BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF010I06

Length=288
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO97994.1|  unnamed protein product                              67.8    8e-11   Coffea canephora [robusta coffee]
ref|XP_004235655.1|  PREDICTED: ruBisCO large subunit-binding pro...  58.5    1e-07   Solanum lycopersicum
gb|AAB39828.1|  chaperonin-60 beta subunit                            54.7    3e-07   Solanum tuberosum [potatoes]
ref|XP_002284134.1|  PREDICTED: ruBisCO large subunit-binding pro...  55.1    2e-06   Vitis vinifera
ref|XP_006343054.1|  PREDICTED: ruBisCO large subunit-binding pro...  54.7    3e-06   Solanum tuberosum [potatoes]
ref|XP_010254011.1|  PREDICTED: ruBisCO large subunit-binding pro...  53.9    5e-06   Nelumbo nucifera [Indian lotus]
ref|XP_011089709.1|  PREDICTED: ruBisCO large subunit-binding pro...  52.8    1e-05   Sesamum indicum [beniseed]
ref|XP_002523404.1|  rubisco subunit binding-protein beta subunit...  51.2    4e-05   Ricinus communis
ref|XP_010249575.1|  PREDICTED: ruBisCO large subunit-binding pro...  51.2    4e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010044926.1|  PREDICTED: chaperonin 60 subunit beta 2, chl...  49.3    1e-04   Eucalyptus grandis [rose gum]
gb|KCW87049.1|  hypothetical protein EUGRSUZ_B03593                   49.3    1e-04   Eucalyptus grandis [rose gum]
ref|XP_008809220.1|  PREDICTED: ruBisCO large subunit-binding pro...  49.3    2e-04   Phoenix dactylifera
gb|KJB56809.1|  hypothetical protein B456_009G136600                  48.9    2e-04   Gossypium raimondii
emb|CDP18583.1|  unnamed protein product                              47.8    5e-04   Coffea canephora [robusta coffee]



>emb|CDO97994.1| unnamed protein product [Coffea canephora]
Length=577

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 3/76 (4%)
 Frame = +2

Query  68   MASTFSAMSSLGAVVSAS-QTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SK  238
            MASTF+AMS +G+++S S  T +KK + SSE LSS  S+S N LGGRR+NV+LRKR   K
Sbjct  1    MASTFTAMSCVGSLISPSTSTADKKFVSSSEALSSLTSISANKLGGRRQNVILRKRLSCK  60

Query  239  VRAMAKDLYFNTDGSA  286
            V+AMAKDL+FN DGSA
Sbjct  61   VQAMAKDLHFNKDGSA  76



>ref|XP_004235655.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Solanum lycopersicum]
Length=605

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 59/75 (79%), Gaps = 5/75 (7%)
 Frame = +2

Query  68   MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  241
            MA+TF+++ S+    S SQT+EKK + S ETLSSF+ +S  +LGGRRKN VL+KR  SK+
Sbjct  1    MAATFTSVCSIS---STSQTVEKKIINSCETLSSFSGISLTSLGGRRKNNVLKKRNDSKI  57

Query  242  RAMAKDLYFNTDGSA  286
            +AMAK+L+FN DGSA
Sbjct  58   QAMAKELHFNQDGSA  72



>gb|AAB39828.1| chaperonin-60 beta subunit, partial [Solanum tuberosum]
Length=174

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 59/75 (79%), Gaps = 5/75 (7%)
 Frame = +2

Query  68   MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  241
            MA+TF+++ S   + S +QT++KK + SSETLSSF+ +S  +LGGRRKN VL+KR  SK+
Sbjct  1    MAATFTSVCS---IASTNQTVDKKFINSSETLSSFSGISLTSLGGRRKNKVLKKRNDSKI  57

Query  242  RAMAKDLYFNTDGSA  286
            +AMAK L+FN DGSA
Sbjct  58   QAMAKKLHFNQDGSA  72



>ref|XP_002284134.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 ref|XP_010654639.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Vitis vinifera]
 emb|CBI36094.3| unnamed protein product [Vitis vinifera]
Length=609

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 59/76 (78%), Gaps = 3/76 (4%)
 Frame = +2

Query  68   MASTFSAMSSLGAVVSAS-QTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS--K  238
            MAS+F+ MSS+G   S+S  T++KK L SS  LSSFAS+S N+  GR++++VL+KR   K
Sbjct  1    MASSFATMSSIGYFTSSSSHTMDKKFLGSSRRLSSFASISANSFEGRKQSMVLQKRCSPK  60

Query  239  VRAMAKDLYFNTDGSA  286
            VRAMAK+LYFN DGSA
Sbjct  61   VRAMAKELYFNKDGSA  76



>ref|XP_006343054.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Solanum tuberosum]
Length=605

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 59/75 (79%), Gaps = 5/75 (7%)
 Frame = +2

Query  68   MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  241
            MA+TF+++ S   + S +QT++KK + SSETLSSF+ +S  +LGGRRKN VL+KR  SK+
Sbjct  1    MAATFTSVCS---IASTNQTVDKKFINSSETLSSFSGISLTSLGGRRKNKVLKKRNDSKI  57

Query  242  RAMAKDLYFNTDGSA  286
            +AMAK L+FN DGSA
Sbjct  58   QAMAKKLHFNQDGSA  72



>ref|XP_010254011.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic-like [Nelumbo nucifera]
Length=608

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +2

Query  68   MASTFSAMSSLGAVVSA-SQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS-KV  241
            MAST + +SS+G++ +A ++ ++KK   S E LSSFAS+S ++LGGRR+NV+L +RS K+
Sbjct  1    MASTIATISSVGSLAAAGNRAVDKKLSSSLEKLSSFASISSSSLGGRRQNVILSRRSPKI  60

Query  242  RAMAKDLYFNTDGSA  286
             AMAK+LYFN DGSA
Sbjct  61   MAMAKELYFNKDGSA  75



>ref|XP_011089709.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Sesamum indicum]
Length=608

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +2

Query  68   MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKR--SKV  241
            MASTF+ MSS+G++ +    +    + +S +  S  +   ++  GRRKNVVLRK   S++
Sbjct  1    MASTFAGMSSVGSLAAPGSRVMDDKIAASSSKLSSLASISSSSLGRRKNVVLRKTRSSQI  60

Query  242  RAMAKDLYFNTDGSA  286
             A AKDLYFN DGSA
Sbjct  61   TAAAKDLYFNKDGSA  75



>ref|XP_002523404.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
 gb|EEF38983.1| rubisco subunit binding-protein beta subunit, rubb, putative 
[Ricinus communis]
Length=605

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 60/75 (80%), Gaps = 5/75 (7%)
 Frame = +2

Query  68   MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK-RS-KV  241
            MASTF+AMSS+G++V+ +  ++KK   +S  LSSFAS+S +A G RR+NVVLR+ RS K+
Sbjct  1    MASTFTAMSSVGSLVAPN--VDKKFASTSNRLSSFASISGSAFG-RRQNVVLRRSRSPKI  57

Query  242  RAMAKDLYFNTDGSA  286
             AMAKDL+FN DGSA
Sbjct  58   CAMAKDLHFNKDGSA  72



>ref|XP_010249575.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Nelumbo nucifera]
Length=609

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 58/76 (76%), Gaps = 3/76 (4%)
 Frame = +2

Query  68   MASTFSAMSSLGAV-VSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRKRS--K  238
            MAST + MSS+G++ V+ S+ ++KK   SSE LSSFAS+S ++  GRR NV+L +R   K
Sbjct  1    MASTIATMSSVGSLAVAGSRAMDKKFSSSSENLSSFASISSSSFSGRRHNVILSRRCFPK  60

Query  239  VRAMAKDLYFNTDGSA  286
            +RAMAK+LYFN DGSA
Sbjct  61   IRAMAKELYFNKDGSA  76



>ref|XP_010044926.1| PREDICTED: chaperonin 60 subunit beta 2, chloroplastic [Eucalyptus 
grandis]
 gb|KCW87050.1| hypothetical protein EUGRSUZ_B03593 [Eucalyptus grandis]
Length=608

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 2/75 (3%)
 Frame = +2

Query  68   MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK--RSKV  241
            MASTF+AMSS G + +    +  K L +S    S  S   ++  GRR+ V LRK    K+
Sbjct  1    MASTFTAMSSAGTLAAPGSCVMDKKLATSLDKLSSVSSISSSSFGRRRTVSLRKSREPKI  60

Query  242  RAMAKDLYFNTDGSA  286
             AMAKDLYFN DGSA
Sbjct  61   CAMAKDLYFNKDGSA  75



>gb|KCW87049.1| hypothetical protein EUGRSUZ_B03593 [Eucalyptus grandis]
Length=620

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 2/75 (3%)
 Frame = +2

Query  68   MASTFSAMSSLGAVVSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK--RSKV  241
            MASTF+AMSS G + +    +  K L +S    S  S   ++  GRR+ V LRK    K+
Sbjct  1    MASTFTAMSSAGTLAAPGSCVMDKKLATSLDKLSSVSSISSSSFGRRRTVSLRKSREPKI  60

Query  242  RAMAKDLYFNTDGSA  286
             AMAKDLYFN DGSA
Sbjct  61   CAMAKDLYFNKDGSA  75



>ref|XP_008809220.1| PREDICTED: ruBisCO large subunit-binding protein subunit beta, 
chloroplastic [Phoenix dactylifera]
Length=612

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 6/79 (8%)
 Frame = +2

Query  68   MASTFSAMSSLGAVVSASQTIEkkslkssetl----ssfaslsPNALGGRRKNVVLRKR-  232
            MASTFS MS++G+V + S  +  + L +S       SS AS S ++L GRR+N+ L+KR 
Sbjct  1    MASTFSTMSTIGSVAAPSSFVTDRKLSASAQKFSKLSSLASSSSSSLSGRRQNLHLQKRC  60

Query  233  -SKVRAMAKDLYFNTDGSA  286
             S +RAMAK+LYFN DGSA
Sbjct  61   NSGIRAMAKELYFNKDGSA  79



>gb|KJB56809.1| hypothetical protein B456_009G136600 [Gossypium raimondii]
 gb|KJB56810.1| hypothetical protein B456_009G136600 [Gossypium raimondii]
Length=609

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 57/76 (75%), Gaps = 3/76 (4%)
 Frame = +2

Query  68   MASTFSAMSSLGAV-VSASQTIEkkslkssetlssfaslsPNALGGRRKNVVLRK--RSK  238
            MAS+F AMSS+G++    S+ ++KK   SS  LSSF S+S +A  G+++ V+LR+   SK
Sbjct  1    MASSFIAMSSIGSLGFPCSKQMDKKFFNSSGRLSSFESISSSAFLGKKQKVILRRGHSSK  60

Query  239  VRAMAKDLYFNTDGSA  286
            +RAMAK+L+FNTDGSA
Sbjct  61   IRAMAKELHFNTDGSA  76



>emb|CDP18583.1| unnamed protein product [Coffea canephora]
Length=609

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +2

Query  68   MASTFSAMSSLGAVVSASQTI-EkkslkssetlssfaslsPNALGGRRKNVVLRKR--SK  238
            MASTF+ MSS+G++ + S  I +   L +S    S  +   ++  GR++NVVLRK   S+
Sbjct  1    MASTFAGMSSVGSLAAPSTCIIDNNKLAASSNKLSSLACISSSSFGRKRNVVLRKSRSSQ  60

Query  239  VRAMAKDLYFNTDGSA  286
            + A AK+LYFN DGSA
Sbjct  61   ITASAKELYFNKDGSA  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552217968300