREDICTED: glutamate--glyoxylate aminotransf...  58.5    9e-08   
ref|XP_002527918.1|  alanine aminotransferase, putative               58.2    1e-07   
gb|KGN51767.1|  hypothetical protein Csa_5G598750                     58.2    1e-07   Cucumis sativus [cucumbers]
ref|XP_004489787.1|  PREDICTED: glutamate--glyoxylate aminotransf...  58.2    1e-07   Cicer arietinum [garbanzo]
ref|XP_003613139.1|  Alanine aminotransferase                         58.2    1e-07   Medicago truncatula
ref|XP_010100388.1|  Glutamate--glyoxylate aminotransferase 2         57.8    1e-07   Morus notabilis
gb|KJB31175.1|  hypothetical protein B456_005G179600                  57.8    1e-07   Gossypium raimondii
gb|KDO82251.1|  hypothetical protein CISIN_1g041151mg                 57.8    1e-07   Citrus sinensis [apfelsine]
gb|KHG15331.1|  Glutamate--glyoxylate aminotransferase 2 -like pr...  57.8    1e-07   Gossypium arboreum [tree cotton]
gb|EMS58349.1|  Alanine aminotransferase 2                            57.8    1e-07   Triticum urartu
emb|CDY41452.1|  BnaA08g20540D                                        57.8    1e-07   Brassica napus [oilseed rape]
ref|XP_003613140.1|  Alanine aminotransferase                         57.8    2e-07   
ref|XP_006438274.1|  hypothetical protein CICLE_v10031381mg           57.8    2e-07   Citrus clementina [clementine]
gb|KJB31170.1|  hypothetical protein B456_005G179600                  57.8    2e-07   Gossypium raimondii
ref|XP_009110107.1|  PREDICTED: glutamate--glyoxylate aminotransf...  57.8    2e-07   Brassica rapa
ref|XP_004135487.1|  PREDICTED: glutamate--glyoxylate aminotransf...  57.4    2e-07   
ref|XP_009406515.1|  PREDICTED: glutamate--glyoxylate aminotransf...  57.4    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004155366.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...  57.4    2e-07   
ref|XP_010927963.1|  PREDICTED: glutamate--glyoxylate aminotransf...  57.0    2e-07   Elaeis guineensis
gb|KGN51765.1|  hypothetical protein Csa_5G598730                     57.0    2e-07   Cucumis sativus [cucumbers]
ref|NP_001183048.1|  uncharacterized protein LOC100501386             57.0    2e-07   Zea mays [maize]
ref|XP_009413361.1|  PREDICTED: glutamate--glyoxylate aminotransf...  57.0    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007044762.1|  Alanine-2-oxoglutarate aminotransferase 2 is...  57.0    3e-07   
ref|XP_006378236.1|  hypothetical protein POPTR_0010s05530g           56.2    3e-07   
ref|XP_008444367.1|  PREDICTED: glutamate--glyoxylate aminotransf...  56.6    3e-07   Cucumis melo [Oriental melon]
ref|XP_006840828.1|  hypothetical protein AMTR_s00083p00031040        56.6    3e-07   Amborella trichopoda
ref|XP_010251104.1|  PREDICTED: glutamate--glyoxylate aminotransf...  56.6    4e-07   Nelumbo nucifera [Indian lotus]
tpg|DAA42656.1|  TPA: hypothetical protein ZEAMMB73_648980            56.6    4e-07   
ref|XP_008446998.1|  PREDICTED: glutamate--glyoxylate aminotransf...  55.1    4e-07   
ref|XP_008389735.1|  PREDICTED: glutamate--glyoxylate aminotransf...  56.6    4e-07   
ref|NP_001237567.1|  alanine aminotransferase 2                       56.2    5e-07   
gb|KHN14541.1|  Glutamate--glyoxylate aminotransferase 2              56.2    5e-07   Glycine soja [wild soybean]
ref|XP_003519649.1|  PREDICTED: glutamate--glyoxylate aminotransf...  56.2    5e-07   Glycine max [soybeans]
ref|XP_006438273.1|  hypothetical protein CICLE_v10031381mg           55.8    5e-07   
ref|NP_001237581.1|  alanine aminotransferase 3                       56.2    5e-07   Glycine max [soybeans]
ref|XP_010928898.1|  PREDICTED: glutamate--glyoxylate aminotransf...  56.2    5e-07   Elaeis guineensis
gb|KJB31174.1|  hypothetical protein B456_005G179600                  55.8    5e-07   Gossypium raimondii
ref|XP_008789746.1|  PREDICTED: glutamate--glyoxylate aminotransf...  56.2    5e-07   
gb|EMT29455.1|  Alanine aminotransferase 2                            56.2    5e-07   
tpg|DAA42658.1|  TPA: LOW QUALITY PROTEIN: alanine aminotransfera...  55.8    6e-07   
ref|XP_002968244.1|  hypothetical protein SELMODRAFT_145611           55.5    8e-07   Selaginella moellendorffii
gb|ABK25444.1|  unknown                                               54.7    2e-06   Picea sitchensis
gb|AET06145.1|  PLP-dependent aminotransferase                        54.3    2e-06   Papaver somniferum
ref|XP_004142968.1|  PREDICTED: glutamate--glyoxylate aminotransf...  53.9    3e-06   Cucumis sativus [cucumbers]
ref|XP_001782822.1|  predicted protein                                53.5    4e-06   
ref|XP_007158412.1|  hypothetical protein PHAVU_002G150800g           53.1    5e-06   Phaseolus vulgaris [French bean]
ref|XP_001777071.1|  predicted protein                                52.4    1e-05   
ref|XP_001763950.1|  predicted protein                                50.4    4e-05   



>ref|XP_009624740.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625366.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
Length=473

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYENLNENVKKCQYAVRGELYLRAS+LQ
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQ  34



>ref|XP_009759837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYENLNENVKKCQYAVRGELYLRAS+LQ
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQ  34



>ref|XP_009765091.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
sylvestris]
Length=481

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDY+NLNENVKKCQYAVRGELYLRASELQ
Sbjct  5    PLDYDNLNENVKKCQYAVRGELYLRASELQ  34



>ref|XP_009623844.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
tomentosiformis]
Length=481

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDY+NLNENVKKCQYAVRGELYLRASELQ
Sbjct  5    PLDYDNLNENVKKCQYAVRGELYLRASELQ  34



>ref|XP_006348507.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=476

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYENLNENVKKCQYAVRGELYLRAS+LQ
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQ  34



>gb|EPS68501.1| hypothetical protein M569_06265, partial [Genlisea aurea]
Length=481

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYENLNENVKKCQYAVRGELYLRASELQ
Sbjct  3    PLDYENLNENVKKCQYAVRGELYLRASELQ  32



>ref|XP_004239121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Solanum 
lycopersicum]
Length=481

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYENLNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQ  34



>ref|XP_006357614.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=481

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYENLNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQ  34



>ref|XP_011071137.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Sesamum 
indicum]
Length=481

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYENLNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQ  34



>ref|XP_011086618.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Sesamum indicum]
Length=478

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYENLNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQ  34



>ref|XP_004228555.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
lycopersicum]
Length=473

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYENLNENVKKCQYAVRGELYLRAS+LQ
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQ  34



>gb|EYU28421.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
 gb|EYU28422.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
Length=480

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/29 (97%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            +DYENLNENVKKCQYAVRGELYLRASELQ
Sbjct  5    MDYENLNENVKKCQYAVRGELYLRASELQ  33



>ref|XP_010552672.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Tarenaya 
hassleriana]
Length=481

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/29 (97%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKKCQYAVRGELYLRASELQ  34



>emb|CDP13207.1| unnamed protein product [Coffea canephora]
Length=481

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYENLN+NVK+CQYAVRGELYLRASELQ
Sbjct  5    PLDYENLNKNVKECQYAVRGELYLRASELQ  34



>ref|XP_006307377.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
 gb|EOA40275.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
Length=481

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY+ LNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQ  34



>ref|XP_010498838.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498839.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498840.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY++LNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQ  34



>ref|XP_010460118.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY++LNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQ  34



>ref|XP_010682426.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682427.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE LNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYELLNENVKKCQYAVRGELYLRASELQ  34



>ref|XP_002893277.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69536.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=481

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY+ LNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQ  34



>ref|XP_006658210.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Oryza 
brachyantha]
Length=494

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE LNENVKK QYAVRGELYLRASELQ
Sbjct  15   PLDYEELNENVKKVQYAVRGELYLRASELQ  44



>ref|XP_010477627.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Camelina 
sativa]
Length=481

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY++LNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQ  34



>ref|XP_009115544.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
 emb|CDY44130.1| BnaA09g31220D [Brassica napus]
 emb|CDY04729.1| BnaC05g18600D [Brassica napus]
Length=478

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            L+YE+LNENVKKCQYAVRGELYLRASELQ
Sbjct  3    LEYESLNENVKKCQYAVRGELYLRASELQ  31



>gb|AAO84040.1| alanine aminotransferase [Oryza sativa Indica Group]
Length=484

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE LNENVKK QYAVRGELYLRASELQ
Sbjct  11   PLDYEELNENVKKVQYAVRGELYLRASELQ  40



>ref|NP_001058716.1| Os07g0108300 [Oryza sativa Japonica Group]
 dbj|BAD30627.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF20630.1| Os07g0108300 [Oryza sativa Japonica Group]
 gb|EAZ02507.1| hypothetical protein OsI_24612 [Oryza sativa Indica Group]
 gb|EAZ38438.1| hypothetical protein OsJ_22816 [Oryza sativa Japonica Group]
 dbj|BAG90568.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE LNENVKK QYAVRGELYLRASELQ
Sbjct  12   PLDYEELNENVKKVQYAVRGELYLRASELQ  41



>ref|XP_006390865.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390866.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390867.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390868.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28151.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28152.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28153.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28154.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
Length=481

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVK CQYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQ  34



>ref|NP_564192.2| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q9LR30.1|GGT1_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 1; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT1; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT1; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis 
thaliana]
 gb|AAF87015.1|AC005292_24 F26F24.16 [Arabidopsis thaliana]
 gb|AAN62332.1|AF479639_1 glutamate:glyoxylate aminotransferase 1 [Arabidopsis thaliana]
 gb|AAL08235.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAN12918.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AEE30370.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=481

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY+ LNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQ  34



>gb|AAK25905.1|AF360195_1 putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY+ LNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQ  34



>dbj|BAH20108.1| AT1G70580 [Arabidopsis thaliana]
Length=481

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVK CQYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQ  34



>gb|AAL24255.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAO11559.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
Length=481

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY+ LNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQ  34



>emb|CDY25781.1| BnaA07g10010D [Brassica napus]
Length=58

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            L+Y++LNENVKKCQYAVRGELYLRASELQ
Sbjct  3    LEYDSLNENVKKCQYAVRGELYLRASELQ  31



>ref|NP_177215.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_974122.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031262.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031263.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9S7E9.1|GGT2_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 2; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT2; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT2; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis 
thaliana]
 gb|AAG52344.1|AC011663_23 putative alanine aminotransferase; 91367-88744 [Arabidopsis thaliana]
 gb|AAG52480.1|AC010796_19 putative alanine aminotransferase; 63135-65758 [Arabidopsis thaliana]
 gb|AAN62333.1|AF479640_1 glutamate:glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AAK59635.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AAL34156.1| putative alanine aminotransferase [Arabidopsis thaliana]
 dbj|BAH19506.1| AT1G70580 [Arabidopsis thaliana]
 gb|AEE35082.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35083.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35084.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35085.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
Length=481

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVK CQYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQ  34



>gb|AAM61453.1| putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVK CQYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQ  34



>ref|XP_002887312.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63571.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=482

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVK CQYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQ  34



>emb|CDY61225.1| BnaC06g43710D [Brassica napus]
Length=481

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVK CQYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQ  34



>ref|XP_006416099.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416100.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416101.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34452.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34453.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34454.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=478

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY+ LNENVKKCQYAVRGELYLRASELQ
Sbjct  3    LDYDALNENVKKCQYAVRGELYLRASELQ  31



>ref|XP_009105727.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Brassica rapa]
Length=481

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE LNENVK CQYAVRGELYLRASELQ
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQ  34



>emb|CDY66294.1| BnaAnng22050D [Brassica napus]
Length=481

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE LNENVK CQYAVRGELYLRASELQ
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQ  34



>ref|XP_009105726.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Brassica rapa]
Length=509

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE LNENVK CQYAVRGELYLRASELQ
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQ  34



>ref|XP_002312679.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
 gb|EEE90046.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
Length=481

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQ  34



>gb|KDP26646.1| hypothetical protein JCGZ_17804 [Jatropha curcas]
Length=481

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE+LNENVKK QYAVRGELYLRASELQ
Sbjct  5    PLDYESLNENVKKVQYAVRGELYLRASELQ  34



>gb|AFK37995.1| unknown [Lotus japonicus]
Length=83

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDY ++NENVKK QYAVRGELYLRASELQ
Sbjct  5    PLDYVSINENVKKAQYAVRGELYLRASELQ  34



>ref|XP_008447004.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=334

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE++NENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESINENVKKAQYAVRGELYLRASELQ  34



>ref|NP_001151209.1| alanine aminotransferase 2 [Zea mays]
 gb|ACG41981.1| alanine aminotransferase 2 [Zea mays]
Length=478

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE LNENVK+ QYAVRGELYLRASELQ
Sbjct  5    PLDYEELNENVKRVQYAVRGELYLRASELQ  34



>ref|XP_010471056.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY++LNENVK CQYAVRGELYLRASELQ
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQ  34



>ref|XP_004309987.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457416.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
Length=481

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQ  34



>ref|NP_001031083.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19579.1| AT1G23310 [Arabidopsis thaliana]
 gb|AEE30371.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=441

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY+ LNENVKKCQYAVRGELYLRASELQ
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQ  34



>ref|XP_006300456.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
 gb|EOA33354.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
Length=481

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY++LNENVK CQYAVRGELYLRASELQ
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQ  34



>ref|XP_010415743.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY++LNENVK CQYAVRGELYLRASELQ
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQ  34



>ref|XP_009103182.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
Length=478

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            L+Y++LNENVKKCQYAVRGELYLRASELQ
Sbjct  3    LEYDSLNENVKKCQYAVRGELYLRASELQ  31



>ref|XP_010427837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Camelina 
sativa]
Length=479

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY++LNENVK CQYAVRGELYLRASELQ
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQ  34



>ref|XP_004489786.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Cicer arietinum]
Length=497

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE++NENVKK QYAVRGELYLRA+ELQ
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQ  34



>ref|XP_007222799.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
 gb|EMJ23998.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
Length=481

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQ  34



>gb|AAZ43368.1| AlaT1 [Vitis labrusca]
Length=477

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQ  34



>emb|CBI23368.3| unnamed protein product [Vitis vinifera]
Length=481

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQ  34



>emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera]
Length=481

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQ  34



>ref|XP_008221924.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221925.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221927.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
Length=481

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQ  34



>ref|XP_004955317.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X2 [Setaria italica]
Length=478

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE LNENVKK QYAVRGELYLRASELQ
Sbjct  5    PLDYEELNENVKKVQYAVRGELYLRASELQ  34



>emb|CDY12474.1| BnaC07g13140D [Brassica napus]
Length=537

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            L+Y++LNENVKKCQYAVRGELYLRASELQ
Sbjct  68   LEYDSLNENVKKCQYAVRGELYLRASELQ  96



>ref|XP_010023477.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
 ref|XP_010023478.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
Length=481

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQ  34



>ref|NP_001268094.1| uncharacterized protein LOC100261274 [Vitis vinifera]
 gb|AAZ43369.1| AlaT1 [Vitis vinifera]
Length=484

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQ  34



>ref|XP_011014669.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Populus euphratica]
 ref|XP_011014670.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Populus euphratica]
Length=481

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQ  34



>ref|XP_006416098.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34451.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=357

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY+ LNENVKKCQYAVRGELYLRASELQ
Sbjct  3    LDYDALNENVKKCQYAVRGELYLRASELQ  31



>ref|XP_008340115.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
 ref|XP_008340116.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
Length=481

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQ  34



>ref|XP_009359228.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Pyrus x 
bretschneideri]
Length=481

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQ  34



>ref|XP_002315675.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|EEF01846.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=481

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQ  34



>ref|XP_003557680.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Brachypodium 
distachyon]
Length=479

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE LNENVKK QYAVRGELYLRASELQ
Sbjct  7    LDYEELNENVKKVQYAVRGELYLRASELQ  35



>ref|XP_004955316.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X1 [Setaria italica]
Length=539

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE LNENVKK QYAVRGELYLRASELQ
Sbjct  5    PLDYEELNENVKKVQYAVRGELYLRASELQ  34



>ref|XP_002527918.1| alanine aminotransferase, putative [Ricinus communis]
 gb|EEF34475.1| alanine aminotransferase, putative [Ricinus communis]
Length=452

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQ  34



>gb|KGN51767.1| hypothetical protein Csa_5G598750 [Cucumis sativus]
Length=474

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE++NENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESINENVKKAQYAVRGELYLRASELQ  34



>ref|XP_004489787.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Cicer arietinum]
Length=481

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE++NENVKK QYAVRGELYLRA+ELQ
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQ  34



>ref|XP_003613139.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96097.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=481

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE++NENVKK QYAVRGELYLRA+ELQ
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQ  34



>ref|XP_010100388.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
 gb|EXB82522.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
Length=481

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE++NENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESINENVKKTQYAVRGELYLRASELQ  34



>gb|KJB31175.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=495

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE +NENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQ  34



>gb|KDO82251.1| hypothetical protein CISIN_1g041151mg [Citrus sinensis]
Length=463

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE++NENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQ  34



>gb|KHG15331.1| Glutamate--glyoxylate aminotransferase 2 -like protein [Gossypium 
arboreum]
Length=481

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE +NENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQ  34



>gb|EMS58349.1| Alanine aminotransferase 2 [Triticum urartu]
Length=478

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYEELNENVKKVQYAVRGELYLRASELQ  34



>emb|CDY41452.1| BnaA08g20540D [Brassica napus]
Length=478

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            L+Y+ LNENVKKCQYAVRGELYLRASELQ
Sbjct  3    LEYDLLNENVKKCQYAVRGELYLRASELQ  31



>ref|XP_003613140.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96098.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=474

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE++NENVKK QYAVRGELYLRA+ELQ
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQ  34



>ref|XP_006438274.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438275.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438276.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438277.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438278.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006483938.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483939.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483940.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X3 [Citrus sinensis]
 gb|ESR51514.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51515.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51516.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51517.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51518.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=481

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE++NENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQ  34



>gb|KJB31170.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31171.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31172.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31173.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=481

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE +NENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQ  34



>ref|XP_009110107.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Brassica 
rapa]
Length=478

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            L+Y+ LNENVKKCQYAVRGELYLRASELQ
Sbjct  3    LEYDLLNENVKKCQYAVRGELYLRASELQ  31



>ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
Length=460

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY+++NENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQ  34



>ref|XP_009406515.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406516.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE+LNENVKK  YAVRGELYLRASELQ
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQ  34



>ref|XP_004155366.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Cucumis sativus]
Length=481

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY+++NENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQ  34



>ref|XP_010927963.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Elaeis guineensis]
Length=481

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE+LNENVKK  YAVRGELYLRASELQ
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQ  34



>gb|KGN51765.1| hypothetical protein Csa_5G598730 [Cucumis sativus]
Length=481

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDY+++NENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQ  34



>ref|NP_001183048.1| uncharacterized protein LOC100501386 [Zea mays]
 gb|ACR35540.1| unknown [Zea mays]
Length=479

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            P+DYE LNE VKK QYAVRGELYLRASELQ
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASELQ  35



>ref|XP_009413361.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413362.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE+LNENVKK  YAVRGELYLRASELQ
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQ  34



>ref|XP_007044762.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044763.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044764.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00594.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00595.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00596.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
Length=481

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LD+E+LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDHESLNENVKKVQYAVRGELYLRASELQ  34



>ref|XP_006378236.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|ERP56033.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=335

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQ  34



>ref|XP_008444367.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=473

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE++NEN+KK +YAVRGELYLRASELQ
Sbjct  5    PLDYESINENMKKVEYAVRGELYLRASELQ  34



>ref|XP_006840828.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
 gb|ERN02503.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
Length=481

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE+LNENVKK  YAVRGELYLRASELQ
Sbjct  5    PLDYESLNENVKKSVYAVRGELYLRASELQ  34



>ref|XP_010251104.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251105.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251106.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
Length=481

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE++NENVKK  YAVRGELYLRASELQ
Sbjct  5    PLDYESINENVKKVAYAVRGELYLRASELQ  34



>tpg|DAA42656.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
 tpg|DAA42657.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
Length=483

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            P+DYE LNE VKK QYAVRGELYLRAS+LQ
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASQLQ  35



>ref|XP_008446998.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
melo]
Length=234

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE++NE VKK QYAVRGELYLRASELQ
Sbjct  6    LDYESINETVKKAQYAVRGELYLRASELQ  34



>ref|XP_008389735.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Malus 
domestica]
Length=481

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE+LNE VKK QYAVRGELYLRASELQ
Sbjct  6    LDYESLNEKVKKVQYAVRGELYLRASELQ  34



>ref|NP_001237567.1| alanine aminotransferase 2 [Glycine max]
 gb|ABW17197.1| alanine aminotransferase 2 [Glycine max]
Length=481

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDY ++NENVKK QYAVRGELYLRASELQ
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQ  34



>gb|KHN14541.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDY ++NENVKK QYAVRGELYLRASELQ
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQ  34



>ref|XP_003519649.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
2 [Glycine max]
 gb|KHN00386.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDY ++NENVKK QYAVRGELYLRASELQ
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQ  34



>ref|XP_006438273.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51513.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=398

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE++NENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQ  34



>ref|NP_001237581.1| alanine aminotransferase 3 [Glycine max]
 gb|ABW17198.1| alanine aminotransferase 3 [Glycine max]
Length=480

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDY ++NENVKK QYAVRGELYLRASELQ
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQ  34



>ref|XP_010928898.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
 ref|XP_010928907.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
Length=481

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE+LNENVKK  YAVRGELY RASELQ
Sbjct  5    PLDYESLNENVKKVAYAVRGELYFRASELQ  34



>gb|KJB31174.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=395

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE +NENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQ  34



>ref|XP_008789746.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
 ref|XP_008789747.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
Length=481

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE+LNENVKK  YAVRGELYLRA+ELQ
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRAAELQ  34



>gb|EMT29455.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=523

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE LNENVKK QYAVRGELYLRASELQ
Sbjct  6    LDYEELNENVKKVQYAVRGELYLRASELQ  34



>tpg|DAA42658.1| TPA: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Zea mays]
Length=479

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            P+DYE LNE VKK QYAVRGELYLRAS+LQ
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASQLQ  35



>ref|XP_002968244.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
 ref|XP_002976136.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ23041.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ30498.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
Length=481

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LD +N+NENVKKC YAVRGELYLRASELQ
Sbjct  6    LDPDNINENVKKCVYAVRGELYLRASELQ  34



>gb|ABK25444.1| unknown [Picea sitchensis]
 gb|ABR16321.1| unknown [Picea sitchensis]
 gb|ABR17158.1| unknown [Picea sitchensis]
 gb|ACN40300.1| unknown [Picea sitchensis]
Length=480

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLDYE +NENVKK  YAVRGELYLRASELQ
Sbjct  5    PLDYECINENVKKVAYAVRGELYLRASELQ  34



>gb|AET06145.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=480

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LD+E LNENVK  QYAVRGELYLRASELQ
Sbjct  5    LDHETLNENVKNVQYAVRGELYLRASELQ  33



>ref|XP_004142968.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 ref|XP_004161062.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 gb|KGN62316.1| hypothetical protein Csa_2G349020 [Cucumis sativus]
Length=473

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            LDYE++NEN+KK +YAVRGELYLRAS+LQ
Sbjct  6    LDYESINENMKKVEYAVRGELYLRASQLQ  34



>ref|XP_001782822.1| predicted protein [Physcomitrella patens]
 gb|EDQ52399.1| predicted protein [Physcomitrella patens]
Length=480

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            +D ENLNENVKK  YAVRGELYLRASELQ
Sbjct  7    MDPENLNENVKKTVYAVRGELYLRASELQ  35



>ref|XP_007158412.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
 gb|ESW30406.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
Length=481

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQ  255
            PLD+  +NENVKK QYAVRGELYLRASELQ
Sbjct  5    PLDHALINENVKKSQYAVRGELYLRASELQ  34



>ref|XP_001777071.1| predicted protein [Physcomitrella patens]
 gb|EDQ58064.1| predicted protein [Physcomitrella patens]
Length=480

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            +D +NLNENVKK  YAVRGELYLRASELQ
Sbjct  7    MDPDNLNENVKKTVYAVRGELYLRASELQ  35



>ref|XP_001763950.1| predicted protein [Physcomitrella patens]
 gb|EDQ71354.1| predicted protein [Physcomitrella patens]
Length=480

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQ  255
            +D ENLN NVKK  YAVRGELYLRASELQ
Sbjct  7    MDPENLNLNVKKTVYAVRGELYLRASELQ  35



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552168806140