BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF010H04

Length=352
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           214   1e-62   Ipomoea purpurea
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       209   6e-61   Ipomoea batatas [batate]
emb|CAJ41418.1|  phenylalanine ammonia-lyase 3                          190   3e-57   Coffea arabica [arabica coffee]
dbj|BAF98437.1|  phenylalanine ammonia-lyase                            189   5e-57   Glehnia littoralis
dbj|BAF98439.1|  phenylalanine ammonia-lyase                            186   6e-56   Glehnia littoralis
dbj|BAF98438.1|  phenylalanine ammonia-lyase                            186   7e-56   Glehnia littoralis
gb|AIB08913.1|  phenylalanine ammonia-lyase                             184   1e-55   Angelica sinensis [Chinese angelica]
gb|ACR56688.1|  phenylalanine ammonia-lyase                             194   2e-55   Scutellaria viscidula [zhan mao huang qin]
emb|CDP06747.1|  unnamed protein product                                190   9e-55   Coffea canephora [robusta coffee]
dbj|BAA95629.1|  phenylalanine ammonia lyase                            192   1e-54   Catharanthus roseus [chatas]
emb|CDP20698.1|  unnamed protein product                                191   1e-54   Coffea canephora [robusta coffee]
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     191   2e-54   Daucus carota [carrots]
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           191   2e-54   Coffea canephora [robusta coffee]
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           191   2e-54   Coffea arabica [arabica coffee]
sp|P35512.1|PALY_MALDO  RecName: Full=Phenylalanine ammonia-lyase       181   2e-54   Malus domestica [apple tree]
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       191   3e-54   Ipomoea batatas [batate]
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   190   3e-54   Ipomoea nil [qian niu]
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             190   4e-54   Nicotiana tomentosiformis
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           190   5e-54   Scutellaria baicalensis [Baikal skullcap]
gb|ABV71917.1|  PAL                                                     180   5e-54   Plectranthus scutellarioides
gb|ABV44807.1|  phenylalanine ammonia lyase 2                           182   1e-53   Eriobotrya japonica [loquat]
emb|CAA34715.1|  unnamed protein product                                187   1e-53   Petroselinum crispum
gb|AGO01924.1|  phenylalanine ammonia-lyase 1                           187   2e-53   Lycium barbarum [Duke of Argyll's teatree]
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     188   2e-53   Petroselinum crispum
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    188   2e-53   Petroselinum crispum
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           188   2e-53   Nicotiana attenuata
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             187   3e-53   Sesamum indicum [beniseed]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             187   3e-53   Nicotiana tomentosiformis
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       187   3e-53   Nicotiana tabacum [American tobacco]
gb|AEA72280.1|  phenylalanine ammonia-lyase                             187   4e-53   Angelica gigas
gb|AIZ76770.1|  PAL2                                                    182   4e-53   Pyrus pyrifolia [sha li]
gb|AIZ76768.1|  PAL2                                                    181   5e-53   Pyrus pyrifolia [sha li]
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             187   5e-53   Sesamum indicum [beniseed]
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     187   6e-53   Petroselinum crispum
gb|ACF94716.1|  phenylalanine ammonia lyase                             187   6e-53   Robinia pseudoacacia [black locust]
gb|AGT63063.1|  phenylalanine ammonia-lyase                             187   6e-53   Solanum tuberosum [potatoes]
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          186   8e-53   Populus euphratica
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   186   8e-53   Rehmannia glutinosa [Chinese foxglove]
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             186   9e-53   Nicotiana sylvestris
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           186   9e-53   Nicotiana attenuata
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            186   1e-52   Daucus carota [carrots]
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            186   1e-52   Daucus carota [carrots]
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   186   1e-52   Populus tremuloides
gb|ACF94717.1|  phenylalanine ammonia lyase                             179   1e-52   Robinia pseudoacacia [black locust]
gb|AEY94464.1|  phenylalanine ammonia-lyase                             180   2e-52   Prunella vulgaris
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        186   2e-52   
gb|AAC33966.1|  phenylalanine ammonia-lyase                             184   2e-52   Capsicum chinense [bonnet pepper]
gb|AID69536.1|  phenylalanine ammonia-lyase                             184   2e-52   Phlomoides rotata
gb|AGO01925.1|  phenylalanine ammonia-lyase 2                           184   2e-52   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           185   2e-52   
gb|AIZ76769.1|  PAL2                                                    182   3e-52   Pyrus pyrifolia [sha li]
gb|AFG30054.1|  phenylalanine ammonialyase                              185   3e-52   Malus hybrid cultivar
dbj|BAF79623.1|  phenylalanine ammonia-lyase                            174   3e-52   Fragaria x ananassa
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             185   3e-52   Solanum lycopersicum
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    184   4e-52   Capsicum annuum
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    184   4e-52   Solanum lycopersicum
ref|XP_003635685.1|  PREDICTED: phenylalanine ammonia-lyase             177   4e-52   Vitis vinifera
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     184   4e-52   Petroselinum crispum
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            184   4e-52   Melissa officinalis [sweet balm]
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             184   5e-52   Perilla frutescens [beefsteak-mint]
gb|AGF50184.1|  phenylalanine ammonia lyase                             176   5e-52   Salvia virgata
gb|AIZ76767.1|  PAL2                                                    183   6e-52   Pyrus pyrifolia [sha li]
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       184   6e-52   Digitalis lanata [Grecian foxglove]
gb|AET41698.1|  phenylalanine ammonia-lyase                             177   6e-52   Prunus salicina [Japanese plum]
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             184   7e-52   Plectranthus scutellarioides
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             184   9e-52   Pyrus x bretschneideri [bai li]
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           184   9e-52   
gb|ABK32083.1|  phenylalanine ammonia-lyase                             176   9e-52   Prunus armeniaca
gb|AGL50914.1|  phenylalanine ammonia lyase                             184   9e-52   Pyrus communis
gb|AGL81344.1|  phenylalanine ammonia lyase                             183   1e-51   Pyrus communis
gb|ABB70117.2|  phenylalanine ammonia lyase                             183   1e-51   Pyrus communis
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 183   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    183   1e-51   Pyrus x bretschneideri [bai li]
dbj|BAF79619.1|  phenylalanine ammonia-lyase                            172   1e-51   Fragaria x ananassa
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             183   1e-51   Nicotiana sylvestris
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       183   2e-51   Camellia sinensis [black tea]
gb|AGF50183.1|  phenylalanine ammonia lyase                             175   2e-51   Salvia hypoleuca
gb|AAU08174.1|  phenylalanine ammonia-lyase                             182   2e-51   Camellia sinensis [black tea]
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             182   2e-51   Populus tomentosa [Chinese white poplar]
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         182   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              182   2e-51   Ricinus communis
ref|XP_006367534.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      179   2e-51   
gb|AFC37247.1|  phenylalanine ammonia-lyase                             175   3e-51   Camellia chekiangoleosa
gb|AEE81750.1|  phenylalanine ammonia lyase                             182   3e-51   Morus alba var. multicaulis
gb|AID16077.1|  phenylalanine ammonium lyase                            182   3e-51   Morus alba
gb|AHY94892.1|  phenylalanine ammonia lyase                             182   3e-51   Prunella vulgaris
gb|AGO01926.1|  phenylalanine ammonia-lyase 3                           181   4e-51   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      182   4e-51   
gb|AIA66448.1|  PAL1                                                    182   4e-51   Capsicum annuum
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    182   4e-51   
gb|AAK60273.1|AF383150_1  phenylalanine ammonia-lyase 3                 175   4e-51   Manihot esculenta [manioc]
gb|AFU82540.1|  phenylalanine ammonia-lyase                             170   4e-51   Artemisia tridentata [big sagebrush]
dbj|BAF79622.1|  phenylalanine ammonia-lyase                            171   5e-51   Fragaria x ananassa
gb|AEX32784.1|  phenylalanine ammonia-lyase                             181   6e-51   Vitis vinifera
sp|P45735.1|PALY_VITVI  RecName: Full=Phenylalanine ammonia-lyase       177   6e-51   Vitis vinifera
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        181   6e-51   Cicer arietinum [garbanzo]
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        181   7e-51   Vitis vinifera
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           181   7e-51   Salvia miltiorrhiza [Chinese salvia]
gb|AIE16710.1|  phenylalanine ammonia-lyase                             172   8e-51   Glycine max [soybeans]
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        181   8e-51   Vitis vinifera
gb|KJB36583.1|  hypothetical protein B456_006G166000                    181   9e-51   Gossypium raimondii
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       180   1e-50   Nicotiana tabacum [American tobacco]
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      180   1e-50   
gb|AFS28702.1|  putative phenylalanine ammonia-lyase                    179   1e-50   Olea europaea
gb|ABD73282.1|  phenylalanine ammonia-lyase                             180   1e-50   Salvia miltiorrhiza [Chinese salvia]
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     180   1e-50   Solanum tuberosum [potatoes]
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             180   1e-50   Vitis vinifera
gb|AGA84059.1|  phenylalanine ammonia lyase                             180   1e-50   Picrorhiza kurrooa
dbj|BAF36975.1|  phenylalanine ammonia-lyase                            173   1e-50   Lotus japonicus
gb|AGF50182.1|  phenylalanine ammonia lyase                             172   2e-50   Salvia officinalis
gb|ACM62741.1|  phenylalanine ammonia-lyase                             180   2e-50   Garcinia mangostana [mangosteen]
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 179   2e-50   Manihot esculenta [manioc]
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          180   2e-50   Cynara cardunculus var. scolymus [artichoke]
emb|CAG27616.1|  putative phenylalanine ammonia-lyase                   170   2e-50   Populus x canadensis [Canadian poplar]
gb|ADI40166.1|  phenylalanine ammonia-lyase                             179   2e-50   Morus alba
gb|ABM67591.1|  phenylalanin ammonia-lyase                              179   3e-50   Vitis vinifera
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             179   3e-50   Vitis vinifera
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           179   3e-50   Prunus mume [ume]
gb|AJO53273.1|  phenylalanine ammonia-lyase                             179   3e-50   Pogostemon cablin
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        179   3e-50   Vitis vinifera
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             179   3e-50   Vitis vinifera
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           179   3e-50   Manihot esculenta [manioc]
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        179   3e-50   Vitis vinifera
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             179   3e-50   Olea europaea
ref|XP_007027354.1|  PHE ammonia lyase 1                                179   3e-50   Theobroma cacao [chocolate]
ref|XP_010107519.1|  Phenylalanine ammonia-lyase                        177   3e-50   
sp|Q40910.1|PAL4_POPKI  RecName: Full=Phenylalanine ammonia-lyase G4    178   3e-50   Populus sieboldii x Populus grandidentata
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             179   3e-50   Populus euphratica
gb|AEX32790.1|  phenylalanine ammonia-lyase                             179   3e-50   Vitis vinifera
gb|AFP24940.1|  phenylalanine ammonia lyase                             179   3e-50   Prunus salicina [Japanese plum]
gb|AFN85669.1|  phenylalanine ammonia-lyase                             179   3e-50   Hibiscus cannabinus [bimli-jute]
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             179   4e-50   Vitis vinifera
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     179   4e-50   Prunus avium [gean]
pir||S60043  phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanes...    178   4e-50
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             179   4e-50   
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            179   4e-50   Lotus japonicus
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             179   4e-50   Vitis vinifera
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             179   4e-50   Vitis vinifera
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            179   5e-50   Lotus japonicus
gb|ADO64252.1|  PAL                                                     178   6e-50   Epimedium sagittatum
gb|AIE16718.1|  phenylalanine ammonia-lyase                             169   7e-50   Glycine soja [wild soybean]
gb|ACR15762.1|  phenylalanine ammonia-lyase                             178   8e-50   Litchi chinensis [litchi]
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             178   8e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        178   9e-50   
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        178   9e-50   Solanum tuberosum [potatoes]
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           178   9e-50   Scutellaria baicalensis [Baikal skullcap]
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        178   1e-49   Morus notabilis
gb|ABI79307.1|  phenylalanine ammonia-lyase                             170   1e-49   Pyrus communis
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        177   1e-49   Solanum tuberosum [potatoes]
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    177   1e-49   Solanum lycopersicum
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            177   1e-49   Populus sieboldii x Populus grandidentata
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   177   1e-49   Populus tremuloides
gb|AEW25950.1|  phenylalanine ammonia-lyase                             173   1e-49   Medicago sativa subsp. x varia
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     177   1e-49   Nicotiana tomentosiformis
gb|KHN00850.1|  Phenylalanine ammonia-lyase 2                           177   1e-49   Glycine soja [wild soybean]
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       177   1e-49   Pisum sativum [garden pea]
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             177   1e-49   Gossypium arboreum [tree cotton]
prf||2001451A  Phe ammonia lyase                                        177   1e-49
gb|AIY26016.1|  PAL                                                     177   1e-49   Jasminum sambac [Arabian jasmine]
ref|XP_007162755.1|  hypothetical protein PHAVU_001G1777000g            169   2e-49   Phaseolus vulgaris [French bean]
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       177   2e-49   Pisum sativum [garden pea]
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             177   2e-49   Prunus persica
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        177   2e-49   Solanum tuberosum [potatoes]
emb|CAN61378.1|  hypothetical protein VITISV_032212                     177   2e-49   Vitis vinifera
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                177   2e-49   Erythranthe guttata [common monkey flower]
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        177   2e-49   Nicotiana sylvestris
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             177   2e-49   Gossypium arboreum [tree cotton]
gb|AJO53274.1|  phenylalanine ammonia-lyase                             177   2e-49   Pogostemon cablin
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    177   2e-49   Solanum tuberosum [potatoes]
ref|XP_003625662.1|  Phenylalanine ammonia-lyase                        174   2e-49   
gb|ADD12041.1|  phenylalanine ammonia lyase                             177   3e-49   Cistanche deserticola
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    177   3e-49   
emb|CAN77065.1|  hypothetical protein VITISV_009233                     176   3e-49   Vitis vinifera
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                176   3e-49   Erythranthe guttata [common monkey flower]
sp|O04058.2|PALY_HELAN  RecName: Full=Phenylalanine ammonia-lyase       176   3e-49   Helianthus annuus
gb|KJB46525.1|  hypothetical protein B456_007G373600                    176   3e-49   Gossypium raimondii
dbj|BAF36969.1|  phenylalanine ammonia-lyase                            173   3e-49   Lotus japonicus
gb|ACC63889.1|  phenylalanine ammonia-lyase                             176   3e-49   Populus trichocarpa [western balsam poplar]
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    176   3e-49   Glycine max [soybeans]
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 176   3e-49   Manihot esculenta [manioc]
gb|ABK32084.1|  phenylalanine ammonia-lyase                             169   3e-49   Prunus cerasifera x Prunus munsoniana
gb|ABV44808.1|  phenylalanine ammonia lyase 1                           171   3e-49   Eriobotrya japonica [loquat]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             176   3e-49   Populus szechuanica
gb|KHN17149.1|  Phenylalanine ammonia-lyase 2                           176   4e-49   Glycine soja [wild soybean]
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              176   4e-49   Ricinus communis
gb|AGY49231.1|  phenylalanine ammonia lyase                             176   4e-49   Ricinus communis
gb|KJB46526.1|  hypothetical protein B456_007G373700                    176   4e-49   Gossypium raimondii
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    176   4e-49   Populus euphratica
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     176   4e-49   Nicotiana sylvestris
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      176   4e-49   Glycine max [soybeans]
ref|XP_010107516.1|  Phenylalanine ammonia-lyase 1                      174   4e-49   
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         176   5e-49   Populus euphratica
gb|ADR78835.1|  phenylalanine ammonia lyase                             175   5e-49   Ziziphus jujuba [Chinese jujube]
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         176   5e-49   Populus trichocarpa [western balsam poplar]
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       176   5e-49   Populus trichocarpa [western balsam poplar]
dbj|BAF36973.1|  phenylalanine ammonia-lyase                            175   6e-49   Lotus japonicus
gb|ADB44001.1|  phenylalanine ammonia lyase                             164   6e-49   Mangifera indica
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    176   6e-49   Populus euphratica
emb|CAL91038.1|  phenylalanine ammonia-lyase 4                          170   6e-49   Cynara cardunculus var. scolymus [artichoke]
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           176   6e-49   Ageratina adenophora
gb|AEW25958.1|  phenylalanine ammonia-lyase                             173   6e-49   Medicago sativa subsp. x varia
gb|AEW26014.1|  phenylalanine ammonia-lyase                             173   6e-49   Medicago sativa subsp. x varia
gb|AEW25999.1|  phenylalanine ammonia-lyase                             173   6e-49   Medicago falcata [sickle alfalfa]
gb|AEW25988.1|  phenylalanine ammonia-lyase                             173   6e-49   Medicago falcata [sickle alfalfa]
gb|ACV30588.1|  phenylalanine ammonia-lyase                             168   6e-49   Carica papaya [mamon]
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   176   6e-49   Agastache rugosa
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            176   6e-49   Lotus japonicus
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            176   6e-49   Lotus japonicus
gb|AFK47120.1|  unknown                                                 166   6e-49   Lotus japonicus
gb|AEW25959.1|  phenylalanine ammonia-lyase                             173   6e-49   Medicago falcata [sickle alfalfa]
gb|AEW25957.1|  phenylalanine ammonia-lyase                             173   6e-49   Medicago falcata [sickle alfalfa]
gb|AEW25989.1|  phenylalanine ammonia-lyase                             173   6e-49   Medicago falcata [sickle alfalfa]
gb|AEW25949.1|  phenylalanine ammonia-lyase                             173   7e-49   Medicago sativa subsp. caerulea
gb|AEW26006.1|  phenylalanine ammonia-lyase                             173   7e-49   Medicago falcata [sickle alfalfa]
gb|ACS71953.1|  phenylalanine ammonia-lyase                             176   7e-49   Euphorbia pulcherrima
gb|AEW25984.1|  phenylalanine ammonia-lyase                             173   7e-49   Medicago falcata [sickle alfalfa]
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             176   7e-49   Capsella rubella
gb|ACM44926.1|  phenylalanine ammonia-lyase                             176   7e-49   Euphorbia pulcherrima
gb|AEW25997.1|  phenylalanine ammonia-lyase                             173   7e-49   Medicago falcata [sickle alfalfa]
gb|ABN79671.2|  phenylalanine ammonia-lyase                             176   7e-49   Rudbeckia hirta
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       175   7e-49   Citrus limon [lemon]
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            175   7e-49   Lotus japonicus
gb|AAQ74878.1|  phenylalanine ammonia lyase                             175   8e-49   Populus trichocarpa x Populus deltoides
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 175   8e-49   Rubus idaeus [European raspberry]
ref|XP_002862326.1|  predicted protein                                  166   8e-49   
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                175   9e-49   Medicago truncatula
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                175   1e-48   Medicago truncatula
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        175   1e-48   Populus euphratica
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           175   1e-48   Prunus domestica
ref|XP_004253518.1|  PREDICTED: phenylalanine ammonia-lyase-like        174   1e-48   
gb|ABD42947.1|  phenylalanine ammonia lyase                             175   1e-48   Acacia auriculiformis x Acacia mangium
pir||JQ1070  phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  ...    171   1e-48
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             174   2e-48   Citrus clementina [clementine]
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    174   2e-48   Populus sieboldii x Populus grandidentata
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         174   2e-48   Populus trichocarpa [western balsam poplar]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   174   2e-48   Citrus sinensis [apfelsine]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         174   2e-48   Populus trichocarpa [western balsam poplar]
gb|ACE95170.1|  phenylalanine ammonia-lyase                             174   2e-48   Populus tomentosa [Chinese white poplar]
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      174   2e-48   Brassica rapa
gb|AIL23235.1|  phenylalanine ammonia-lyase                             174   2e-48   Astragalus chrysochlorus
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      174   2e-48   Camelina sativa [gold-of-pleasure]
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      174   2e-48   Cicer arietinum [garbanzo]
gb|KDO50672.1|  hypothetical protein CISIN_1g037382mg                   173   2e-48   Citrus sinensis [apfelsine]
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       174   2e-48   Stylosanthes humilis [alfafinha do nordeste]
gb|ABR14606.1|  phenylalanine ammonia-lyase                             174   2e-48   Salvia miltiorrhiza [Chinese salvia]
emb|CAB42793.1|  phenylalanine-ammonia lyase                            174   2e-48   Citrus clementina x Citrus reticulata
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             174   2e-48   Populus tomentosa [Chinese white poplar]
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        174   2e-48   Citrus sinensis [apfelsine]
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           174   2e-48   Fragaria vesca subsp. vesca
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           174   3e-48   Populus tomentosa [Chinese white poplar]
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       174   3e-48   Medicago sativa [alfalfa]
gb|EPS61109.1|  phenylalanine ammonia-lyase                             174   3e-48   Genlisea aurea
dbj|BAM28965.1|  phenylalanine ammonia lyase                            167   3e-48   Lilium hybrid division I
gb|AAX84839.1|  phenylalanine ammonia-lyase                             174   3e-48   Astragalus mongholicus
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        174   3e-48   Solanum tuberosum [potatoes]
gb|KJB62426.1|  hypothetical protein B456_009G416300                    174   3e-48   Gossypium raimondii
gb|ACF94715.1|  phenylalanine ammonia lyase                             168   3e-48   Robinia pseudoacacia [black locust]
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             174   3e-48   Eutrema salsugineum [saltwater cress]
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             174   3e-48   Populus tomentosa [Chinese white poplar]
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             174   3e-48   
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             173   4e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      173   4e-48   
gb|AFQ92048.1|  phenylalanine ammonia-lyase                             165   4e-48   Pyrus pyrifolia [sha li]
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           173   4e-48   Rhizophora mangle
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           173   4e-48   Camelina sativa [gold-of-pleasure]
gb|AEW25981.1|  phenylalanine ammonia-lyase                             171   5e-48   Medicago sativa subsp. caerulea
gb|AGU91428.1|  phenylalanine ammonia-lyase                             173   5e-48   Chrysanthemum boreale
gb|ABE03772.1|  phenylalanine ammonia-lyase                             173   5e-48   Arnebia euchroma
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             173   6e-48   
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        172   6e-48   Medicago truncatula
gb|AAA34179.2|  phenylalanine ammonia lyase                             172   7e-48   Solanum lycopersicum
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    172   7e-48   Solanum lycopersicum
gb|AIB06732.1|  phenylalanine ammonia lyase                             172   8e-48   Mangifera indica
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           172   9e-48   Glycine soja [wild soybean]
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             172   9e-48   Gossypium arboreum [tree cotton]
dbj|BAD94354.1|  phenylalanine ammonia lyase                            167   9e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AEW25956.1|  phenylalanine ammonia-lyase                             170   9e-48   Medicago sativa subsp. caerulea
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     172   1e-47   Nicotiana tomentosiformis
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      172   1e-47   
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             172   1e-47   
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    172   1e-47   
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    172   1e-47   
gb|KGN52971.1|  hypothetical protein Csa_4G008250                       164   1e-47   
gb|KHN39030.1|  Phenylalanine ammonia-lyase class 2                     171   1e-47   
gb|AAF17247.1|AF206634_1  phenylalanine ammonia lyase                   167   1e-47   
gb|AAR31107.1|  phenylalanine ammonia-lyase                             172   1e-47   
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            172   1e-47   
gb|KJB73539.1|  hypothetical protein B456_011G238400                    172   1e-47   
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    172   1e-47   
emb|CDX74991.1|  BnaA05g07370D                                          167   1e-47   
gb|AEH02821.1|  phenylalanine ammonia lyase                             171   2e-47   
gb|AGE10589.1|  phenylalanine amononia-lyase                            171   2e-47   
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             171   2e-47   
ref|XP_006439143.1|  hypothetical protein CICLE_v10010874mg             165   2e-47   
emb|CDX91331.1|  BnaC04g08190D                                          167   2e-47   
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          171   2e-47   
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    171   2e-47   
gb|AEX09407.1|  phenylalanine ammonia-lyase                             164   2e-47   
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      171   2e-47   
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             171   2e-47   
gb|KJB16792.1|  hypothetical protein B456_002G248000                    171   2e-47   
gb|AAY82485.1|  phenylalanine ammonia-lyase                             169   2e-47   
gb|AFU90757.1|  phenylalanine ammonia-lyase                             171   2e-47   
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     171   2e-47   
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             171   2e-47   
gb|ACR10243.1|  phenylalanine ammonia-lyase                             171   2e-47   
gb|AIA24411.1|  phenylalanine ammonia-lyase                             171   3e-47   
gb|ABF50788.1|  phenylalanine ammonia-lyase                             171   3e-47   
gb|AGV54597.1|  phenylalanine ammonia-lyase                             171   3e-47   
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             171   3e-47   
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    171   3e-47   
gb|AEW26003.1|  phenylalanine ammonia-lyase                             169   3e-47   
gb|AER12109.1|  PAL                                                     171   4e-47   
gb|AGH13333.1|  phenylalanine ammonia-lyase                             171   4e-47   
gb|ACX31148.1|  phenylalanine ammonialyase                              170   4e-47   
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           171   4e-47   
gb|AAY82486.1|  phenylalanine ammonia-lyase                             170   4e-47   
gb|ABI33979.1|  phenylalanine ammonia lyase                             170   4e-47   
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             170   4e-47   
dbj|BAM28963.1|  phenylalanine ammonia lyase                            170   5e-47   
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 170   5e-47   
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      170   6e-47   
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            170   6e-47   
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      170   6e-47   
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           170   6e-47   
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    170   7e-47   
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           170   7e-47   
gb|ACZ36441.1|  phenylalanine ammonialyase                              170   7e-47   
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    170   7e-47   
gb|AAX22055.1|  phenylalanine ammonia-lyase                             170   8e-47   
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         170   8e-47   
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             170   8e-47   
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      169   8e-47   
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             169   8e-47   
gb|ABC69916.1|  phenylalanine ammonia-lyase                             170   8e-47   
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           169   8e-47   
gb|AAM12956.1|  phenylalanine ammonia-lyase                             169   9e-47   
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    169   9e-47   
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             169   9e-47   
gb|AAC18871.1|  phenylalanine ammonia lyase                             169   1e-46   
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         169   1e-46   
gb|AAC18870.1|  phenylalanine ammonia lyase                             169   1e-46   
emb|CAB42794.1|  phenylalanine-ammonia lyase                            169   1e-46   
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             169   1e-46   
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    169   1e-46   
dbj|BAH20339.1|  AT3G53260                                              168   1e-46   
gb|KDO36715.1|  hypothetical protein CISIN_1g016039mg                   165   1e-46   
gb|AAN32867.1|AF460204_1  phenylalanine ammonia-lyase 2                 169   1e-46   
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      169   1e-46   
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    169   1e-46   
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             169   2e-46   
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      169   2e-46   
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          169   2e-46   
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            169   2e-46   
gb|AEW43005.1|  phenylalanine ammonia lyase                             164   2e-46   
prf||2006271A  Phe ammonia lyase                                        169   2e-46
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            169   2e-46   
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           169   2e-46   
gb|ACA30407.1|  phenylalanine ammonia-lyase                             169   2e-46   
gb|AFP49806.1|  phenylalanine ammonialyase 1                            169   2e-46   
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       169   2e-46   
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             169   2e-46   
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        169   2e-46   
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           169   2e-46   
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   169   2e-46   
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   168   2e-46   
dbj|BAM28964.1|  phenylalanine ammonia lyase                            169   2e-46   
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 168   2e-46   
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             168   2e-46   
gb|AAP34199.1|  phenylalanine ammonia-lyase                             168   2e-46   
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             168   3e-46   
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           168   3e-46   
gb|AAX22053.1|  phenylalanine ammonia-lyase                             168   3e-46   
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        168   3e-46   
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       167   3e-46   
gb|KHN02334.1|  Phenylalanine ammonia-lyase 1                           167   4e-46   
gb|ACT32033.1|  phenylalanine ammonia-lyase                             167   4e-46   
gb|ADY02660.1|  phenylalanine ammonia lyase                             167   4e-46   
gb|AFG26322.1|  phenylalanine ammonia-lyase                             167   4e-46   
gb|AEJ88223.1|  phenylalanine ammonia lyase                             167   4e-46   
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            168   4e-46   
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    167   4e-46   
gb|ADA81868.1|  phenylalanine ammonia-lyase                             167   5e-46   
gb|KGN52973.1|  hypothetical protein Csa_4G008760                       165   5e-46   
gb|AHA42443.1|  phenylalanine ammonia lyase                             167   5e-46   
gb|AAM28276.1|  phenylalanine ammonia-lyase                             161   5e-46   
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      167   5e-46   
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         167   5e-46   
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         167   5e-46   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             167   5e-46   
emb|CDY18464.1|  BnaA04g21230D                                          164   5e-46   
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    167   7e-46   
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    167   7e-46   
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   167   7e-46   
gb|AAZ29733.1|  phenylalanine ammonia lyase                             167   7e-46   
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        167   8e-46   
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             167   8e-46   
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        167   9e-46   
emb|CDO99754.1|  unnamed protein product                                166   9e-46   
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    167   9e-46   
gb|AGE10605.1|  phenylalanine amononia-lyase                            160   1e-45   
gb|AAZ29735.1|  phenylalanine ammonia lyase                             167   1e-45   
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             167   1e-45   
gb|ADD82537.1|  phenylalanine ammonia-lyase                             166   1e-45   
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        166   1e-45   
dbj|BAM28966.1|  phenylalanine ammonia lyase                            166   1e-45   
gb|AAV98199.1|  phenylalanine ammonialyase 1                            166   1e-45   
gb|AEC11891.1|  PAL1                                                    166   1e-45   
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           166   1e-45   
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        166   1e-45   
gb|AAD45384.1|  phenylalanine ammonia-lyase                             166   1e-45   
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       166   1e-45   
gb|AGZ95691.1|  phenylalanine ammonia-lyase                             166   2e-45   
gb|ADY02661.1|  phenylalanine ammonia lyase                             166   2e-45   
gb|ADY02662.1|  phenylalanine ammonia lyase                             166   2e-45   
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    166   2e-45   
gb|AAR19393.1|  phenylalanine ammonia-lyase                             166   2e-45   
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             166   2e-45   
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    166   2e-45   
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      166   2e-45   
sp|P07218.2|PAL1_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    164   2e-45   
gb|ACG56647.1|  phenylalanine ammonia lyase                             165   3e-45   
pir||A24727  phenylalanine ammonia-lyase (EC 4.3.1.5) - kidney be...    164   3e-45
gb|AGZ59813.1|  phenylalanine ammonia lyase                             164   3e-45   
gb|AGZ59814.1|  phenylalanine ammonia lyase                             164   3e-45   
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        165   3e-45   
gb|ACG56648.1|  phenylalanine ammonia lyase                             165   3e-45   
gb|AGZ59815.1|  phenylalanine ammonia lyase                             164   3e-45   
gb|AHC29063.1|  phenylalanine ammonia lyase                             164   3e-45   
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      165   3e-45   
ref|XP_004167356.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    165   3e-45   
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        165   4e-45   
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             165   4e-45   
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       165   4e-45   
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        165   5e-45   
gb|AGZ59812.1|  phenylalanine ammonia lyase                             164   5e-45   
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   6e-45   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             164   6e-45   
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             164   7e-45   
sp|P45727.1|PALY_PERAE  RecName: Full=Phenylalanine ammonia-lyase       164   7e-45   
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   7e-45   
gb|AAZ29734.1|  phenylalanine ammonia lyase                             164   8e-45   
gb|AAZ29732.1|  phenylalanine ammonia lyase                             164   8e-45   
gb|ADA72013.1|  phenylalanine ammonia-lyase                             164   8e-45   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   9e-45   
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       164   9e-45   
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   1e-44   
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             164   1e-44   
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   1e-44   
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   1e-44   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             164   1e-44   
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   1e-44   
emb|CAA68064.1|  phenylalanine ammonia-lyase                            159   1e-44   
gb|ABC69917.1|  phenylalanine ammonia-lyase                             163   2e-44   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          163   2e-44   
dbj|BAM28967.1|  phenylalanine ammonia lyase                            163   2e-44   
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             163   2e-44   
ref|XP_007016787.1|  PHE ammonia lyase 1                                163   2e-44   
gb|ACT21093.1|  phenylalanine ammonia-lyase                             162   2e-44   
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             162   3e-44   
gb|AHC29062.1|  phenylalanine ammonia lyase                             162   3e-44   
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        162   4e-44   
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             162   4e-44   
gb|AFI71896.1|  phenylalanine ammonia-lyase                             162   4e-44   
dbj|BAC10907.1|  phenylalanine ammonia-lyase 1                          157   4e-44   
gb|EMS57454.1|  Phenylalanine ammonia-lyase                             156   4e-44   
dbj|BAF93189.1|  putative phenylalanine ammonia-lyase                   160   4e-44   
ref|XP_008456500.1|  PREDICTED: phenylalanine ammonia-lyase G4          162   5e-44   
ref|XP_002448194.1|  hypothetical protein SORBIDRAFT_06g022750          162   5e-44   
ref|NP_001053326.1|  Os04g0518400                                       162   5e-44   
dbj|BAJ85028.1|  predicted protein                                      161   5e-44   
gb|ADB97626.1|  phenylalanine ammonia-lyase                             162   5e-44   
dbj|BAM05605.1|  phenylalanine ammonia lyase                            158   6e-44   
dbj|BAM05606.1|  phenylalanine ammonia lyase                            158   6e-44   
gb|AFF60415.1|  phenylalanine ammonia lyase                             161   6e-44   
gb|AER58180.1|  phenylalanine ammonia lyase                             161   7e-44   
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           161   7e-44   
gb|AAW78932.1|  phenylalanine-ammonia lyase                             161   7e-44   
gb|EMS57329.1|  Phenylalanine ammonia-lyase                             159   7e-44   
gb|AFP86474.1|  phenylalanine ammonia-lyase                             162   8e-44   
gb|ACT68010.1|  phenylalanine ammonia-lyase                             161   8e-44   
ref|XP_006652523.1|  PREDICTED: phenylalanine ammonia-lyase-like        161   8e-44   
gb|EMT29668.1|  Phenylalanine ammonia-lyase                             161   8e-44   
gb|ACG80829.1|  phenylalanine ammonia lyase                             160   9e-44   
ref|XP_010031967.1|  PREDICTED: phenylalanine ammonia-lyase-like        161   1e-43   
dbj|BAM05604.1|  phenylalanine ammonia lyase                            157   1e-43   
gb|EMS63272.1|  Phenylalanine ammonia-lyase                             160   1e-43   
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           160   1e-43   
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        160   1e-43   
ref|XP_006846821.1|  hypothetical protein AMTR_s00148p00088930          160   1e-43   
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            160   1e-43   
gb|KGN48165.1|  hypothetical protein Csa_6G445780                       157   2e-43   
gb|ACM61988.1|  phenylalanine ammonia-lyase                             160   2e-43   
dbj|BAJ88975.1|  predicted protein                                      160   2e-43   
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              160   2e-43   
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             160   2e-43   
dbj|BAN10321.1|  phenylalanine ammonia-lyase                            150   2e-43   
gb|AGC23439.1|  phenylalanine ammonia-lyase                             160   2e-43   
dbj|BAJ85603.1|  predicted protein                                      160   2e-43   
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        160   3e-43   



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/116 (97%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAYADDPCS NYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED
Sbjct  556  DLLRVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  615

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIReelgteiltgexVQS  351
            ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTE+LTGE VQS
Sbjct  616  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTEMLTGEKVQS  671



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAYADDPCSANYPL QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED
Sbjct  557  DLLRVVDREYVFAYADDPCSANYPLFQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  616

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVEGARSA+ENGNPAIPNRITECRSYPLYKF+R
Sbjct  617  ELKAVLPKEVEGARSAIENGNPAIPNRITECRSYPLYKFVR  657



>emb|CAJ41418.1| phenylalanine ammonia-lyase 3 [Coffea arabica]
Length=279

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY FAY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFED
Sbjct  172  DLLRVVDREYAFAYVDDPCSATYPLMQKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFED  231

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE ARSA+E+GNPAIPNRI ECRSYPLYKF+R
Sbjct  232  ELKAVLPKEVESARSAVESGNPAIPNRIRECRSYPLYKFVR  272



>dbj|BAF98437.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   189 bits (480),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN+STSIFQKIAAFED
Sbjct  116  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGETEKNLSTSIFQKIAAFED  175

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+ LE+GNPA+PNRI ECRSYPLYKFIR
Sbjct  176  ELKTLLPKEVESARAVLESGNPAVPNRIKECRSYPLYKFIR  216



>dbj|BAF98439.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL NG++E+N+STSIFQKIA FED
Sbjct  116  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALTNGDNERNLSTSIFQKIATFED  175

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+R
Sbjct  176  ELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYKFVR  216



>dbj|BAF98438.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   186 bits (472),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFED
Sbjct  116  DLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFED  175

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+R
Sbjct  176  ELKALLPKEVESARAALESGNPAIPNRIKECRSYPLYKFVR  216



>gb|AIB08913.1| phenylalanine ammonia-lyase, partial [Angelica sinensis]
Length=233

 Score =   184 bits (468),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFED
Sbjct  83   DLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFED  142

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+R
Sbjct  143  ELKTLLPKEVESARAALESGNPAIPNRIKECRSYPLYKFVR  183



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCSANYPLMQKLRQVLVDHAL+NGE+EKN STSIFQKI AFE+
Sbjct  560  DLLRVVDREYVFAYIDDPCSANYPLMQKLRQVLVDHALKNGENEKNASTSIFQKIEAFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR ALE GNPA+PNRITECRSYPLYKFIR
Sbjct  620  ELKALLPKEVESARMALEAGNPAVPNRITECRSYPLYKFIR  660



>emb|CDP06747.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   190 bits (483),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY FAY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFED
Sbjct  406  DLLRVVDREYAFAYVDDPCSATYPLMQKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFED  465

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE ARSA+E+GNPAIPNRI ECRSYPLYKF+R
Sbjct  466  ELKAVLPKEVESARSAVESGNPAIPNRIRECRSYPLYKFVR  506



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL+RVVDREYVFAY DDPCS  YPLM+KLRQV+VDHALQNGE EKNV+TSIFQKIAAFED
Sbjct  565  DLIRVVDREYVFAYVDDPCSGTYPLMEKLRQVIVDHALQNGESEKNVNTSIFQKIAAFED  624

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK +LPKEVE AR+ALENGNPAIPNRI ECRSYPLYKF+R
Sbjct  625  ELKTVLPKEVESARTALENGNPAIPNRIKECRSYPLYKFVR  665



>emb|CDP20698.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY FAY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFED
Sbjct  523  DLLRVVDREYAFAYVDDPCSATYPLMQKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFED  582

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE ARSA+ENGNPAIPNRI +CRSYPLYKF+R
Sbjct  583  ELKAVLPKEVESARSAVENGNPAIPNRIRKCRSYPLYKFVR  623



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN+STSIFQKIAAFED
Sbjct  557  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGETEKNLSTSIFQKIAAFED  616

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+ +E+GNPAIPNRI ECRSYPLYKFIR
Sbjct  617  ELKALLPKEVESARAVVESGNPAIPNRIKECRSYPLYKFIR  657



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY FAY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFED
Sbjct  560  DLLRVVDREYAFAYVDDPCSATYPLMQKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFED  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE ARSA+E+GNPAIPNRI ECRSYPLYKF+R
Sbjct  620  ELKAVLPKEVESARSAVESGNPAIPNRIRECRSYPLYKFVR  660



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY FAY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFED
Sbjct  560  DLLRVVDREYAFAYVDDPCSATYPLMQKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFED  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE ARSA+E+GNPAIPNRI ECRSYPLYKF+R
Sbjct  620  ELKAVLPKEVESARSAVESGNPAIPNRIRECRSYPLYKFVR  660



>sp|P35512.1|PALY_MALDO RecName: Full=Phenylalanine ammonia-lyase, partial [Malus domestica]
 emb|CAA48231.1| phenylalanine ammonia-lyase [Malus sp.]
Length=235

 Score =   181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VL++HAL NGE EKN STSIFQKI AFE+
Sbjct  84   DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLIEHALTNGESEKNASTSIFQKIGAFEE  143

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE ARSA+E GN A+PNRI ECRSYPLYKF+R
Sbjct  144  ELKALLPKEVESARSAIEGGNAAVPNRIAECRSYPLYKFVR  184



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAYADDPCSANYPLMQKLRQ LVDHALQNGE+EKN  TSIF K+AAFED
Sbjct  556  DLLRVVDREYVFAYADDPCSANYPLMQKLRQALVDHALQNGENEKNTGTSIFLKVAAFED  615

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR A+E+GNPAIPNRI ECRSYPLYKF+R
Sbjct  616  ELKAVLPKEVEAARIAVESGNPAIPNRIKECRSYPLYKFVR  656



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAYADDPCSANYPLMQKLRQ LVDHALQNGE EKN  TSIF K+AAFED
Sbjct  560  DLLRVVDREYVFAYADDPCSANYPLMQKLRQALVDHALQNGESEKNTGTSIFLKVAAFED  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR A+E+GNPAIPNRI ECRSYPLYKF+R
Sbjct  620  ELKAVLPKEVEAARIAVESGNPAIPNRIKECRSYPLYKFVR  660



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLR+VDREY+FAYADDPCS NYPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFED
Sbjct  564  ELLRIVDREYLFAYADDPCSCNYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIGAFED  623

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+ALE+GNPAIPNRITECRSYPLY+F+R
Sbjct  624  ELKAVLPKEVESARAALESGNPAIPNRITECRSYPLYRFVR  664



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCSANYPLMQKLRQVLVDHAL+NGE+EKN STSI Q+I AFE+
Sbjct  560  DLLRVVDREYVFAYIDDPCSANYPLMQKLRQVLVDHALKNGENEKNASTSILQEIEAFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR ALE GNPA+PNRITECRSYPLYKFIR
Sbjct  620  ELKALLPKEVESARMALEAGNPAVPNRITECRSYPLYKFIR  660



>gb|ABV71917.1| PAL [Solenostemon scutellarioides]
Length=233

 Score =   180 bits (456),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL+RVVDREYVFAY DDPCSA YPLMQKLRQVLVDHALQNGE+EKNV TSIF KI +FE+
Sbjct  84   DLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALQNGENEKNVGTSIFHKIESFEE  143

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKE E AR +LE+GNPAI NRI ECRSYPLYKFIR
Sbjct  144  ELKALLPKEDESARISLESGNPAIANRIAECRSYPLYKFIR  184



>gb|ABV44807.1| phenylalanine ammonia lyase 2 [Eriobotrya japonica]
Length=330

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  180  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEE  239

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  240  ELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  280



>emb|CAA34715.1| unnamed protein product [Petroselinum crispum]
Length=580

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL+NG++E+N+STSIFQKIA FED
Sbjct  429  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALKNGDNERNLSTSIFQKIATFED  488

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+R
Sbjct  489  ELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYKFVR  529



>gb|AGO01924.1| phenylalanine ammonia-lyase 1, partial [Lycium barbarum]
Length=561

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREY+FAYADDPCS  YPLMQKLRQVLVDHAL+NGE EKNV++SIFQKI AFED
Sbjct  460  ELLRVVDREYLFAYADDPCSCTYPLMQKLRQVLVDHALKNGESEKNVNSSIFQKIGAFED  519

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA LPKEVE AR+ LE+GNP+IPNRITECRSYPLYKF+R
Sbjct  520  ELKACLPKEVESARAVLESGNPSIPNRITECRSYPLYKFVR  560



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL+NG++E+N+STSIFQKIA FED
Sbjct  565  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALKNGDNERNLSTSIFQKIATFED  624

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+R
Sbjct  625  ELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYKFVR  665



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL+NG++E+N+STSIFQKIA FED
Sbjct  563  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALKNGDNERNLSTSIFQKIATFED  622

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+R
Sbjct  623  ELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYKFVR  663



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREY+FAYADDPCS NYPLMQKLRQVLVDHA++NGE EKNV++SIFQKI AFED
Sbjct  566  ELLRVVDREYLFAYADDPCSCNYPLMQKLRQVLVDHAMKNGESEKNVNSSIFQKIGAFED  625

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+ALE+GNPAI NRITECRSYPLY+F+R
Sbjct  626  ELKAVLPKEVENARAALESGNPAIANRITECRSYPLYRFVR  666



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL+NG+ EK++STSIFQKI AFED
Sbjct  560  DLLRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALKNGDGEKSLSTSIFQKIEAFED  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR ALE+GNPAI NRITECRSYPLYKFIR
Sbjct  620  ELKALLPKEVESARIALESGNPAIANRITECRSYPLYKFIR  660



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAYADD CSANYPLMQKLRQVLVDHALQNGE+EKN ++SIFQKI AFED
Sbjct  561  DLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHALQNGENEKNANSSIFQKILAFED  620

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+ALE+GNPAI NRI ECRSYPLY+F+R
Sbjct  621  ELKAVLPKEVESARAALESGNPAIANRIKECRSYPLYRFVR  661



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAYADD CSANYPLMQKLRQVLVDHALQNGE+EKN ++SIFQKI AFED
Sbjct  561  DLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHALQNGENEKNANSSIFQKILAFED  620

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+ALE+GNPAI NRI ECRSYPLY+F+R
Sbjct  621  ELKAVLPKEVESARAALESGNPAIANRIKECRSYPLYRFVR  661



>gb|AEA72280.1| phenylalanine ammonia-lyase, partial [Angelica gigas]
Length=699

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQ LV+HAL NG++E+N+STSIFQKIA FED
Sbjct  548  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALTNGDNERNLSTSIFQKIATFED  607

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+R
Sbjct  608  ELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYKFVR  648



>gb|AIZ76770.1| PAL2, partial [Pyrus pyrifolia]
Length=368

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  230  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHALTNGESEKNASTSIFQKIGAFEE  289

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  290  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  330



>gb|AIZ76768.1| PAL2, partial [Pyrus pyrifolia]
Length=367

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  229  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHALTNGESEKNASTSIFQKIGAFEE  288

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  289  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  329



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCS NYPLMQKLRQVLV+HAL+NG++EKN+STSIFQKI AFED
Sbjct  561  DLLRVVDREYVFAYVDDPCSENYPLMQKLRQVLVEHALKNGDNEKNLSTSIFQKIGAFED  620

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR ALE+GNPAI NRI ECRSYPLY+FIR
Sbjct  621  ELKALLPKEVESARIALESGNPAIANRIKECRSYPLYRFIR  661



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFED
Sbjct  567  DLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFED  626

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+R
Sbjct  627  ELKALLPKEVETARAALESGNPAIPNRIKECRSYPLYKFVR  667



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL NGE+EKN++TSIFQKIA FED
Sbjct  568  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALVNGEYEKNLNTSIFQKIATFED  627

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+A E+GNPAIPN+I ECRSYPLYKF+R
Sbjct  628  ELKALLPKEVESARAAYESGNPAIPNKIKECRSYPLYKFVR  668



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREYVFAYADDPCS+ YPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFED
Sbjct  571  ELLRVVDREYVFAYADDPCSSTYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIVAFED  630

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+ LE+GNP+IPNRITECRSYPLYK +R
Sbjct  631  ELKAMLPKEVESARAVLESGNPSIPNRITECRSYPLYKLVR  671



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   186 bits (473),  Expect = 8e-53, Method: Composition-based stats.
 Identities = 86/101 (85%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VF Y DDPCSA YPLMQKLRQVLVDHAL NGE E N STSIFQKI AFE+
Sbjct  560  DLLKVVDREHVFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNSSTSIFQKIGAFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR  LENGNPAIPNRITECRSYPLYKF+R
Sbjct  620  ELKALLPKEVESARHELENGNPAIPNRITECRSYPLYKFVR  660



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCS  YPLMQKLRQVLVDHAL NGE EKNVSTSIFQKI AFE 
Sbjct  557  DLLRVVDREYVFAYIDDPCSGTYPLMQKLRQVLVDHALNNGESEKNVSTSIFQKIEAFEV  616

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR ALE+GNPAI NRITECRSYPLYKFIR
Sbjct  617  ELKAILPKEVESARIALESGNPAIGNRITECRSYPLYKFIR  657



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   186 bits (473),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREY+FAYADDPCS NYPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFED
Sbjct  566  ELLRVVDREYLFAYADDPCSCNYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIGAFED  625

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+ALE GNPAI NRITECRSYPLY+F+R
Sbjct  626  ELKAVLPKEVESARAALECGNPAIANRITECRSYPLYRFVR  666



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   186 bits (473),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAYADD CSANYPLMQKLRQVLVDHALQNGE+EKN ++SIFQKI AFED
Sbjct  561  DLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHALQNGENEKNANSSIFQKILAFED  620

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR ALE+GNPAI NRI ECRSYPLY+F+R
Sbjct  621  ELKAVLPKEVESARIALESGNPAIANRIKECRSYPLYRFVR  661



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFED
Sbjct  564  DLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFED  623

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+A+E+GNPAIPNRI ECRSYPLYKF+R
Sbjct  624  ELKALLPKEVESARAAVESGNPAIPNRIKECRSYPLYKFVR  664



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFED
Sbjct  564  DLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFED  623

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+A+E+GNPAIPNRI ECRSYPLYKF+R
Sbjct  624  ELKALLPKEVESARAAVESGNPAIPNRIKECRSYPLYKFVR  664



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   186 bits (472),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 86/101 (85%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VF Y DDPCSA YPLMQKLRQVLVDHAL NGE E N STSIFQKI  FED
Sbjct  560  DLLKVVDREHVFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNSSTSIFQKIGVFED  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR  LENGNPAIPNRITECRSYPLYKF+R
Sbjct  620  ELKALLPKEVESARLELENGNPAIPNRITECRSYPLYKFVR  660



>gb|ACF94717.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=311

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQKLRQVLVDHAL NGE+EKN++TSIFQKIA FE+
Sbjct  160  DLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHALVNGENEKNLNTSIFQKIATFEE  219

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+A E+GN AIPN+I ECRSYPLYKF+R
Sbjct  220  ELKALLPKEVESARAAYESGNAAIPNKINECRSYPLYKFVR  260



>gb|AEY94464.1| phenylalanine ammonia-lyase, partial [Prunella vulgaris]
Length=349

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +L+RVVDREYVFAYADDPCSA YPLMQKLRQVLVDHAL+NG+ EKNVSTSIF KI AFE+
Sbjct  198  ELIRVVDREYVFAYADDPCSATYPLMQKLRQVLVDHALKNGDGEKNVSTSIFHKIEAFEE  257

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR ALE+G PA+ NRI ECRSYPLYKFIR
Sbjct  258  ELKALLPKEVESARIALESGAPAVANRIAECRSYPLYKFIR  298



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREYVFAYADDPCS+ YPLMQKLRQVLVDHA++NGE EKNV++SIFQKI AFED
Sbjct  570  ELLRVVDREYVFAYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNVNSSIFQKIVAFED  629

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPLY+ +R
Sbjct  630  ELKAVLPKEVESARAVVESGNPAIPNRITECRSYPLYRLVR  670



>gb|AAC33966.1| phenylalanine ammonia-lyase [Capsicum chinense]
Length=532

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREY+FAYADDPCS+ YPLMQKLRQVLVDHAL NGE EKNV++SIFQKIAAFED
Sbjct  381  ELLRVVDREYLFAYADDPCSSTYPLMQKLRQVLVDHALNNGESEKNVNSSIFQKIAAFED  440

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  LE+GNP+IPNRITECRSYPLY+ +R
Sbjct  441  ELKAVLPKEVESARITLESGNPSIPNRITECRSYPLYRLVR  481



>gb|AID69536.1| phenylalanine ammonia-lyase, partial [Phlomoides rotata]
Length=540

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL RVVDREYVFAY DDPCS  YPLMQKLRQVLVDHAL+NGE E+N+STSIF KI AFE+
Sbjct  389  DLARVVDREYVFAYVDDPCSTGYPLMQKLRQVLVDHALKNGEEERNISTSIFHKILAFEE  448

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVEGAR ALE+GNPA+ NRITECRSYPLYKFIR
Sbjct  449  ELKTLLPKEVEGARLALESGNPAVGNRITECRSYPLYKFIR  489



>gb|AGO01925.1| phenylalanine ammonia-lyase 2, partial [Lycium barbarum]
Length=561

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREY+FAYADDPCS  YPLMQKLRQVLVDHAL+NGE EKNV++SIFQKI AFED
Sbjct  460  ELLRVVDREYLFAYADDPCSCTYPLMQKLRQVLVDHALKNGESEKNVNSSIFQKIGAFED  519

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK  LPKEVE AR+ LE+GNP+IPNRITECRSYP YKF+R
Sbjct  520  ELKVCLPKEVESARAVLESGNPSIPNRITECRSYPFYKFVR  560



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEE  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  629  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  669



>gb|AIZ76769.1| PAL2, partial [Pyrus pyrifolia]
Length=507

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  369  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHALTNGESEKNASTSIFQKIGAFEE  428

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  429  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  469



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEE  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  629  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  669



>dbj|BAF79623.1| phenylalanine ammonia-lyase [Fragaria x ananassa]
Length=188

 Score =   174 bits (441),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL VV+REY+FAY DDPCSA YPLMQ+LRQVLV+HAL NGE+EKN +TSIFQKI+AFE+
Sbjct  84   DLLMVVEREYLFAYIDDPCSATYPLMQRLRQVLVEHALTNGENEKNANTSIFQKISAFEE  143

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A E+GN AIPNRI +CRSYPLYKF+R
Sbjct  144  ELKAILPKEVESARAACESGNAAIPNRIIKCRSYPLYKFVR  184



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLR+VDREY+FAYADDPCSANYPLMQKLRQVLV+HALQNGE+EKN S+SIFQKI AFE+
Sbjct  560  DLLRIVDREYLFAYADDPCSANYPLMQKLRQVLVEHALQNGENEKNASSSIFQKIVAFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK++LP+EVE AR ALE+GNPAI NRI ECRSYPLYKF+R
Sbjct  620  ELKSVLPREVESARVALESGNPAIANRINECRSYPLYKFVR  660



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREY+FAYADDPCS+ YPLMQKLRQVLVDHAL NGE EKNV++SIFQKIAAFED
Sbjct  566  ELLRVVDREYLFAYADDPCSSTYPLMQKLRQVLVDHALNNGESEKNVNSSIFQKIAAFED  625

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  LE+GNP+IPNRITECRSYPLY+ +R
Sbjct  626  ELKAVLPKEVESARITLESGNPSIPNRITECRSYPLYRLVR  666



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREYVFAYADDPCS+ YPLMQKLRQVLVDHA++NGE EKNV++SIFQKI AFED
Sbjct  570  ELLRVVDREYVFAYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNVNSSIFQKIVAFED  629

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA LPKEVE AR+ +E+GNPAIPNRITECRSYPLY+ +R
Sbjct  630  ELKAALPKEVESARAVVESGNPAIPNRITECRSYPLYRLVR  670



>ref|XP_003635685.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=308

 Score =   177 bits (450),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  157  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEE  216

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  217  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVR  257



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLR VDREY+FAY DDPCSA YPLMQKLRQ LV+HAL+NG++E+N++TSIFQKIA FED
Sbjct  565  DLLRFVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALKNGDNERNMNTSIFQKIATFED  624

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYKF+R
Sbjct  625  ELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYKFVR  665



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL+RVVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN STSIFQKI AFE+
Sbjct  558  DLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALKNGEGEKNASTSIFQKIEAFEE  617

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+ALE+GNPAI NRI ECRSYPLYKFIR
Sbjct  618  ELKTLLPKEVESARTALESGNPAIANRIAECRSYPLYKFIR  658



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL+ VVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL+NGE EKNVSTSIF KI AFE+
Sbjct  560  DLISVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALKNGETEKNVSTSIFHKIEAFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR ALE GNPAI NRI+ECRSYPLYKFIR
Sbjct  620  ELKALLPKEVESARIALEGGNPAIANRISECRSYPLYKFIR  660



>gb|AGF50184.1| phenylalanine ammonia lyase, partial [Salvia virgata]
Length=282

 Score =   176 bits (447),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL+RVVDREYVF+Y DDPC A YPLMQKLRQVLV+HAL+NGE EKN STSIFQKI  FE+
Sbjct  131  DLIRVVDREYVFSYVDDPCLATYPLMQKLRQVLVEHALKNGEGEKNASTSIFQKIEQFEE  190

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR ALE+G+PA+PNRI ECRSYPLYKF+R
Sbjct  191  ELKALLPKEVEAARLALESGSPAVPNRIAECRSYPLYKFVR  231



>gb|AIZ76767.1| PAL2, partial [Pyrus pyrifolia]
Length=569

 Score =   183 bits (464),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  432  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHALTNGESEKNASTSIFQKIGAFEE  491

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  492  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  532



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL+NGE+EKN STSIFQKI AFE 
Sbjct  562  DLLRVVDREYVFAYVDDPCSATYPLMQKLRQVLVEHALKNGENEKNASTSIFQKIEAFEA  621

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR ALE+G PAI NRITECRSYPLYKFIR
Sbjct  622  ELKAVLPKEVESARVALEDGKPAIANRITECRSYPLYKFIR  662



>gb|AET41698.1| phenylalanine ammonia-lyase [Prunus salicina]
Length=317

 Score =   177 bits (449),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  166  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  225

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYKF+R
Sbjct  226  ELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVR  266



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCSANYPLMQKLRQVLVDHAL+NG+ EKNV TSIFQKI  FE+
Sbjct  560  DLLRVVDREYVFAYIDDPCSANYPLMQKLRQVLVDHALKNGDSEKNVGTSIFQKIQVFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL A+LPKEVE AR ALE GNPAIPNRI ECRSYPLY FIR
Sbjct  620  ELTAVLPKEVEAARIALEAGNPAIPNRIKECRSYPLYSFIR  660



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  568  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHALTNGESEKNASTSIFQKIGAFEE  627

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  628  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  668



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEE  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  629  ELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  669



>gb|ABK32083.1| phenylalanine ammonia-lyase, partial [Prunus armeniaca]
Length=290

 Score =   176 bits (446),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQK  AFE+
Sbjct  190  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKTVAFEE  249

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYKF+R
Sbjct  250  ELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVR  290



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEE  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  629  ELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  669



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEE  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  629  ELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  669



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEE  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  629  ELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  669



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  568  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHALTNGESEKNASTSIFQKIGAFEE  627

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  628  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  668



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  568  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHALTNGESEKNASTSIFQKIGAFEE  627

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  628  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  668



>dbj|BAF79619.1| phenylalanine ammonia-lyase [Fragaria x ananassa]
 dbj|BAF79621.1| phenylalanine ammonia-lyase [Fragaria x ananassa]
Length=188

 Score =   172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL VV+REY+FAY DDPCSA YPLMQ+LRQVLV+HAL NGE+EKN +TSIFQKI+AFE+
Sbjct  84   DLLMVVEREYLFAYIDDPCSATYPLMQRLRQVLVEHALTNGENEKNANTSIFQKISAFEE  143

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK +LPKEVE  R+A E+GN AIPNRI ECRSYPLYKF+R
Sbjct  144  ELKTILPKEVESVRAACESGNAAIPNRIIECRSYPLYKFVR  184



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAYADD CSANYPLMQKLRQVLVDHAL+NGE+EKN ++SIFQKI AFE 
Sbjct  561  DLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHALENGENEKNANSSIFQKILAFEG  620

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR +LENGNPAI NRI ECRSYPLY+F+R
Sbjct  621  ELKAVLPKEVESARISLENGNPAIANRIKECRSYPLYRFVR  661



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN+STSIFQKI AFE+
Sbjct  563  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGESEKNLSTSIFQKIRAFEE  622

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            E+K LLPKEVE  R+A+ENGN AIPNRI ECRSYPLYKF+R
Sbjct  623  EIKTLLPKEVESTRAAIENGNSAIPNRIKECRSYPLYKFVR  663



>gb|AGF50183.1| phenylalanine ammonia lyase, partial [Salvia hypoleuca]
Length=282

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL+RVVDREYVF+Y DDPC A YPLMQKLRQVLV+HAL+NGE EKN STSIF KI  FE+
Sbjct  131  DLIRVVDREYVFSYVDDPCLATYPLMQKLRQVLVEHALKNGEGEKNASTSIFHKIEQFEE  190

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR ALE+G+PA+PNRI ECRSYPLYKF+R
Sbjct  191  ELKALLPKEVEAARMALESGSPAVPNRIAECRSYPLYKFVR  231



>gb|AAU08174.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN+STSIFQKI AFE+
Sbjct  563  DLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGESEKNLSTSIFQKIRAFEE  622

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            E+K LLPKEVE  R+A+ENGN AIPNRI ECRSYPLYKF+R
Sbjct  623  EIKTLLPKEVESTRAAIENGNSAIPNRIKECRSYPLYKFVR  663



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   182 bits (463),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 84/101 (83%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+ F Y DDPCSA YPLMQKLRQVLVDHAL NGE E N STSIFQKI AFE+
Sbjct  560  DLLKVVDREHAFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNSSTSIFQKIGAFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR  LENGNPAIPNRITECRSYPLYKF+R
Sbjct  620  ELKTLLPKEVENARLELENGNPAIPNRITECRSYPLYKFVR  660



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   182 bits (463),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 84/101 (83%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+ F Y DDPCSA YPLMQKLRQVLVDHAL NGE E N STSIFQKI AFE+
Sbjct  560  DLLKVVDREHAFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNSSTSIFQKIGAFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR  LENGNPAIPNRITECRSYPLYKF+R
Sbjct  620  ELKTLLPKEVENARLELENGNPAIPNRITECRSYPLYKFVR  660



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREY+FAY DDPCSA YPLMQKLRQVLVDHAL NGE EKN STSIFQKI AFE+
Sbjct  568  DLLKVVDREYIFAYIDDPCSATYPLMQKLRQVLVDHALLNGEKEKNSSTSIFQKIGAFEE  627

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+  +NGNPAIPN+I ECRSYPLYKF+R
Sbjct  628  ELKALLPKEVENARTEYDNGNPAIPNKIKECRSYPLYKFVR  668



>ref|XP_006367534.1| PREDICTED: phenylalanine ammonia-lyase 1-like, partial [Solanum 
tuberosum]
Length=441

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREY+F YADDPCS+ YPLMQKLRQVLVDHA++NGE EKN+++SIFQKI AFED
Sbjct  290  ELLRVVDREYLFTYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNINSSIFQKIGAFED  349

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL A+LPKEVE AR+ LE+GNP+IPNRITECRSYPLY+ +R
Sbjct  350  ELNAVLPKEVESARALLESGNPSIPNRITECRSYPLYRLVR  390



>gb|AFC37247.1| phenylalanine ammonia-lyase [Camellia chekiangoleosa]
Length=308

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDRE+VF Y DDPCSA YPLMQKLRQVLV+HAL+NG+ EKNVSTSIFQKI AFE+
Sbjct  157  ELLRVVDREHVFEYIDDPCSATYPLMQKLRQVLVEHALKNGDAEKNVSTSIFQKIRAFEE  216

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL ALLPKEVE AR A+E+GNP IPNRI ECRSYPLYKF+R
Sbjct  217  ELMALLPKEVESARRAVESGNPGIPNRIKECRSYPLYKFVR  257



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   182 bits (462),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYV+AY DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+
Sbjct  575  DLLKVVDREYVYAYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEE  634

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+A ENGN AI N+ITECRSYPLYKF+R
Sbjct  635  ELKALLPKEVESARTAYENGNAAISNKITECRSYPLYKFVR  675



>gb|AID16077.1| phenylalanine ammonium lyase [Morus alba]
Length=726

 Score =   182 bits (462),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYV+AY DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+
Sbjct  575  DLLKVVDREYVYAYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEE  634

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+A ENGN AI N+ITECRSYPLYKF+R
Sbjct  635  ELKALLPKEVESARTAYENGNAAISNKITECRSYPLYKFVR  675



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +L+RVVDREYVFAYADDPCSA YPLMQKLRQVLVDHAL+NG+ EKNVSTSIF KI AFE+
Sbjct  559  ELIRVVDREYVFAYADDPCSATYPLMQKLRQVLVDHALKNGDGEKNVSTSIFHKIEAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR ALE+G PA+ NRI ECRSYPLYKFIR
Sbjct  619  ELKALLPKEVESARIALESGAPAVANRIAECRSYPLYKFIR  659



>gb|AGO01926.1| phenylalanine ammonia-lyase 3, partial [Lycium barbarum]
Length=561

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREY+FAYADD CS  YPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFE+
Sbjct  460  ELLRVVDREYLFAYADDCCSCTYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIVAFEE  519

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+ LE+GNP+IPNRITECRSYPLYKF+R
Sbjct  520  ELKAVLPKEVESARAVLESGNPSIPNRITECRSYPLYKFVR  560



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VL +HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLXEHALTNGESEKNASTSIFQKIGAFEE  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  629  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  669



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREY+FAYADD CS+ YPLMQKLRQVLVDHAL NGE EKNV++SIFQKIAAFED
Sbjct  566  ELLRVVDREYLFAYADDTCSSTYPLMQKLRQVLVDHALNNGESEKNVNSSIFQKIAAFED  625

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  LE+GNP+IPNRITECRSYPLY+ +R
Sbjct  626  ELKAVLPKEVESARITLESGNPSIPNRITECRSYPLYRLVR  666



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLR+VL +HAL NGE EKN STSIFQKI AFE+
Sbjct  569  DLLKVVDREYVFAYIDDPCSATYPLMQKLREVLXEHALTNGESEKNASTSIFQKIGAFEE  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE ARSA+E+GN A+PNRI ECRSYPLYKF+R
Sbjct  629  ELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVR  669



>gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot esculenta]
Length=315

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE VF+Y DD CSA YPLMQKLRQVLVDHAL NGE EKN STSIFQKI AFE+
Sbjct  164  DLLKVVDREQVFSYVDDACSATYPLMQKLRQVLVDHALANGESEKNASTSIFQKIRAFEE  223

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR A ENGNPAI N+I ECRSYPLYKF+R
Sbjct  224  ELKALLPKEVESAREAYENGNPAIANKIKECRSYPLYKFVR  264



>gb|AFU82540.1| phenylalanine ammonia-lyase, partial [Artemisia tridentata]
Length=159

 Score =   170 bits (431),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPC A YPLMQKLRQVLVDHAL NGE EKN +TSIFQKIA FE+
Sbjct  10   DLLRVVDREYVFAYIDDPCLATYPLMQKLRQVLVDHALTNGETEKNTNTSIFQKIATFEE  69

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            E+KA+LPKEVE  R A ENG  AIPNRI  CRSYPLY+F+R
Sbjct  70   EIKAILPKEVEAVRVAFENGTLAIPNRIKACRSYPLYRFVR  110



>dbj|BAF79622.1| phenylalanine ammonia-lyase [Fragaria x ananassa]
Length=188

 Score =   171 bits (433),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL VV+REY+FAY DDPCSA YPLMQ+LRQVLV+HAL NGE+EKN +TSIFQKI+ FE+
Sbjct  84   DLLMVVEREYLFAYIDDPCSATYPLMQRLRQVLVEHALTNGENEKNANTSIFQKISTFEE  143

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK +LPKEVE  R+A E+GN AIPNRI ECRSYPLYKF+R
Sbjct  144  ELKTILPKEVESVRAACESGNAAIPNRIIECRSYPLYKFVR  184



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKIAAFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIAAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVR  659



>sp|P45735.1|PALY_VITVI RecName: Full=Phenylalanine ammonia-lyase, partial [Vitis vinifera]
 emb|CAA53581.1| phenylalanine ammonium lyase [Vitis vinifera]
Length=416

 Score =   177 bits (449),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  265  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGESEKNGSTSIFQKIGAFEE  324

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  325  ELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVR  365



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQKLRQVLVDHAL NGE+EKN++TSIFQKIA FED
Sbjct  572  DLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHALVNGENEKNLNTSIFQKIATFED  631

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+A E+GNPAIPN+I  CRSYPLYKF+R
Sbjct  632  ELKTLLPKEVESARAAYESGNPAIPNKINGCRSYPLYKFVR  672



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKIAAFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIAAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVR  659



>gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza]
Length=760

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPC A YPLMQKLRQVLVDHAL+NG+ EKN STSIFQKI AFE 
Sbjct  609  DLLRVVDREYVFAYVDDPCLATYPLMQKLRQVLVDHALKNGDGEKNPSTSIFQKIEAFEA  668

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL+ LLPKEVEGARSALE GNPAI NRI ECRSYPLYKF+R
Sbjct  669  ELEVLLPKEVEGARSALEAGNPAIGNRIKECRSYPLYKFVR  709



>gb|AIE16710.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16711.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16712.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16713.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16714.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16715.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16716.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16717.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16719.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16720.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16722.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16723.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16724.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16725.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16726.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16727.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16728.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16729.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16730.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16731.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16732.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16733.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16734.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16735.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16736.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16737.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16738.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16739.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16740.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16741.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AIE16742.1| phenylalanine ammonia-lyase, partial [Glycine max]
Length=224

 Score =   172 bits (435),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREY+F+Y DDPCSA YPLMQKLRQVLVDHAL N E EK+V++SIFQKIA FE+
Sbjct  95   DLLKVVDREYIFSYIDDPCSATYPLMQKLRQVLVDHALVNAESEKDVNSSIFQKIAIFEE  154

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVEGAR+A E+G  AIPN+I ECRSYPLYKF+R
Sbjct  155  ELKNLLPKEVEGARAAYESGKAAIPNKIQECRSYPLYKFVR  195



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVEHALSNGENEKNGSTSIFQKIVAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVR  659



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   181 bits (458),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+ VDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKIAAFE+
Sbjct  569  DLLKAVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIAAFEE  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+++ENGN AIPN+I ECRS+PLYKF+R
Sbjct  629  ELKAVLPKEVESARASVENGNAAIPNKIKECRSFPLYKFVR  669



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVF YADD CSANYPLMQKLRQVLVDHAL+NGE+EKN ++SIFQKI AFE 
Sbjct  561  DLLRVVDREYVFRYADDACSANYPLMQKLRQVLVDHALENGENEKNANSSIFQKILAFEG  620

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR +LENGNPAI NRI ECRSYPLY+F+R
Sbjct  621  ELKAVLPKEVESARISLENGNPAIANRIKECRSYPLYRFVR  661



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY++AY DDPCSA YPLMQKLRQVLVDHAL NG+ EKN +TSIFQKI AFE+
Sbjct  562  DLLRVVDREYLYAYVDDPCSATYPLMQKLRQVLVDHALMNGDREKNSTTSIFQKIGAFEE  621

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVEGAR   ENGN AIPNRI ECRSYPLYKF+R
Sbjct  622  ELKTLLPKEVEGARIEFENGNAAIPNRIEECRSYPLYKFVR  662



>gb|AFS28702.1| putative phenylalanine ammonia-lyase, partial [Olea europaea]
 gb|AFS28703.1| putative phenylalanine ammonia-lyase, partial [Olea europaea]
Length=528

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL+NGE EK  +TSIFQKI AFED
Sbjct  396  DLLRVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALKNGETEKEANTSIFQKIGAFED  455

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL A LPKEVE AR ALE+GNPAIPN+I ECRSYPLYKF+R
Sbjct  456  ELIANLPKEVESARIALESGNPAIPNKINECRSYPLYKFVR  496



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL+RVVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKN STSIFQKI AFE+
Sbjct  560  DLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALKNGDLEKNASTSIFQKIEAFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR ALE+G+P + NRI ECRSYPLYKFIR
Sbjct  620  ELKALLPKEVESARMALESGSPTVANRIAECRSYPLYKFIR  660



>sp|P31425.1|PAL1_SOLTU RecName: Full=Phenylalanine ammonia-lyase 1 [Solanum tuberosum]
Length=720

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREY+F YADDPCS+ YPLMQKLRQVLVDHA++NGE EKN+++SIFQKI AFED
Sbjct  569  ELLRVVDREYLFTYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNINSSIFQKIGAFED  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL A+LPKEVE AR+ LE+GNP+IPNRITECRSYPLY+ +R
Sbjct  629  ELNAVLPKEVESARALLESGNPSIPNRITECRSYPLYRLVR  669



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVEHALSNGENEKNGSTSIFQKIVAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR A+E+GNP+ PNRI ECRSYPLYKF+R
Sbjct  619  ELKAVLPKEVESARGAVESGNPSTPNRIKECRSYPLYKFVR  659



>gb|AGA84059.1| phenylalanine ammonia lyase [Picrorhiza kurrooa]
Length=713

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCSA YPLMQKLRQVLVD+AL+NGE EKN STSIF KI AFE+
Sbjct  562  DLLRVVDREYVFAYVDDPCSATYPLMQKLRQVLVDNALKNGESEKNASTSIFHKIEAFEE  621

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR ALE GNPAI NRI ECRSYPLYKFIR
Sbjct  622  ELKSLLPKEVESARIALEAGNPAIGNRIKECRSYPLYKFIR  662



>dbj|BAF36975.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=311

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE +FAY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FED
Sbjct  160  DLLKVVDRETLFAYIDDPCLATYPLMQKLRQVLVDHALVNGEYEKDSKTSIFQKIATFED  219

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR+A E+GNPA+PN+I ECRSYPLYKF+R
Sbjct  220  ELKSLLPKEVESARAAYESGNPAMPNKINECRSYPLYKFVR  260



>gb|AGF50182.1| phenylalanine ammonia lyase, partial [Salvia officinalis]
Length=282

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL+RVVDREYVF+Y DDPC A YPLMQKLRQVLV+HAL+NGE EK+VSTSIF KI  FE+
Sbjct  131  DLIRVVDREYVFSYIDDPCLATYPLMQKLRQVLVEHALKNGEGEKSVSTSIFHKIEQFEE  190

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL ALLPKEVE AR ALE+G+PA+PNRI ECRSYPLYKFIR
Sbjct  191  ELMALLPKEVESARIALESGSPAVPNRIAECRSYPLYKFIR  231



>gb|ACM62741.1| phenylalanine ammonia-lyase [Garcinia mangostana]
Length=718

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPCSA YPLMQKLRQVLVDHAL NGE E+N +TS+FQKIAAFE+
Sbjct  567  DLLKVVDREYVFAYADDPCSATYPLMQKLRQVLVDHALANGEGERNPNTSVFQKIAAFEE  626

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKE+EG R A E+GN AIPNRI ECRSYPLYKF+R
Sbjct  627  ELKDLLPKEIEGVRLAYESGNTAIPNRIKECRSYPLYKFVR  667



>gb|AAK60274.1|AF383151_1 phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=687

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYV+AY DDPCSA YPLMQKLRQVLVDHA+ NGE EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREYVYAYVDDPCSATYPLMQKLRQVLVDHAMMNGEKEKNSSTSIFQKIGAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+  ENGNPAI N+I ECRSYPLYKF+R
Sbjct  619  ELKTLLPKEVESARTEYENGNPAISNKIKECRSYPLYKFVR  659



>emb|CAL91169.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=713

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCSA YPLMQKLR+VLVDHAL NGE EKN STSIFQKI AFED
Sbjct  562  DLLRVVDREYVFAYIDDPCSATYPLMQKLREVLVDHALNNGETEKNTSTSIFQKIGAFED  621

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVEG R++ E+G  AIPNRI  CRSYPLY+F+R
Sbjct  622  ELKAILPKEVEGVRTSYEDGTLAIPNRIKACRSYPLYRFVR  662



>emb|CAG27616.1| putative phenylalanine ammonia-lyase [Populus x canadensis]
Length=207

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VF Y DDPCSA YPLMQKLRQVLVDHAL NGE E N STSIFQKI AFE+
Sbjct  112  DLLKVVDREHVFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNSSTSIFQKIGAFEE  171

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  291
            ELK LLPKEVE  R  +ENGNPAIPNRITECRSYPL
Sbjct  172  ELKTLLPKEVESTRLEIENGNPAIPNRITECRSYPL  207



>gb|ADI40166.1| phenylalanine ammonia-lyase [Morus alba]
Length=726

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  575  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  634

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYKF+R
Sbjct  635  ELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVR  675



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIGAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  619  ELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVR  659



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREY+FAY DDPCS  YPLMQK+RQVLV+HAL NGE+EKNVSTSIFQKI AFE+
Sbjct  559  DLLKVVDREYIFAYIDDPCSETYPLMQKVRQVLVEHALNNGENEKNVSTSIFQKIVAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE  R+ LE+GNP IPNRI +CRSYPLYKF+R
Sbjct  619  ELKALLPKEVESTRAGLESGNPFIPNRIKDCRSYPLYKFVR  659



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  566  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  625

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYKF+R
Sbjct  626  ELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVR  666



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAYADDPCS NYPLMQKLRQVLVDHAL NG+ EKN STSIFQKI AFE+
Sbjct  560  DLLRVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALNNGDKEKNASTSIFQKIQAFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVEGAR A+E G   I NRI ECRSYPLYKFIR
Sbjct  620  ELKAVLPKEVEGARLAVEGGKEVIGNRIKECRSYPLYKFIR  660



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIGAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  619  ELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVR  659



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIGAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  619  ELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVR  659



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYV+AY DDPCSA YPLMQKLRQVLVDHA+ NGE EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREYVYAYVDDPCSATYPLMQKLRQVLVDHAMMNGEKEKNSSTSIFQKIGAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+  ENGNPAI N+I ECRSYPLYKF+R
Sbjct  619  ELKTLLPKEVESARTEYENGNPAISNKIKECRSYPLYKFVR  659



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVR  659



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL+NGE EK  +TSIFQKI AFED
Sbjct  562  DLLRVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALKNGETEKEANTSIFQKIGAFED  621

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL A LPKEVE AR ALE+GNPAIPN+I ECRSYPLYKF+R
Sbjct  622  ELIANLPKEVESARIALESGNPAIPNKINECRSYPLYKFVR  662



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+ VD EYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQK+AAFE+
Sbjct  571  DLLKAVDSEYVFAYIDDPCSATYPLMQKLRQVLVEHALANGENEKNASTSIFQKVAAFEE  630

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR +LENGN  IPNRI ECRSYPLYKF+R
Sbjct  631  ELKAILPKEVESARLSLENGNAGIPNRIQECRSYPLYKFVR  671



>ref|XP_010107519.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16201.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=535

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYV+AY DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+
Sbjct  384  DLLKVVDREYVYAYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEE  443

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR A ENGN AI N+ITECRSYPLYKF+R
Sbjct  444  ELKSLLPKEVESARIAYENGNAAISNKITECRSYPLYKFVR  484



>sp|Q40910.1|PAL4_POPKI RecName: Full=Phenylalanine ammonia-lyase G4, partial [Populus 
sieboldii x Populus grandidentata]
 dbj|BAA07861.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=571

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVF Y DDPCSA YPLMQKLRQVLVDHAL NGE E+N STSIFQKI AFE+
Sbjct  420  DLLKVVDREYVFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEQNSSTSIFQKIGAFEE  479

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR  LENGNPAIPNRIT+ RSYPLYKF+R
Sbjct  480  ELKILLPKEVESARLELENGNPAIPNRITDRRSYPLYKFVR  520



>ref|XP_011010447.1| PREDICTED: phenylalanine ammonia-lyase [Populus euphratica]
Length=715

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVDREYVFAY DDPCSA YPLMQKLRQVLVDHAL+NGE+EKN+STS+FQKI AFE+
Sbjct  564  ELLKVVDREYVFAYVDDPCSATYPLMQKLRQVLVDHALENGENEKNLSTSVFQKIGAFEE  623

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIReelgteiltgexVQS  351
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+REELG  +LTGE VQS
Sbjct  624  ELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYKFVREELGAVLLTGEKVQS  679



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVR  659



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  566  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  625

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYKF+R
Sbjct  626  ELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVR  666



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVD EYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKIAAFE+
Sbjct  564  DLLKVVDCEYVFAYVDDPCSATYPLMQKLRQVLVEHALTNGENEKNTSTSIFQKIAAFEE  623

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK +LPKEVE AR +LENGN AIPNRI +CRSYPLYKF+R
Sbjct  624  ELKVVLPKEVESARVSLENGNAAIPNRIKDCRSYPLYKFVR  664



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIRECRSYPLYKFVR  659



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  566  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  625

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEV+ AR+AL++G+  +PNRITECRSYPLYKF+R
Sbjct  626  ELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVR  666



>pir||S60043 phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanese aspen x 
large-toothed aspen (fragment)
Length=582

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVF Y DDPCSA YPLMQKLRQVLVDHAL NGE E+N STSIFQKI AFE+
Sbjct  431  DLLKVVDREYVFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEQNSSTSIFQKIGAFEE  490

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR  LENGNPAIPNRIT+ RSYPLYKF+R
Sbjct  491  ELKILLPKEVESARLELENGNPAIPNRITDRRSYPLYKFVR  531



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VV+REY+F YADDPCS+ YPLMQKLRQVLVDHA++NGE EKNV++SIFQKI AFED
Sbjct  570  ELLQVVEREYLFTYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNVNSSIFQKIVAFED  629

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPLY+ +R
Sbjct  630  ELKAVLPKEVESARAVVESGNPAIPNRITECRSYPLYRLVR  670



>dbj|BAF36972.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=688

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE VFAY DDPCSA YPLMQKLRQVLVDHAL N E+EKN++TSIFQKIA FED
Sbjct  537  DLLKVVDRETVFAYIDDPCSATYPLMQKLRQVLVDHALVNEENEKNMNTSIFQKIATFED  596

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPLYKF+R
Sbjct  597  ELKSLLPKEVESARAAYESGNPAIPNKINECRSYPLYKFVR  637



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGESEKNGSTSIFQKIGAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  619  ELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVR  659



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  559  DLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKILAFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  619  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVR  659



>dbj|BAF36971.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=717

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE +FAY DDPCSA YPLMQKLRQVLVDHAL NGE+EKN  TSIFQKIA FED
Sbjct  566  DLLKVVDRETLFAYIDDPCSATYPLMQKLRQVLVDHALVNGENEKNSKTSIFQKIATFED  625

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR+A E+GNP IPN+I ECRSYPLYKF+R
Sbjct  626  ELKSLLPKEVESARAAYESGNPTIPNKINECRSYPLYKFVR  666



>gb|ADO64252.1| PAL [Epimedium sagittatum]
Length=708

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+V+DREY+FAY DDPCSA YPLMQKLRQVLVDHAL NG++EK+++TSIFQKI+ FE+
Sbjct  557  DLLKVIDREYIFAYIDDPCSATYPLMQKLRQVLVDHALLNGQNEKDLNTSIFQKISTFEE  616

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE  R+A+E+GNP IPNRI ECRSYPLYKF+R
Sbjct  617  ELKALLPKEVESMRTAIESGNPLIPNRIKECRSYPLYKFVR  657



>gb|AIE16718.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AIE16721.1| phenylalanine ammonia-lyase, partial [Glycine soja]
Length=224

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREY+F+Y DDPCSA YPLMQKLRQVLVDHAL N E EK+V++SIFQKIA FE+
Sbjct  95   DLLKVVDREYIFSYIDDPCSATYPLMQKLRQVLVDHALVNAESEKDVNSSIFQKIAIFEE  154

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+A E+G  AIPN+I ECRSYPLYKF+R
Sbjct  155  ELKNLLPKEVESARAAYESGKAAIPNKIQECRSYPLYKFVR  195



>gb|ACR15762.1| phenylalanine ammonia-lyase [Litchi chinensis]
Length=723

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKNV++SIFQKI AFE+
Sbjct  572  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALFNGENEKNVTSSIFQKIGAFEE  631

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR   ENGN AIPN+I ECRSYPLYKF+R
Sbjct  632  ELKAVLPKEVENARQVYENGNAAIPNKIEECRSYPLYKFVR  672



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQ LRQVLV HAL NGE+EKN +TSIFQKI AFE+
Sbjct  564  DLLKVVDREYVFAYIDDPCSATYPLMQNLRQVLVQHALLNGENEKNSNTSIFQKITAFEE  623

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVEGAR A E+G+PA+PNRI ECRSYP+YKF+R
Sbjct  624  ELKALLPKEVEGARIAYESGSPAVPNRIKECRSYPIYKFVR  664



>ref|XP_010107518.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16200.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=769

 Score =   178 bits (452),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYV+ Y DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+
Sbjct  618  DLLKVVDREYVYTYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEE  677

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR A ENGN AI N+ITECRSYPLYKF+R
Sbjct  678  ELKSLLPKEVESARIAYENGNAAISNKITECRSYPLYKFVR  718



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LLRVVDREY+FAYADDPCS+NYPLMQKLRQVLVD A++NGE EKNV++SIFQKI AFED
Sbjct  572  ELLRVVDREYLFAYADDPCSSNYPLMQKLRQVLVDQAMKNGESEKNVNSSIFQKIGAFED  631

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL A+LPKEVE  R+ +E+GNP+IPNRITECRSYPLY+ +R
Sbjct  632  ELIAVLPKEVESVRAVVESGNPSIPNRITECRSYPLYRLVR  672



>gb|ADN32768.1| phenylalanine ammonia-lyase 2 [Scutellaria baicalensis]
Length=708

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL+RVVDREYVFAY DDPCS  YPLMQKLRQVLVDHAL+NGE EKN S+SIFQKI AFE+
Sbjct  557  DLIRVVDREYVFAYVDDPCSGTYPLMQKLRQVLVDHALKNGEAEKNPSSSIFQKIEAFEE  616

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR ALE+GNP I NRI ECRSYPLY+F+R
Sbjct  617  ELKSLLPKEVESARVALESGNPTIANRIRECRSYPLYRFVR  657



>ref|XP_010107520.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16202.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=725

 Score =   178 bits (451),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYV+ Y DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+
Sbjct  574  DLLKVVDREYVYTYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEE  633

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR A ENGN AI N+ITECRSYPLYKF+R
Sbjct  634  ELKSLLPKEVESARIAYENGNAAISNKITECRSYPLYKFVR  674



>gb|ABI79307.1| phenylalanine ammonia-lyase [Pyrus communis]
Length=282

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLR VLV+HAL NG+ E++ STSIFQKIA FE+
Sbjct  169  DLLKVVDREYVFAYIDDPCSATYPLMQKLRHVLVEHALSNGDKERSTSTSIFQKIATFEE  228

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE  R+  ENG  AIPNRI ECRSYPLYKF+R
Sbjct  229  ELKTLLPKEVETTRAEYENGKTAIPNRIKECRSYPLYKFVR  269



>ref|XP_006358655.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=709

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL VVDREY+FAYADDPCS+NYPLMQKLRQVLVD+A++NGE EKNV++SIFQKI AFED
Sbjct  558  ELLLVVDREYLFAYADDPCSSNYPLMQKLRQVLVDYAMKNGESEKNVNSSIFQKIGAFED  617

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK +LP EVE AR  LE+GNP+IPNRITECRSYPLY+F+R
Sbjct  618  ELKVVLPNEVENARVILESGNPSIPNRITECRSYPLYRFVR  658



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VV+REY+F YADDPCS+ YPLMQKLRQVLVDHA++NGE EKN+++SIFQKI AFED
Sbjct  570  ELLQVVEREYLFTYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNLNSSIFQKIVAFED  629

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+ +E+GNPAIPNRITECRSYPLY+ +R
Sbjct  630  ELKAVLPKEVESARAVVESGNPAIPNRITECRSYPLYRLVR  670



>dbj|BAA21643.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=715

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVDRE VFAYADDPCSA YPLMQKLRQVLVDHAL NGE+EKN STS+FQKIAAFED
Sbjct  564  ELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHALANGENEKNASTSVFQKIAAFED  623

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+R
Sbjct  624  ELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVR  664



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVDRE VFAYADDPCSA YPLMQKLRQVLVDHAL NGE+EKN STS+FQKIAAFED
Sbjct  563  ELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHALANGENEKNASTSVFQKIAAFED  622

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+R
Sbjct  623  ELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVR  663



>gb|AEW25950.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25983.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25991.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=403

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL N E EKN++TSIFQKIA FED
Sbjct  286  DLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNLNTSIFQKIATFED  345

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYKF+R
Sbjct  346  ELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVR  386



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL VVDREYVFAYADDPCS NYPL+QKLRQVLVDHAL NGE E N STSIFQKI AFE+
Sbjct  566  DLLNVVDREYVFAYADDPCSCNYPLIQKLRQVLVDHALLNGEGEMNSSTSIFQKIGAFEE  625

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIReelgteiltgexVQS  351
            ELKA+LPKEVE AR  LEN  P IPNRI ECRSYPLYKF+R+ELGT +LTGE VQS
Sbjct  626  ELKAILPKEVESARCDLENSKPTIPNRIQECRSYPLYKFVRKELGTNLLTGENVQS  681



>gb|KHN00850.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL++VDREYV+AY DDPCSA YPLMQKLR VLVDHALQNG+ E N STSIFQKI AFE+
Sbjct  468  DLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHALQNGDKEVNSSTSIFQKIGAFEE  527

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL ALLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+R
Sbjct  528  ELNALLPKEVESARIEVENGNPAIPNRIKECRSYPLYKFVR  568



>sp|Q01861.1|PAL1_PEA RecName: Full=Phenylalanine ammonia-lyase 1 [Pisum sativum]
 dbj|BAA00885.1| phenylalanine ammonia-lyase [Pisum sativum]
 dbj|BAA00886.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=723

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDRE+VFAY DDPCSA YPLMQKLRQVLVDHAL NGE EKN++TSIFQKIA FED
Sbjct  572  DLLRVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHALVNGESEKNLNTSIFQKIATFED  631

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE  R+A E+GNP +PN+I  CRSYPLY+F+R
Sbjct  632  ELKTLLPKEVESTRAAYESGNPTVPNKINGCRSYPLYRFVR  672



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+ VDREYVFAY DDPCSA Y +MQKLRQVLV+HAL NGE+EKN STSIFQKIAAFE+
Sbjct  569  DLLKAVDREYVFAYIDDPCSATYSMMQKLRQVLVEHALTNGENEKNASTSIFQKIAAFEE  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+++ENGN AIPN+I ECRS+PLYKF+R
Sbjct  629  ELKAVLPKEVESARASVENGNAAIPNKIKECRSFPLYKFVR  669



>prf||2001451A Phe ammonia lyase
Length=723

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDRE+VFAY DDPCSA YPLMQKLRQVLVDHAL NGE EKN++TSIFQKIA FED
Sbjct  572  DLLRVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHALVNGESEKNLNTSIFQKIATFED  631

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE  R+A E+GNP +PN+I  CRSYPLY+F+R
Sbjct  632  ELKTLLPKEVESTRAAYESGNPTVPNKINGCRSYPLYRFVR  672



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY+FAY DDPCS  YPLMQKLRQVLV+HAL N E+EK+ STSIFQKI AFED
Sbjct  561  DLLRVVDREYLFAYIDDPCSTTYPLMQKLRQVLVEHALNNTENEKSGSTSIFQKIEAFED  620

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE +R ALE+GNPAIPNRI +CRSYPLYKF+R
Sbjct  621  ELKAVLPKEVESSRVALESGNPAIPNRIKDCRSYPLYKFVR  661



>ref|XP_007162755.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
 gb|ESW34749.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
Length=240

 Score =   169 bits (427),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVF+Y DDPCS  YPLMQKLRQVLVDHAL N E+EK+V+TSIFQKIA FE+
Sbjct  89   DLLKVVDREYVFSYIDDPCSGTYPLMQKLRQVLVDHALINAENEKDVNTSIFQKIATFEE  148

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK +LPKEVE  R+A E+G  AIPN+I ECRSYPLYKF+R
Sbjct  149  ELKTILPKEVESTRAAYESGKAAIPNKIKECRSYPLYKFVR  189



>sp|Q04593.1|PAL2_PEA RecName: Full=Phenylalanine ammonia-lyase 2 [Pisum sativum]
 dbj|BAA00887.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=724

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDRE+VF+Y DDPCSA YPLMQKLRQVLVDHAL NGE EKN++TSIFQKIA FED
Sbjct  573  DLLRVVDREHVFSYIDDPCSATYPLMQKLRQVLVDHALVNGESEKNLNTSIFQKIATFED  632

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR A ENGN  I N+I ECRSYPLYKF+R
Sbjct  633  ELKTLLPKEVESARGAYENGNTTISNKIKECRSYPLYKFVR  673



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPC+A YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  566  DLLKVVDREYVFAYIDDPCNATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  625

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEV+ AR+AL++G   +PNRITECRSYPLYKF+R
Sbjct  626  ELKVLLPKEVDSARAALDSGTAGVPNRITECRSYPLYKFVR  666



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VV+REY+F YADDPCS  YPLMQKLRQVLVDHA++NGE E NV++SIFQKI AFED
Sbjct  571  ELLQVVEREYLFTYADDPCSCTYPLMQKLRQVLVDHAMKNGESESNVNSSIFQKIVAFED  630

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  LE+GNP IPNRITECRSYPLY+F+R
Sbjct  631  ELKAVLPKEVESARVVLESGNPVIPNRITECRSYPLYRFVR  671



>emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera]
Length=686

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPLMQ +RQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  535  DLLKVVDREHVFAYIDDPCSATYPLMQNVRQVLVEHALNNGENEKNGSTSIFQKILAFEE  594

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  595  ELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVR  635



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCS  YPLMQKLR+VLVDHAL+NG+++KN +TSIFQKI AFE+
Sbjct  639  DLLRVVDREYVFAYIDDPCSGTYPLMQKLREVLVDHALKNGDNQKNAATSIFQKIEAFEE  698

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE ARSA+ENGN A+ NRI ECRSYPLYKF+R
Sbjct  699  ELKAVLPKEVESARSAVENGNAAVGNRIKECRSYPLYKFMR  739



>ref|XP_009794410.1| PREDICTED: phenylalanine ammonia-lyase-like [Nicotiana sylvestris]
Length=717

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPC+ NYPL+QKLRQVLVDHAL NGE EKN STSIF+KI+AFE+
Sbjct  566  DLLKVVDREYVFAYADDPCNCNYPLIQKLRQVLVDHALLNGEGEKNSSTSIFEKISAFEE  625

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIReelgteiltgexVQS  351
            ELKA+LPKEVE AR  LEN  P IPNRI ECRSYPLYKF+R+ELGT +LTGE VQS
Sbjct  626  ELKAILPKEVESARCDLENCKPTIPNRIQECRSYPLYKFVRKELGTNLLTGENVQS  681



>gb|KHG26972.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=710

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREY++AYADDPCSANYPL+QKLRQVLVDHAL NG+ EK+ +TSIFQKI  FE+
Sbjct  559  DLLRVVDREYLYAYADDPCSANYPLIQKLRQVLVDHALMNGDREKDSTTSIFQKIGVFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK  LPKEVE AR+  ENGNPAIPN+I ECRSYPLYKF+R
Sbjct  619  ELKTHLPKEVESARTEFENGNPAIPNKIEECRSYPLYKFVR  659



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL+RVVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL+NG+ EK VSTSIFQKI +FE+
Sbjct  564  DLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALKNGDGEKTVSTSIFQKIESFEE  623

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR A+E GN AI NRI ECRSYPLYKFIR
Sbjct  624  ELKALLPKEVESARMAVEGGNLAISNRIAECRSYPLYKFIR  664



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVD+EY+FAY DDPC++NYPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFED
Sbjct  572  ELLQVVDKEYLFAYVDDPCNSNYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIVAFED  631

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK +LPKEVE AR  +E+GNPAIPNRITECRSYPLY+ +R
Sbjct  632  ELKVVLPKEVESARVVVESGNPAIPNRITECRSYPLYRLVR  672



>ref|XP_003625662.1| Phenylalanine ammonia-lyase [Medicago truncatula]
Length=456

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPL QKLRQVLVDHAL NGE EKN++TSIFQKIA FE+
Sbjct  305  DLLKVVDREHVFAYIDDPCSATYPLSQKLRQVLVDHALVNGESEKNLNTSIFQKIATFEE  364

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR+A E+GNP IPN+I  CRSYPLYKF+R
Sbjct  365  ELKSLLPKEVESARTAYESGNPTIPNKINGCRSYPLYKFVR  405



>gb|ADD12041.1| phenylalanine ammonia lyase [Cistanche deserticola]
 gb|ADD16918.1| phenylalanine ammonia lyase [Cistanche deserticola]
Length=709

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCS  YPLM+KLRQVLVDHAL+NGE EKN  TSIFQKI AFED
Sbjct  558  DLLRVVDREYVFAYVDDPCSGTYPLMEKLRQVLVDHALENGESEKNEKTSIFQKIRAFED  617

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL+ALLPKEVE AR  +E+G PAI NRI ECRSYPLYKFIR
Sbjct  618  ELRALLPKEVESARIGVESGKPAIGNRIKECRSYPLYKFIR  658



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVD+EY+FAY DDPC++NYPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFED
Sbjct  568  ELLQVVDKEYLFAYVDDPCNSNYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIVAFED  627

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK +LPKEVE AR  +E+GNPAIPNRITECRSYPLY+ +R
Sbjct  628  ELKVVLPKEVESARVVVESGNPAIPNRITECRSYPLYRLVR  668



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  7    LLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDE  186
            LL+VVDRE+VFAY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+E
Sbjct  557  LLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEEE  616

Query  187  LKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            LKA+LPKEVE AR  +E+GNP+IPNRI ECRSYPLYKF+R
Sbjct  617  LKAVLPKEVESARGGVESGNPSIPNRIRECRSYPLYKFVR  656



>gb|EYU34451.1| hypothetical protein MIMGU_mgv1a002104mg [Erythranthe guttata]
Length=714

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL+R+VDREYVFAY DDPCS  YPLMQKLR+VLV+HAL+NGE+EKN +TSIFQKI  FE+
Sbjct  563  DLMRIVDREYVFAYIDDPCSGTYPLMQKLREVLVEHALKNGENEKNANTSIFQKIGDFEE  622

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR ALE+GN A+ NRITECRSYPLYKFIR
Sbjct  623  ELKAILPKEVESARVALESGNAAVGNRITECRSYPLYKFIR  663



>sp|O04058.2|PALY_HELAN RecName: Full=Phenylalanine ammonia-lyase [Helianthus annuus]
 emb|CAA73065.1| phenylalanine ammonia lyase [Helianthus annuus]
Length=667

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAYADDPC   YPLMQKLRQVLVDHAL NGE EKN +TSIFQKIA FED
Sbjct  560  DLLRVVDREYVFAYADDPCLTTYPLMQKLRQVLVDHALNNGETEKNANTSIFQKIATFED  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE  R A ENG  +IPNRI  CRSYPLY+F+R
Sbjct  620  ELKAILPKEVESVRVAFENGTMSIPNRIKACRSYPLYRFVR  660



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+ VD EYVF+Y DDPCSA YPLMQKLRQVLV+HAL NG +E N STSIFQKIAAFE+
Sbjct  567  DLLKAVDHEYVFSYIDDPCSATYPLMQKLRQVLVEHALSNGNNENNASTSIFQKIAAFEE  626

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE +R +++NGNPAIPN+ITECRSYPLYKF+R
Sbjct  627  ELKTLLPKEVENSRVSIQNGNPAIPNKITECRSYPLYKFVR  667



>dbj|BAF36969.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=437

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE +FAY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKI +FED
Sbjct  286  DLLKVVDRETLFAYIDDPCLATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIGSFED  345

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPLYKF+R
Sbjct  346  ELKSLLPKEVESARAAYESGNPAIPNKINECRSYPLYKFVR  386



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+R
Sbjct  620  ELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVR  660



>ref|XP_006589419.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X1 [Glycine 
max]
 ref|XP_006589420.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X2 [Glycine 
max]
Length=717

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL++VDREYV+AY DDPCSA YPLMQKLR VLVDHALQNG+ E + STSIFQKI AFE+
Sbjct  566  DLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHALQNGDKEASSSTSIFQKIGAFEE  625

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL ALLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+R
Sbjct  626  ELNALLPKEVESARIEVENGNPAIPNRIKECRSYPLYKFVR  666



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE VF+Y DD CSA YPLMQKLRQVLVDHAL NGE EKN STSIFQKI AFE+
Sbjct  561  DLLKVVDREQVFSYVDDACSATYPLMQKLRQVLVDHALANGESEKNASTSIFQKIRAFEE  620

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR A ENGNPAI N+I ECRSYPLYKF+R
Sbjct  621  ELKALLPKEVESAREAYENGNPAIANKIKECRSYPLYKFVR  661



>gb|ABK32084.1| phenylalanine ammonia-lyase, partial [Prunus cerasifera x Prunus 
munsoniana]
Length=290

 Score =   169 bits (429),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLR VLV+HAL NGE EK+ STSIFQKI AFED
Sbjct  190  DLLKVVDREYVFAYVDDPCSATYPLMQKLRHVLVEHALNNGEKEKSSSTSIFQKITAFED  249

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR   +NG  A PNRI +CRSYPLYKF+R
Sbjct  250  ELKTLLPKEVESARLEYDNGKSATPNRIKDCRSYPLYKFVR  290



>gb|ABV44808.1| phenylalanine ammonia lyase 1 [Eriobotrya japonica]
Length=330

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVF Y DDPCSA YPLMQKLR VLV+HAL NG+ E++ STSIFQKIAAFE+
Sbjct  179  DLLKVVDREYVFTYIDDPCSATYPLMQKLRHVLVEHALSNGDKERSTSTSIFQKIAAFEE  238

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE  R+  ENG  AIPNRI ECRSYPLYKF+R
Sbjct  239  ELKALLPKEVETTRAEYENGKTAIPNRIKECRSYPLYKFVR  279



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+R
Sbjct  620  ELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVR  660



>gb|KHN17149.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL++VDREYV+AY DDPCSA YPLMQKLR VLVDHALQNG+ E + STSIFQKI AFE+
Sbjct  468  DLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHALQNGDKEASSSTSIFQKIGAFEE  527

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL ALLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+R
Sbjct  528  ELNALLPKEVESARIEVENGNPAIPNRIKECRSYPLYKFVR  568



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPCSA YPLMQKLRQ+LV+HAL NGE+EKN  TS+FQKI+AFE+
Sbjct  563  DLLKVVDREYVFAYADDPCSATYPLMQKLRQILVEHALANGENEKNAGTSVFQKISAFEE  622

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE  R A E+GNPA  NRI ECRSYPLYKF+R
Sbjct  623  ELKTLLPKEVESVRIAYESGNPATANRIKECRSYPLYKFVR  663



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPCSA YPLMQKLRQ+LV+HAL NGE+EKN  TS+FQKI+AFE+
Sbjct  563  DLLKVVDREYVFAYADDPCSATYPLMQKLRQILVEHALANGENEKNAGTSVFQKISAFEE  622

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE  R A E+GNPA  NRI ECRSYPLYKF+R
Sbjct  623  ELKTLLPKEVESVRIAYESGNPATANRIKECRSYPLYKFVR  663



>gb|KJB46526.1| hypothetical protein B456_007G373700 [Gossypium raimondii]
Length=670

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+ VD EYVF+Y DDPCSA YPLMQKLRQVLV+HAL NG +E N STSIFQKIAAFE+
Sbjct  519  DLLKAVDHEYVFSYIDDPCSATYPLMQKLRQVLVEHALSNGNNENNASTSIFQKIAAFEE  578

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE +R ++ENGNPAIPN+IT+CRSYPLYKF+R
Sbjct  579  ELKTLLPKEVENSRVSIENGNPAIPNKITKCRSYPLYKFVR  619



>ref|XP_011041027.1| PREDICTED: phenylalanine ammonia-lyase G2B-like isoform X2 [Populus 
euphratica]
Length=711

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+R
Sbjct  620  ELKTLLPKEVENARLEVENGNPAIPNRIKECRSYPLYKFVR  660



>ref|XP_009759945.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana sylvestris]
Length=718

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL VVDREY FAYADDPCSANYPLMQKLRQV VDHAL NG+ EKN STSIF KI+AFE+
Sbjct  567  DLLTVVDREYCFAYADDPCSANYPLMQKLRQVSVDHALSNGDMEKNSSTSIFHKISAFEE  626

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIReelgteiltgexVQS  351
            ELK +LPKE+E AR  LENG P IPNRI ECRSYPLYKF+REEL T  LTGE VQS
Sbjct  627  ELKIVLPKEIESARCNLENGKPTIPNRIQECRSYPLYKFVREELKTNYLTGEKVQS  682



>ref|XP_003556238.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Glycine max]
Length=717

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL++VDREYV+AY DDPCSA YPLMQKLR VLVDHALQNG+ E N STSIFQKI AFE+
Sbjct  566  DLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHALQNGDKEVNSSTSIFQKIGAFEE  625

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            EL ALLPKEVE +R  +ENGNPAIPNRI ECRSYPLYKF+R
Sbjct  626  ELNALLPKEVESSRIEVENGNPAIPNRIKECRSYPLYKFVR  666



>ref|XP_010107516.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
 gb|EXC16198.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
Length=534

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYV+ Y DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+
Sbjct  383  DLLKVVDREYVYTYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEE  442

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+ LPKEVE AR A ENGN AI N+ITECRSYPLYKF+R
Sbjct  443  ELKSFLPKEVESARIAYENGNAAISNKITECRSYPLYKFVR  483



>ref|XP_011041025.1| PREDICTED: phenylalanine ammonia-lyase G2B [Populus euphratica]
Length=711

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+R
Sbjct  620  ELKTLLPKEVENARLEVENGNPAIPNRIKECRSYPLYKFVR  660



>gb|ADR78835.1| phenylalanine ammonia lyase [Ziziphus jujuba]
Length=559

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVDREYVFAY DDPCSA YPLMQKLRQV+V+HAL+NGE+E+N STSIFQKIAAFE+
Sbjct  408  ELLQVVDREYVFAYIDDPCSATYPLMQKLRQVIVEHALKNGENERNASTSIFQKIAAFEE  467

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+  ENGNPAIPN+I E RSYPLYKF+R
Sbjct  468  ELKTLLPKEVESARAEYENGNPAIPNKIKERRSYPLYKFVR  508



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVDREYVFAY DDPCSA YPLMQKLRQV VDHAL+NGE+EKN STS+FQKI AFE+
Sbjct  564  ELLKVVDREYVFAYVDDPCSATYPLMQKLRQVFVDHALENGENEKNFSTSVFQKIEAFEE  623

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIReelgteiltgexVQS  351
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGE VQS
Sbjct  624  ELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYKFVREELGTVLLTGEKVQS  679



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVDREYVFAY DDPCSA YPLMQKLRQV VDHAL+NGE+EKN STS+FQKI AFE+
Sbjct  564  ELLKVVDREYVFAYVDDPCSATYPLMQKLRQVFVDHALENGENEKNFSTSVFQKIEAFEE  623

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIReelgteiltgexVQS  351
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGE VQS
Sbjct  624  ELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYKFVREELGTVLLTGEKVQS  679



>dbj|BAF36973.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=569

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE VFAY DDPCSA YPLMQKLRQVLVDHAL N E+EKN +TSIFQKI+ FED
Sbjct  418  DLLKVVDREVVFAYIDDPCSATYPLMQKLRQVLVDHALVNAENEKNQNTSIFQKISTFED  477

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR+A E+GNP IPN+I ECRSYPLYKF+R
Sbjct  478  ELKSLLPKEVESARNAYESGNPVIPNKINECRSYPLYKFVR  518



>gb|ADB44001.1| phenylalanine ammonia lyase [Mangifera indica]
Length=126

 Score =   164 bits (414),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL++VVDRE+VFAY DDPCSA YPLMQKLR+ LVDHAL NGE+EKNV++SIFQKI AFE+
Sbjct  31   DLIKVVDREHVFAYIDDPCSATYPLMQKLRRELVDHALNNGENEKNVNSSIFQKIGAFEE  90

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPL  291
            ELKA+LPKEVE AR  +ENGN AIPNRI ECRSYPL
Sbjct  91   ELKAVLPKEVENARVVIENGNAAIPNRIKECRSYPL  126



>ref|XP_011041026.1| PREDICTED: phenylalanine ammonia-lyase G2B-like isoform X1 [Populus 
euphratica]
Length=749

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  598  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  657

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+R
Sbjct  658  ELKTLLPKEVENARLEVENGNPAIPNRIKECRSYPLYKFVR  698



>emb|CAL91038.1| phenylalanine ammonia-lyase 4 [Cynara cardunculus var. scolymus]
Length=339

 Score =   170 bits (431),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPCSA YPLMQ+LRQVLVDHAL NGE EKN +TSIFQKIA FED
Sbjct  188  DLLRVVDREYVFAYIDDPCSATYPLMQRLRQVLVDHALNNGETEKNTNTSIFQKIATFED  247

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE  R+A E  + +IPNRI  CRSYPLY+F+R
Sbjct  248  ELKAILPKEVESVRTAYETDSLSIPNRIKACRSYPLYRFVR  288



>gb|ACT53399.1| phenylalanine ammonia-lyase 2 [Ageratina adenophora]
Length=720

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPC A YPLMQKLRQVLVDHAL  GE EKN++TSIFQKI  FED
Sbjct  569  DLLRVVDREYVFAYIDDPCLATYPLMQKLRQVLVDHALNAGETEKNLNTSIFQKITTFED  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVEG R A ENG  +IPNRI ECRSYPLY+F+R
Sbjct  629  ELKAILPKEVEGVRVAFENGTLSIPNRIKECRSYPLYRFVR  669



>gb|AEW25958.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
Length=493

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL N E EKN++TSIFQKIA FED
Sbjct  376  DLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNLNTSIFQKIATFED  435

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYKF+R
Sbjct  436  ELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVR  476



>gb|AEW26014.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26017.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=493

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL N E EKN++TSIFQKIA FED
Sbjct  376  DLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNLNTSIFQKIATFED  435

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYKF+R
Sbjct  436  ELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVR  476



>gb|AEW25999.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW26001.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW26005.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=493

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL N E EKN++TSIFQKIA FED
Sbjct  376  DLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNLNTSIFQKIATFED  435

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYKF+R
Sbjct  436  ELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVR  476



>gb|AEW25988.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=493

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL N E EKN++TSIFQKIA FED
Sbjct  376  DLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNLNTSIFQKIATFED  435

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYKF+R
Sbjct  436  ELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVR  476



>gb|ACV30588.1| phenylalanine ammonia-lyase [Carica papaya]
Length=268

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREY+FAYADDPCSA YPLMQKLRQVLVDHAL N + +KN  +SIF KI AFE+
Sbjct  117  DLLKVVDREYLFAYADDPCSATYPLMQKLRQVLVDHALINADRDKNSGSSIFHKIGAFEE  176

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVEG R  +E GN AIPNRI ECRSYPLYKF+R
Sbjct  177  ELKTLLPKEVEGTRLEVEAGNAAIPNRIKECRSYPLYKFVR  217



>gb|AAK15640.1|AF326116_1 phenylalanine ammonia-lyase [Agastache rugosa]
Length=716

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +L+RVVDREYVF Y DDPC A YPLMQKLRQVLVDHAL+NGE EKNVSTSIF KI AFE+
Sbjct  565  ELIRVVDREYVFTYIDDPCLATYPLMQKLRQVLVDHALKNGESEKNVSTSIFHKIEAFEE  624

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR ALE+G+PA+ NRI ECRS+PLYKFIR
Sbjct  625  ELKALLPKEVESARIALESGSPAVANRIEECRSFPLYKFIR  665



>dbj|BAF36968.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=690

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE +FAY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FED
Sbjct  539  DLLKVVDRETLFAYIDDPCLATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIATFED  598

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPLYKF+R
Sbjct  599  ELKSLLPKEVESARAAYESGNPAIPNKINECRSYPLYKFVR  639



>dbj|BAF36974.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=684

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE +FAY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FED
Sbjct  533  DLLKVVDRETLFAYIDDPCLATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIATFED  592

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR+A E+GNPAIPN+I ECRSYPLYKF+R
Sbjct  593  ELKSLLPKEVESARAAYESGNPAIPNKINECRSYPLYKFVR  633



>gb|AFK47120.1| unknown [Lotus japonicus]
Length=206

 Score =   166 bits (420),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL VVDRE VFAY DDPCS  YPLMQKLRQ LVDHAL+N + EKNV+TSIFQKIA FED
Sbjct  55   DLLTVVDREDVFAYIDDPCSGTYPLMQKLRQSLVDHALENADAEKNVNTSIFQKIAIFED  114

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR A +NG  AIPN+I ECRSYPLYKF+R
Sbjct  115  ELKAILPKEVESARVAYDNGESAIPNKIKECRSYPLYKFVR  155



>gb|AEW25959.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW26008.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=493

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL N E EKN++TSIFQKIA FED
Sbjct  376  DLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNLNTSIFQKIATFED  435

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYKF+R
Sbjct  436  ELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVR  476



>gb|AEW25957.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=493

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL N E EKN++TSIFQKIA FED
Sbjct  376  DLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNLNTSIFQKIATFED  435

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYKF+R
Sbjct  436  ELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVR  476



>gb|AEW25989.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=493

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL N E EKN++TSIFQKIA FED
Sbjct  376  DLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNLNTSIFQKIATFED  435

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYKF+R
Sbjct  436  ELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVR  476



>gb|AEW25949.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25951.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25952.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25953.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25954.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25955.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25960.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25962.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25964.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25965.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25966.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25968.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25969.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25971.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25972.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25973.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25974.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25975.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25976.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25977.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25978.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25980.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25986.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25993.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25995.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25996.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25998.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW26000.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW26004.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW26007.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW26009.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26012.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26013.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26015.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26016.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW26018.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=493

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL N E EKN++TSIFQKIA FED
Sbjct  376  DLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNLNTSIFQKIATFED  435

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYKF+R
Sbjct  436  ELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVR  476



>gb|AEW26006.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=493

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL N E EKN++TSIFQKIA FED
Sbjct  376  DLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNLNTSIFQKIATFED  435

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYKF+R
Sbjct  436  ELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVR  476



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVDREYVFAYADDPCS+ YPLMQKLRQV+VDHAL NG++EKN +TSIFQKI+AFE 
Sbjct  570  ELLKVVDREYVFAYADDPCSSTYPLMQKLRQVIVDHALLNGDNEKNANTSIFQKISAFEA  629

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+A E+GN  IPNRI ECRSYPLYKF+R
Sbjct  630  ELKTLLPKEVEAARAAYESGNAPIPNRIMECRSYPLYKFVR  670



>gb|AEW25984.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=493

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL N E EKN++TSIFQKIA FED
Sbjct  376  DLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNLNTSIFQKIATFED  435

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYKF+R
Sbjct  436  ELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVR  476



>ref|XP_006290660.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
 gb|EOA23558.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
Length=718

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE VF YADDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+
Sbjct  567  DLLKVVDREQVFTYADDPCSATYPLMQKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEE  626

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE  R+A  +GN AIPNRI ECRSYPLYKF+R
Sbjct  627  ELKAVLPKEVEATRAAYGSGNAAIPNRIKECRSYPLYKFVR  667



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVDREYVFAYADDPCS+ YPLMQKLRQV+VDHAL NG++EKN +TSIFQKI+AFE 
Sbjct  570  ELLKVVDREYVFAYADDPCSSTYPLMQKLRQVIVDHALLNGDNEKNANTSIFQKISAFEA  629

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+A E+GN  IPNRI ECRSYPLYKF+R
Sbjct  630  ELKTLLPKEVEAARAAYESGNAPIPNRIMECRSYPLYKFVR  670



>gb|AEW25997.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=493

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAYADDPC A YPLMQKLRQVLVDHAL N E EKN++TSIFQKIA FED
Sbjct  376  DLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNLNTSIFQKIATFED  435

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A ENG   I N+I ECRSYPLYKF+R
Sbjct  436  ELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVR  476



>gb|ABN79671.2| phenylalanine ammonia-lyase [Rudbeckia hirta]
Length=720

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLLRVVDREYVFAY DDPC A YPLMQKLRQVLVDHAL NGE EKN +TSIFQKIA FED
Sbjct  569  DLLRVVDREYVFAYIDDPCLATYPLMQKLRQVLVDHALNNGETEKNTNTSIFQKIATFED  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE  R A ENG  +IPNRI  CRSYPLY+F+R
Sbjct  629  ELKAILPKEVESVRVAFENGTMSIPNRIKACRSYPLYRFVR  669



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   175 bits (444),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL++VVDREYVFAY DDPCSA+ PLMQKLRQVLVDHAL NG+ EKN +TSIFQKI AFED
Sbjct  569  DLIKVVDREYVFAYIDDPCSASSPLMQKLRQVLVDHALDNGDREKNSTTSIFQKIGAFED  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+ LE+GN AIPNRI ECRSYPLYK +R
Sbjct  629  ELKTLLPKEVEIARTELESGNAAIPNRIKECRSYPLYKIVR  669



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   175 bits (444),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE +F+Y DDPCSA YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FED
Sbjct  553  DLLKVVDRETLFSYIDDPCSATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIATFED  612

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR+A E+GNP IPN+I ECRSYPLYKF+R
Sbjct  613  ELKSLLPKEVESARAAYESGNPTIPNKINECRSYPLYKFVR  653



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE E N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERETNSTTSIFQKIGSFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+R
Sbjct  620  ELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVR  660



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL VV+REY+FAY DDPCSA YPLMQ+LRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  579  DLLMVVEREYLFAYIDDPCSATYPLMQRLRQVLVEHALTNGENEKNASTSIFQKITAFEE  638

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK +LPKEVE AR+A E+GN AIPNRI ECRSYPLYKF+R
Sbjct  639  ELKTILPKEVESARAAYESGNAAIPNRIVECRSYPLYKFVR  679



>ref|XP_002862326.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38584.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=220

 Score =   166 bits (421),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVDRE V+ YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+
Sbjct  69   NLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALINGESEKNAVTSIFHKIGAFEE  128

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR+A +NG  AIPNRI ECRSYPLY+F+R
Sbjct  129  ELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVR  169



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPL QKLRQVLVDHAL NGE EKN++TSIFQKIA FE+
Sbjct  573  DLLKVVDREHVFAYIDDPCSATYPLSQKLRQVLVDHALVNGESEKNLNTSIFQKIATFEE  632

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR+A E+GNP IPN+I  CRSYPLYKF+R
Sbjct  633  ELKSLLPKEVESARTAYESGNPTIPNKINGCRSYPLYKFVR  673



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VFAY DDPCSA YPL QKLRQVLVDHAL NGE EKN++TSIFQKIA FE+
Sbjct  573  DLLKVVDREHVFAYIDDPCSATYPLSQKLRQVLVDHALVNGESEKNLNTSIFQKIATFEE  632

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK+LLPKEVE AR+A E+GNP IPN+I  CRSYPLYKF+R
Sbjct  633  ELKSLLPKEVESARTAYESGNPTIPNKINGCRSYPLYKFVR  673



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVDRE VFAYADDPCSANYPLM+KLRQVLVDHAL NGE+EKN STS+FQKI AFE+
Sbjct  563  ELLKVVDREDVFAYADDPCSANYPLMKKLRQVLVDHALANGENEKNASTSVFQKIGAFEE  622

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+R
Sbjct  623  ELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVR  663



>gb|AHZ30594.1| phenylalanine ammonia lyase-2, partial [Prunus domestica]
Length=701

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+
Sbjct  553  DLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEE  612

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEV+  R+AL++G+  +PNRITECR YPLYKF+R
Sbjct  613  ELKVLLPKEVDSXRAALDSGSAGVPNRITECRFYPLYKFVR  653



>ref|XP_004253518.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Solanum 
lycopersicum]
Length=582

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL VVDREY+FAYADDPCS+NYPLMQKLRQVLVD+A++NGE EKNV++SIFQKI AFED
Sbjct  431  ELLLVVDREYLFAYADDPCSSNYPLMQKLRQVLVDYAMKNGESEKNVNSSIFQKIGAFED  490

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK +LP EVE AR  LE G+P IPNRITECRSYPLY+F+R
Sbjct  491  ELKVVLPDEVENARVVLEGGSPLIPNRITECRSYPLYRFVR  531



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VF Y DDP SA YPLMQKLRQVLVDHAL+NG++EKN STSIFQKIAAFE+
Sbjct  563  DLLKVVDREHVFTYIDDPTSATYPLMQKLRQVLVDHALENGDNEKNSSTSIFQKIAAFEE  622

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+A ENGN ++PN+I ECRSYPLYKF+R
Sbjct  623  ELKTLLPKEVERARTAYENGNSSVPNKIKECRSYPLYKFVR  663



>pir||JQ1070 phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  (fragment)
Length=416

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREY FAY DDPCS  YPLMQKLRQVLVD+AL NGE+EKN +TSIFQKIA+FE+
Sbjct  265  DLLKVVDREYTFAYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNTNTSIFQKIASFEE  324

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVEGAR A EN   AIPN+I ECRSYPLYKF+R
Sbjct  325  ELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPLYKFVR  365



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL++VVDREYVFAY DDPCSA+YPLMQKLRQVLVDHAL NG+ EKN +TSIFQKI AFED
Sbjct  569  DLIKVVDREYVFAYIDDPCSASYPLMQKLRQVLVDHALDNGDREKNSTTSIFQKIGAFED  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+ LE+GN AI NRI ECRSYPLYK +R
Sbjct  629  ELKTLLPKEVEIARTELESGNAAIANRIKECRSYPLYKIVR  669



>sp|Q43052.1|PAL2_POPKI RecName: Full=Phenylalanine ammonia-lyase G2B [Populus sieboldii 
x Populus grandidentata]
 pir||S60042 phenylalanine ammonia-lyase (EC 4.3.1.5) 2b - Japanese aspen 
x large-toothed aspen
 dbj|BAA07860.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=710

 Score =   174 bits (442),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 79/101 (78%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VF+Y DDPCSA YPLMQKLRQVLV+HAL NGE  +N +TSIFQKI +FE+
Sbjct  559  DLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGEKVRNSTTSIFQKIGSFEE  618

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+R
Sbjct  619  ELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVR  659



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVDRE VFAYADDPCSA YPLMQKLRQVLVDHAL NGE+EKN STS+FQKI AFE+
Sbjct  563  ELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHALANGENEKNTSTSVFQKITAFEE  622

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+R
Sbjct  623  ELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVR  663



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL++VVDREYVFAY DDPCSA+YPLMQKLRQVLVDHAL NG+ EKN +TSIFQKI AFED
Sbjct  569  DLIKVVDREYVFAYIDDPCSASYPLMQKLRQVLVDHALDNGDREKNSTTSIFQKIGAFED  628

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR+ LE+GN AI NRI ECRSYPLYK +R
Sbjct  629  ELKTLLPKEVEIARTELESGNAAIANRIKECRSYPLYKIVR  669



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VF+Y DDPCSA YPLMQ LRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQNLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+R
Sbjct  620  ELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVR  660



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            +LL+VVDRE VFAYADDPCSA YPLMQKLRQVLVDHAL NGE+EKN STS+FQKIA FE+
Sbjct  563  ELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHALANGENEKNASTSVFQKIATFEE  622

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+R
Sbjct  623  ELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVR  663



>ref|XP_009103852.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Brassica rapa]
Length=718

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE VF Y DDPCSA+YPLMQKLRQV+VDHAL NGE EKNV TSIFQKI AFE+
Sbjct  567  DLLKVVDREQVFTYVDDPCSASYPLMQKLRQVIVDHALANGETEKNVETSIFQKIGAFEE  626

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK +LPKEV+ AR A  NGN AIPNRI ECRSYPLYKF+R
Sbjct  627  ELKTVLPKEVDAAREAYGNGNAAIPNRIKECRSYPLYKFVR  667



>gb|AIL23235.1| phenylalanine ammonia-lyase [Astragalus chrysochlorus]
Length=719

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDREYVFAY DDPC A YP+MQKLRQVLVDHAL N E EKN++TSIFQKIA FED
Sbjct  568  DLLKVVDREYVFAYIDDPCLATYPMMQKLRQVLVDHALANAEAEKNMNTSIFQKIATFED  627

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEVE  R+A ENG  AIPN+I ECRSYPLYKF+R
Sbjct  628  ELKALLPKEVENTRAAYENGQCAIPNKIKECRSYPLYKFVR  668



>ref|XP_010426963.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   174 bits (441),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 80/101 (79%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE VF Y DDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+
Sbjct  567  DLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEE  626

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE  R+A  NG  AIPNRITECRSYPLYKF+R
Sbjct  627  ELKAVLPKEVEATRAAYGNGTAAIPNRITECRSYPLYKFVR  667



>ref|NP_001266106.1| phenylalanine ammonia-lyase 2 [Cicer arietinum]
 sp|Q9SMK9.1|PAL2_CICAR RecName: Full=Phenylalanine ammonia-lyase 2 [Cicer arietinum]
 emb|CAB60719.1| phenylalanine ammonia-lyase [Cicer arietinum]
Length=718

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL VV+REYVFAY DDPCSA YPLMQKLR VLVDHAL+NG+ E N STSIFQKI AFE 
Sbjct  567  DLLNVVEREYVFAYIDDPCSATYPLMQKLRHVLVDHALENGDREGNSSTSIFQKIGAFEQ  626

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE  R  +ENGNPA+PNRI ECRSYPLYKF+R
Sbjct  627  ELKTLLPKEVESVRVDVENGNPAVPNRIIECRSYPLYKFVR  667



>gb|KDO50672.1| hypothetical protein CISIN_1g037382mg [Citrus sinensis]
Length=555

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+  DRE+VFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN ++SIFQKIAAFE+
Sbjct  404  DLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNANSSIFQKIAAFEE  463

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPLY+ +R
Sbjct  464  ELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYRLVR  504



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL++VDREY FAY DDPCSA YPLMQKLRQVLV+HAL N E+EKNV+TSIFQKI  FE+
Sbjct  564  DLLKIVDREYCFAYIDDPCSATYPLMQKLRQVLVEHALANAENEKNVNTSIFQKITTFEE  623

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVEGAR A ENG  AIPN+I ECRSYPLYKF+R
Sbjct  624  ELKTLLPKEVEGARIAYENGQSAIPNKIKECRSYPLYKFVR  664



>gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DL+RVVDREYVFAY DDP SA YPLMQKLRQVLVDHAL+NG+ EKN STSIFQKI AFE+
Sbjct  560  DLIRVVDREYVFAYIDDPSSATYPLMQKLRQVLVDHALKNGDLEKNASTSIFQKIEAFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKALLPKEV  AR ALE+G+P + NRI ECRSYPLYKFIR
Sbjct  620  ELKALLPKEVGSARMALESGSPTVANRIAECRSYPLYKFIR  660



>emb|CAB42793.1| phenylalanine-ammonia lyase [Citrus clementina x Citrus reticulata]
Length=721

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+  DRE+VFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN ++SIFQKIAAFE+
Sbjct  570  DLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNANSSIFQKIAAFEE  629

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPLY+ +R
Sbjct  630  ELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYRLVR  670



>gb|AFZ78653.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+VVDRE+VF+Y DDPCSA YPLMQ LRQVLV+HAL NGE E+N +TSIFQKI +FE+
Sbjct  560  DLLKVVDREHVFSYIDDPCSATYPLMQNLRQVLVEHALVNGERERNSTTSIFQKIGSFEE  619

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK LLPKEVE AR  +ENGNPAIPNRI ECRSYPLYKF+R
Sbjct  620  ELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVR  660



>ref|XP_006481493.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
Length=721

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL+  DRE+VFAY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN ++SIFQKIAAFE+
Sbjct  570  DLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNANSSIFQKIAAFEE  629

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELKA+LPKEVE AR  +ENGNP IPNRI ECRSYPLY+ +R
Sbjct  630  ELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYRLVR  670



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  4    DLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFED  183
            DLL VV+REY+FAY DDPCSA YPLMQ+LRQVLV+HAL NGE+EKN +TSIFQKI+AFE+
Sbjct  573  DLLMVVEREYLFAYIDDPCSATYPLMQRLRQVLVEHALTNGENEKNANTSIFQKISAFEE  632

Query  184  ELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIR  306
            ELK +LPKEVE AR+A E+GN AIPNRI ECRSYPLYKF+R
Sbjct  633  ELKTILPKEVESARAACESGNAAIPNRIIECRSYPLYKFVR  673



>gb|AEV53411.1| phenylalanine ammonia-lyase 3 [Populus tomentosa]
 gb|AFZ78652.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=715

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +1

Query  10   LRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDEL  189
            L+VVDREYVFAY DDPCSA YPLMQKLRQV VDHAL+NGE+EKN STS+FQKI AFE+EL
Sbjct  566  LKVVDREYVFAYVDDPCSATYPLMQKLRQVFVDHALENGENEKNFSTSVFQKIEAFEEEL  625

Query  190  KALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIReelgteiltgexVQS  351
            KALLPKEVE AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGE VQS
Sbjct  626  KALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYKFVREELGTVLLTGEKVQS  679



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 569837304960