BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF010G13

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P04715.1|RBS2_PETHY  RecName: Full=Ribulose bisphosphate carbo...    193   4e-59   Petunia x hybrida [garden petunia]
gb|AFK40375.1|  unknown                                                 189   2e-57   Medicago truncatula
sp|P04714.1|RBS1_PETHY  RecName: Full=Ribulose bisphosphate carbo...    188   3e-57   Petunia x hybrida [garden petunia]
ref|XP_003618736.1|  Ribulose bisphosphate carboxylase small chain      187   4e-57   Medicago truncatula
gb|AFK42721.1|  unknown                                                 187   8e-57   Lotus japonicus
gb|AFK36660.1|  unknown                                                 186   1e-56   Lotus japonicus
gb|AHI85721.1|  stress-induced protein 16                               186   1e-56   Capsicum annuum
ref|XP_009595081.1|  PREDICTED: ribulose bisphosphate carboxylase...    186   2e-56   Nicotiana tomentosiformis
sp|P26573.1|RBS8_NICPL  RecName: Full=Ribulose bisphosphate carbo...    186   3e-56   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_003618735.1|  Ribulose bisphosphate carboxylase small chain      185   3e-56   Medicago truncatula
gb|AFK48034.1|  unknown                                                 186   3e-56   Lotus japonicus
ref|XP_006363111.1|  PREDICTED: ribulose bisphosphate carboxylase...    185   4e-56   Solanum tuberosum [potatoes]
sp|P07180.1|RBS3A_SOLLC  RecName: Full=Ribulose bisphosphate carb...    185   5e-56   Solanum lycopersicum
sp|P26576.1|RBSB_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    184   8e-56   Solanum tuberosum [potatoes]
ref|XP_004232356.1|  PREDICTED: ribulose bisphosphate carboxylase...    184   1e-55   
sp|O65194.1|RBS_MEDSA  RecName: Full=Ribulose bisphosphate carbox...    184   1e-55   Medicago sativa [alfalfa]
gb|AFB70994.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    184   1e-55   Nicotiana attenuata
sp|P32764.1|RBS3_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    184   2e-55   Solanum tuberosum [potatoes]
gb|AAA34192.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    184   2e-55   Solanum lycopersicum
ref|XP_008368660.1|  PREDICTED: ribulose bisphosphate carboxylase...    184   2e-55   Malus domestica [apple tree]
sp|P26575.1|RBSA_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    183   2e-55   Solanum tuberosum [potatoes]
sp|Q41351.1|RBS_STELP  RecName: Full=Ribulose bisphosphate carbox...    183   2e-55   Stellaria longipes
ref|XP_004234568.1|  PREDICTED: ribulose bisphosphate carboxylase...    183   2e-55   
gb|AFK33868.1|  unknown                                                 182   4e-55   Lotus japonicus
ref|XP_010693099.1|  PREDICTED: ribulose bisphosphate carboxylase...    182   4e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009795055.1|  PREDICTED: ribulose bisphosphate carboxylase...    182   4e-55   Nicotiana sylvestris
ref|NP_001275244.1|  ribulose bisphosphate carboxylase small chai...    182   8e-55   Solanum tuberosum [potatoes]
gb|AGT97045.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    182   9e-55   Capsicum annuum
gb|AAR83879.1|  Cristal-Glass1 protein                                  182   1e-54   Capsicum annuum
ref|XP_010044264.1|  PREDICTED: ribulose bisphosphate carboxylase...    181   1e-54   Eucalyptus grandis [rose gum]
gb|AAA33866.1|  ribulose 1,5-bisphosphate carboxylase small subunit     181   1e-54   Malus domestica x Pyrus communis
gb|AIF75357.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    180   2e-54   Nicotiana tomentosiformis
sp|O65349.1|RBS_CAPAN  RecName: Full=Ribulose bisphosphate carbox...    181   3e-54   Capsicum annuum
ref|XP_002521232.1|  Ribulose bisphosphate carboxylase small chai...    180   3e-54   Ricinus communis
sp|P17673.1|RBS_TRIRP  RecName: Full=Ribulose bisphosphate carbox...    180   3e-54   Trifolium repens [creeping white clover]
ref|XP_008381263.1|  PREDICTED: ribulose bisphosphate carboxylase...    180   4e-54   
ref|XP_006482254.1|  PREDICTED: ribulose bisphosphate carboxylase...    180   5e-54   Citrus sinensis [apfelsine]
ref|XP_009342656.1|  PREDICTED: ribulose bisphosphate carboxylase...    180   6e-54   Pyrus x bretschneideri [bai li]
sp|P26574.1|RBS1_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    179   8e-54   Solanum tuberosum [potatoes]
gb|AIR75142.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    179   8e-54   Chenopodium album [lamb's-quarters]
gb|ABY21253.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    179   9e-54   Solanum tuberosum [potatoes]
ref|XP_010036887.1|  PREDICTED: ribulose bisphosphate carboxylase...    179   9e-54   
ref|XP_009357812.1|  PREDICTED: ribulose bisphosphate carboxylase...    179   9e-54   Pyrus x bretschneideri [bai li]
gb|AFW90575.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    179   1e-53   Solanum tuberosum [potatoes]
dbj|BAI53119.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    179   1e-53   Eucalyptus globulus [blue gum]
gb|KCW52064.1|  hypothetical protein EUGRSUZ_J01502                     179   1e-53   Eucalyptus grandis [rose gum]
gb|ABK96567.1|  unknown                                                 179   1e-53   Populus trichocarpa x Populus deltoides
ref|XP_010693054.1|  PREDICTED: ribulose bisphosphate carboxylase...    179   2e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|AIF75298.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    178   2e-53   Arachis duranensis
ref|XP_009800809.1|  PREDICTED: ribulose bisphosphate carboxylase...    179   2e-53   Nicotiana sylvestris
ref|XP_010693073.1|  PREDICTED: ribulose bisphosphate carboxylase...    179   2e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK96590.1|  unknown                                                 179   2e-53   Populus trichocarpa x Populus deltoides
gb|AIF75299.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    177   2e-53   Arachis hypogaea [goober]
ref|XP_006383456.1|  Ribulose bisphosphate carboxylase small chai...    178   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_011015710.1|  PREDICTED: ribulose bisphosphate carboxylase...    178   2e-53   Populus euphratica
ref|XP_006430779.1|  hypothetical protein CICLE_v10012893mg             178   2e-53   Citrus clementina [clementine]
sp|P24007.1|RBS_PYRPY  RecName: Full=Ribulose bisphosphate carbox...    178   2e-53   Pyrus pyrifolia [sha li]
dbj|BAI53118.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    178   2e-53   Eucalyptus globulus [blue gum]
ref|XP_010032637.1|  PREDICTED: ribulose bisphosphate carboxylase...    178   2e-53   Eucalyptus grandis [rose gum]
gb|AIF75353.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    177   3e-53   Nicotiana sylvestris
gb|ABY21254.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    178   3e-53   Solanum tuberosum [potatoes]
ref|XP_010693059.1|  PREDICTED: ribulose bisphosphate carboxylase...    178   3e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011021244.1|  PREDICTED: ribulose bisphosphate carboxylase...    178   3e-53   Populus euphratica
gb|AIR75141.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    177   3e-53   Blitum nuttallianum
sp|Q02980.1|RBS_MALSP  RecName: Full=Ribulose bisphosphate carbox...    178   3e-53   Malus sp.
emb|CAD11990.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    177   5e-53   Coffea arabica [arabica coffee]
sp|Q96542.1|RBS_BETPN  RecName: Full=Ribulose bisphosphate carbox...    177   6e-53   Betula pendula [white birch]
gb|AIF75349.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    176   7e-53   Nicotiana sylvestris
gb|AIF75346.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    176   7e-53   Nicotiana sylvestris
ref|XP_002532149.1|  Ribulose bisphosphate carboxylase small chai...    177   8e-53   Ricinus communis
gb|AIF75359.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    176   8e-53   Nicotiana tomentosiformis
ref|XP_006358055.1|  PREDICTED: ribulose-1,5-bisphosphate carboxy...    177   9e-53   Solanum tuberosum [potatoes]
gb|AIF75367.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    176   1e-52   Nicotiana tomentosiformis
gb|KEH21530.1|  ribulose bisphosphate carboxylase small chain           176   1e-52   Medicago truncatula
ref|XP_004303137.1|  PREDICTED: ribulose bisphosphate carboxylase...    176   1e-52   Fragaria vesca subsp. vesca
gb|KEH21531.1|  ribulose bisphosphate carboxylase small chain           176   1e-52   Medicago truncatula
gb|KEH21538.1|  ribulose bisphosphate carboxylase small chain           176   1e-52   Medicago truncatula
ref|XP_003637843.1|  Ribulose bisphosphate carboxylase small chai...    176   1e-52   
gb|AIF75351.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    175   1e-52   Nicotiana sylvestris
gb|AIR75140.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    176   1e-52   Blitum nuttallianum
ref|XP_003600302.1|  Ribulose bisphosphate carboxylase small chai...    176   1e-52   
gb|ACJ85905.1|  unknown                                                 176   2e-52   Medicago truncatula
gb|KEH21536.1|  ribulose bisphosphate carboxylase small chain           176   2e-52   Medicago truncatula
ref|XP_009758143.1|  PREDICTED: ribulose bisphosphate carboxylase...    176   2e-52   Nicotiana sylvestris
ref|XP_003636970.1|  Ribulose bisphosphate carboxylase small chai...    176   2e-52   
ref|XP_004233493.1|  PREDICTED: ribulose bisphosphate carboxylase...    176   2e-52   
sp|Q42516.1|RBS1_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    176   2e-52   Amaranthus hypochondriacus [prince's feather]
gb|KEH21539.1|  ribulose bisphosphate carboxylase small chain           175   3e-52   Medicago truncatula
ref|XP_010669829.1|  PREDICTED: ribulose bisphosphate carboxylase...    175   3e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|AIF75364.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    174   3e-52   Nicotiana tomentosiformis
ref|XP_009767108.1|  PREDICTED: ribulose bisphosphate carboxylase...    175   3e-52   Nicotiana sylvestris
gb|AIF75355.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    174   3e-52   Nicotiana sylvestris
sp|O22077.1|RBS_FAGCR  RecName: Full=Ribulose bisphosphate carbox...    175   3e-52   Fagus crenata
gb|KEH21537.1|  ribulose bisphosphate carboxylase small chain           175   4e-52   Medicago truncatula
ref|XP_009625434.1|  PREDICTED: ribulose bisphosphate carboxylase...    175   4e-52   Nicotiana tomentosiformis
gb|AIR75143.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    173   5e-52   Blitum virgatum
gb|AIR75144.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    174   6e-52   Blitum bonus-henricus [allgood]
sp|Q9XGX5.1|RBS2_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    174   6e-52   Amaranthus hypochondriacus [prince's feather]
gb|ABY21255.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    174   7e-52   Solanum tuberosum [potatoes]
gb|AAA33036.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    174   7e-52   Mesembryanthemum crystallinum
gb|AAW31667.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    174   8e-52   Ammopiptanthus mongolicus
sp|Q04450.1|RBS2_MESCR  RecName: Full=Ribulose bisphosphate carbo...    174   8e-52   Mesembryanthemum crystallinum
gb|AAU14862.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    174   9e-52   Fagus sylvatica
emb|CAA10290.1|  ribulose 1,5-bisphosphate carboxylase small subunit    174   9e-52   Cicer arietinum [garbanzo]
sp|Q08186.1|RBS6_MESCR  RecName: Full=Ribulose bisphosphate carbo...    174   9e-52   Mesembryanthemum crystallinum
gb|AAA34191.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    174   9e-52   Solanum lycopersicum
sp|P07689.1|RBS3_PEA  RecName: Full=Ribulose bisphosphate carboxy...    174   1e-51   Pisum sativum [garden pea]
sp|P16032.2|RBS1_MESCR  RecName: Full=Ribulose bisphosphate carbo...    174   1e-51   Mesembryanthemum crystallinum
dbj|BAE46384.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    174   1e-51   Panax ginseng [Asiatic ginseng]
gb|AIF75361.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    173   1e-51   Nicotiana tomentosiformis
gb|ABS72189.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    174   1e-51   Corchorus olitorius [Nalta jute]
sp|P00869.1|RBS2_PEA  RecName: Full=Ribulose bisphosphate carboxy...    174   1e-51   Pisum sativum [garden pea]
gb|AIF75363.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    172   1e-51   Nicotiana tabacum [American tobacco]
gb|AAA33035.1|  ribulose-1-5-bisphosphate carboxylase                   174   1e-51   Mesembryanthemum crystallinum
gb|AAF19793.1|AF162210_1  ribulose-1,5-bisphosphate carboxylase/o...    174   1e-51   Lactuca sativa [cultivated lettuce]
sp|Q40250.1|RBS_LACSA  RecName: Full=Ribulose bisphosphate carbox...    173   2e-51   Lactuca sativa [cultivated lettuce]
ref|XP_010263805.1|  PREDICTED: ribulose bisphosphate carboxylase...    173   2e-51   Nelumbo nucifera [Indian lotus]
sp|Q9XGX4.1|RBS3_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    173   2e-51   Amaranthus hypochondriacus [prince's feather]
gb|AGV08375.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    172   4e-51   Arachis hypogaea [goober]
ref|XP_008244506.1|  PREDICTED: ribulose bisphosphate carboxylase...    172   4e-51   Prunus mume [ume]
ref|XP_010521010.1|  PREDICTED: ribulose bisphosphate carboxylase...    172   5e-51   Tarenaya hassleriana [spider flower]
ref|XP_008446602.1|  PREDICTED: ribulose bisphosphate carboxylase...    172   5e-51   Cucumis melo [Oriental melon]
ref|XP_002305162.2|  Ribulose bisphosphate carboxylase small chai...    172   7e-51   
gb|AFO67218.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...    172   7e-51   Aralia elata
gb|ABK95229.1|  unknown                                                 172   8e-51   Populus trichocarpa [western balsam poplar]
gb|ABK96431.1|  unknown                                                 172   8e-51   Populus trichocarpa x Populus deltoides
gb|AEJ33935.1|  chloroplast putative ribulose-1,5-bisphosphate ca...    171   8e-51   Wolffia australiana
gb|KCW52065.1|  hypothetical protein EUGRSUZ_J01502                     171   8e-51   Eucalyptus grandis [rose gum]
sp|Q08184.1|RBS4_MESCR  RecName: Full=Ribulose bisphosphate carbo...    172   9e-51   Mesembryanthemum crystallinum
gb|AIF75365.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    170   1e-50   Nicotiana tabacum [American tobacco]
ref|XP_010265138.1|  PREDICTED: ribulose bisphosphate carboxylase...    171   1e-50   Nelumbo nucifera [Indian lotus]
ref|XP_007215051.1|  hypothetical protein PRUPE_ppa012123mg             171   1e-50   Prunus persica
ref|XP_004299075.1|  PREDICTED: ribulose bisphosphate carboxylase...    171   1e-50   Fragaria vesca subsp. vesca
ref|XP_002531624.1|  Ribulose bisphosphate carboxylase small chai...    171   1e-50   Ricinus communis
ref|XP_004135094.1|  PREDICTED: ribulose bisphosphate carboxylase...    171   2e-50   Cucumis sativus [cucumbers]
ref|XP_011035062.1|  PREDICTED: ribulose bisphosphate carboxylase...    171   2e-50   Populus euphratica
gb|ABK55670.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    168   3e-50   Cucumis sativus [cucumbers]
emb|CCF55356.1|  ribulose-1,5-bisphosphate carboxylase small subunit    171   3e-50   Cucumis sativus [cucumbers]
gb|KDP20120.1|  hypothetical protein JCGZ_05889                         170   3e-50   Jatropha curcas
ref|XP_008352922.1|  PREDICTED: ribulose bisphosphate carboxylase...    170   3e-50   
gb|ABK15574.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    170   3e-50   Camellia sinensis [black tea]
sp|Q43832.1|RBS2_SPIOL  RecName: Full=Ribulose bisphosphate carbo...    170   3e-50   Spinacia oleracea
ref|XP_008339672.1|  PREDICTED: ribulose bisphosphate carboxylase...    170   4e-50   
gb|AAB81105.1|  ribulose 1,5-bisphosphate carboxylase small subunit     170   4e-50   Spinacia oleracea
gb|AAF03096.1|AF162195_1  ribulose-1,5-bisphosphate carboxylase/o...    169   4e-50   Lactuca sativa [cultivated lettuce]
ref|XP_010551266.1|  PREDICTED: ribulose bisphosphate carboxylase...    169   6e-50   Tarenaya hassleriana [spider flower]
gb|AIR75139.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    169   6e-50   Spinacia turkestanica
ref|XP_009774104.1|  PREDICTED: ribulose bisphosphate carboxylase...    169   7e-50   Nicotiana sylvestris
gb|AIR75138.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    169   7e-50   Spinacia tetrandra
gb|ADB85091.1|  ribulose 1,5-bisphosphate carboxylase small subunit     169   7e-50   Jatropha curcas
gb|AAA33037.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    169   7e-50   Mesembryanthemum crystallinum
ref|NP_001235314.1|  uncharacterized protein LOC100500504               169   7e-50   Glycine max [soybeans]
sp|Q08183.1|RBS3_MESCR  RecName: Full=Ribulose bisphosphate carbo...    169   7e-50   Mesembryanthemum crystallinum
gb|AIR75136.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    169   8e-50   Spinacia oleracea
gb|AIL82451.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    169   8e-50   Spinacia oleracea
gb|AAG24884.1|AF303941_1  ribulose-1,5-bisphosphate carboxylase s...    169   1e-49   Glycine max [soybeans]
ref|NP_001241137.1|  ribulose bisphosphate carboxylase small chai...    169   1e-49   Glycine max [soybeans]
gb|AIB04188.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    168   1e-49   Camellia oleifera [abura-tsubaki]
gb|AIF75300.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    167   2e-49   Arachis duranensis
gb|AIF75302.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    167   2e-49   Arachis duranensis
gb|AIF75301.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    167   2e-49   
gb|AAF06098.1|  ribulose 1,5-bisphosphate carboxylase small chain...    168   2e-49   Manihot esculenta [manioc]
ref|XP_009602965.1|  PREDICTED: ribulose bisphosphate carboxylase...    167   3e-49   Nicotiana tomentosiformis
ref|XP_009356790.1|  PREDICTED: ribulose bisphosphate carboxylase...    167   3e-49   Pyrus x bretschneideri [bai li]
sp|P08705.1|RBS_HELAN  RecName: Full=Ribulose bisphosphate carbox...    167   3e-49   Helianthus annuus
emb|CBY05833.1|  Ribulose 1,5-bisphosphate carboxylase small subu...    167   4e-49   Coffea canephora [robusta coffee]
sp|P08474.1|RBS_CUCSA  RecName: Full=Ribulose bisphosphate carbox...    167   4e-49   Cucumis sativus [cucumbers]
ref|XP_010263795.1|  PREDICTED: ribulose bisphosphate carboxylase...    167   5e-49   Nelumbo nucifera [Indian lotus]
sp|P19311.1|RBS5_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    167   5e-49   Lemna gibba
sp|P19312.1|RBS6_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    167   6e-49   Lemna gibba
gb|AAA33686.1|  ribulose 1,5-bisphosphate carboxylase small subun...    166   9e-49   Pisum sativum [garden pea]
sp|P18960.1|RBS_SILPR  RecName: Full=Ribulose bisphosphate carbox...    166   9e-49   
ref|XP_010926041.1|  PREDICTED: ribulose bisphosphate carboxylase...    166   9e-49   Elaeis guineensis
sp|Q42915.1|RBS_MANES  RecName: Full=Ribulose bisphosphate carbox...    166   1e-48   Manihot esculenta [manioc]
gb|KDP29409.1|  hypothetical protein JCGZ_18330                         165   1e-48   Jatropha curcas
gb|ACU13285.1|  unknown                                                 166   1e-48   Glycine max [soybeans]
gb|AAO25119.1|  ribulose-1,5-bisphosphate carboxylase small subunit     166   1e-48   Chrysanthemum x morifolium [florist's chrysanthemum]
sp|P00865.1|RBS1_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    166   1e-48   Glycine max [soybeans]
sp|Q42823.1|RBS_GLYTA  RecName: Full=Ribulose bisphosphate carbox...    166   1e-48   Glycine tabacina
emb|CDP20139.1|  unnamed protein product                                165   1e-48   Coffea canephora [robusta coffee]
ref|NP_001235266.1|  ribulose-1,5-bisphosphate carboxylase small ...    166   1e-48   
gb|AAA82069.1|  ribulose 1,5-bisphosphate carboxylase small subun...    166   2e-48   Glycine soja [wild soybean]
sp|Q42822.1|RBS_GLYTO  RecName: Full=Ribulose bisphosphate carbox...    165   2e-48   Glycine tomentella [wooly glycine]
sp|P08135.1|RBS_RAPSA  RecName: Full=Ribulose bisphosphate carbox...    165   2e-48   Raphanus sativus
ref|XP_007225932.1|  hypothetical protein PRUPE_ppa012174mg             165   3e-48   Prunus persica
gb|AAF06100.1|  ribulose 1,5-bisphosphate carboxylase small chain...    165   3e-48   Manihot esculenta [manioc]
sp|Q08185.1|RBS5_MESCR  RecName: Full=Ribulose bisphosphate carbo...    165   3e-48   Mesembryanthemum crystallinum
emb|CDY52468.1|  BnaA04g27920D                                          164   4e-48   Brassica napus [oilseed rape]
ref|XP_009140170.1|  PREDICTED: ribulose bisphosphate carboxylase...    164   5e-48   Brassica rapa
gb|AIF75323.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    164   6e-48   Brassica napus [oilseed rape]
emb|CAA32701.1|  ribulose bisphosphate carboxylase                      164   6e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75322.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    164   6e-48   Brassica napus [oilseed rape]
sp|P29684.1|RBS_HEVBR  RecName: Full=Ribulose bisphosphate carbox...    164   6e-48   Hevea brasiliensis [jebe]
gb|AIF75321.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    164   6e-48   Brassica rapa
ref|NP_198658.1|  ribulose bisphosphate carboxylase small chain 2B      164   6e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888576.1|  ribulose bisphosphate carboxylase small chai...    164   7e-48   Arabidopsis lyrata subsp. lyrata
gb|AFS41770.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    164   7e-48   Gossypium gossypioides
ref|XP_008243231.1|  PREDICTED: ribulose bisphosphate carboxylase...    164   7e-48   Prunus mume [ume]
gb|AIF75340.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    164   8e-48   Brassica oleracea
gb|AIF75285.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    163   8e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151650.1|  hypothetical protein PHAVU_004G064800g             164   1e-47   Phaseolus vulgaris [French bean]
ref|XP_002868775.1|  ribulose bisphosphate carboxylase small chai...    164   1e-47   
ref|XP_006285820.1|  hypothetical protein CARUB_v10007296mg             164   1e-47   Capsella rubella
sp|P19308.1|RBS2_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    164   1e-47   Lemna gibba
gb|AGV54682.1|  ribulose bisphosphate carboxylase                       164   1e-47   Phaseolus vulgaris [French bean]
ref|NP_198657.1|  ribulose bisphosphate carboxylase small chain 3B      164   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198659.1|  ribulose bisphosphate carboxylase small chain 1B      164   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb|ACQ90230.1|  virus-resistance protein                                166   1e-47   Brassica rapa subsp. chinensis [bok-choy]
gb|AIF75292.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    163   1e-47   Arabidopsis suecica
emb|CAA32702.1|  ribulose bisphosphate carboxylase                      163   1e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDX99682.1|  BnaC04g34390D                                          164   1e-47   
sp|P12468.1|RBS4_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    163   2e-47   Glycine max [soybeans]
ref|XP_006391132.1|  hypothetical protein EUTSA_v10019199mg             163   2e-47   Eutrema salsugineum [saltwater cress]
gb|AIF75289.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    162   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75288.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    162   2e-47   Arabidopsis suecica
emb|CDX67402.1|  BnaA07g14420D                                          163   2e-47   
ref|XP_010450911.1|  PREDICTED: ribulose bisphosphate carboxylase...    163   2e-47   Camelina sativa [gold-of-pleasure]
gb|AIF75324.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    162   2e-47   Brassica rapa
ref|XP_010450912.1|  PREDICTED: ribulose bisphosphate carboxylase...    162   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006405770.1|  hypothetical protein EUTSA_v10027955mg             162   3e-47   Eutrema salsugineum [saltwater cress]
ref|XP_010440948.1|  PREDICTED: ribulose bisphosphate carboxylase...    162   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010450913.1|  PREDICTED: ribulose bisphosphate carboxylase...    162   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010435745.1|  PREDICTED: ribulose bisphosphate carboxylase...    162   3e-47   Camelina sativa [gold-of-pleasure]
gb|AIF75296.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    162   3e-47   Arabidopsis arenosa
ref|XP_010435743.1|  PREDICTED: ribulose bisphosphate carboxylase...    162   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006285696.1|  hypothetical protein CARUB_v10007166mg             162   3e-47   Capsella rubella
gb|AIF75291.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    162   3e-47   Arabidopsis arenosa
ref|XP_006391472.1|  hypothetical protein EUTSA_v10019202mg             162   3e-47   Eutrema salsugineum [saltwater cress]
emb|CAA42618.1|  ribulose bisphosphate carboxylase                      162   3e-47   Phaseolus vulgaris [French bean]
ref|NP_176880.1|  ribulose bisphosphate carboxylase small chain 1A      162   3e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75283.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    162   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284616.1|  hypothetical protein CARUB_v10005847mg             162   4e-47   Capsella rubella
gb|AIF75294.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    161   4e-47   Arabidopsis suecica
gb|AIF75344.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    162   4e-47   Brassica oleracea
ref|XP_009125072.1|  PREDICTED: ribulose bisphosphate carboxylase...    162   5e-47   Brassica rapa
ref|XP_009139778.1|  PREDICTED: ribulose bisphosphate carboxylase...    162   5e-47   Brassica rapa
gb|AIF75317.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    162   6e-47   Brassica rapa
gb|AIF75295.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    161   6e-47   Arabidopsis suecica
gb|AEX60835.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    161   6e-47   Gossypium herbaceum [Arabian cotton]
gb|ABB51649.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    162   6e-47   Brassica napus [oilseed rape]
ref|XP_002868776.1|  ribulose bisphosphate carboxylase                  162   7e-47   Arabidopsis lyrata subsp. lyrata
gb|AIF75337.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    161   9e-47   Brassica oleracea
gb|AFS41765.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    161   9e-47   Gossypium armourianum
emb|CDY01665.1|  BnaC04g30870D                                          161   9e-47   
ref|XP_010440945.1|  PREDICTED: ribulose bisphosphate carboxylase...    161   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_008807113.1|  PREDICTED: ribulose bisphosphate carboxylase...    161   1e-46   Phoenix dactylifera
gb|AEX60840.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   1e-46   Gossypium herbaceum [Arabian cotton]
emb|CDY67657.1|  BnaCnng55860D                                          161   1e-46   Brassica napus [oilseed rape]
gb|AFS41762.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   1e-46   Gossypium herbaceum [Arabian cotton]
gb|AFS41744.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    161   1e-46   Gossypium tomentosum
gb|AEX60841.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    161   1e-46   Gossypium hirsutum [American cotton]
gb|ACO35888.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    161   1e-46   Ageratina adenophora
gb|AFS41729.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    161   1e-46   Gossypium hirsutum [American cotton]
gb|AEX60836.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   1e-46   Gossypium raimondii
gb|AFS41756.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    161   1e-46   Gossypium darwinii
gb|AFS41727.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    161   1e-46   Gossypium hirsutum [American cotton]
sp|P31333.2|RBS_GOSHI  RecName: Full=Ribulose bisphosphate carbox...    161   1e-46   Gossypium hirsutum [American cotton]
gb|EYU38172.1|  hypothetical protein MIMGU_mgv1a014686mg                160   1e-46   Erythranthe guttata [common monkey flower]
gb|AIF75342.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    160   1e-46   Brassica oleracea
sp|Q39746.1|RBS4_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    160   1e-46   Flaveria pringlei
ref|XP_007033270.1|  Ribulose bisphosphate carboxylase (small cha...    160   2e-46   Theobroma cacao [chocolate]
gb|AIF75332.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    160   2e-46   Brassica oleracea
gb|EYU38174.1|  hypothetical protein MIMGU_mgv1a014707mg                160   2e-46   Erythranthe guttata [common monkey flower]
gb|AFS41763.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   2e-46   Gossypium herbaceum [Arabian cotton]
gb|AFS41766.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   2e-46   Gossypium armourianum
emb|CAA53083.1|  ribulose-1,5-bisphosphate carboxylase /oxygenase...    160   2e-46   Brassica napus [oilseed rape]
gb|AFS41724.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   3e-46   Gossypium raimondii
gb|AFS41733.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   3e-46   Gossypium hirsutum [American cotton]
gb|AEX60838.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    159   3e-46   Gossypium raimondii
gb|AFS41753.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   3e-46   Gossypium mustelinum
gb|AEX60842.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   3e-46   Gossypium hirsutum [American cotton]
gb|AFS41732.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   3e-46   Gossypium hirsutum [American cotton]
gb|AEX60839.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   3e-46   Gossypium hirsutum [American cotton]
gb|AFS41771.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    159   3e-46   Gossypium gossypioides
sp|Q39749.1|RBS7_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    159   3e-46   Flaveria pringlei
gb|AFS41754.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   3e-46   Gossypium mustelinum
ref|XP_010103758.1|  hypothetical protein L484_014647                   160   3e-46   Morus notabilis
ref|XP_010511625.1|  PREDICTED: ribulose bisphosphate carboxylase...    159   4e-46   Camelina sativa [gold-of-pleasure]
gb|AIF75313.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    159   5e-46   Brassica rapa
sp|P05346.2|RBS1_BRANA  RecName: Full=Ribulose bisphosphate carbo...    159   5e-46   
gb|AEX60837.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    159   5e-46   
sp|P19310.1|RBS4_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    159   5e-46   
gb|ACA42439.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    159   5e-46   
dbj|BAJ08160.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        159   6e-46   
ref|XP_006302885.1|  hypothetical protein CARUB_v10021016mg             159   6e-46   
gb|AAG40356.1|AF325004_1  At1g67090                                     159   6e-46   
sp|Q39745.1|RBS3_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    159   6e-46   
gb|AFS41725.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    159   6e-46   
gb|AAB95215.1|  ribulose 1,5 bisphosphate carboxylase small subunit     158   7e-46   
gb|AAB95212.1|  ribulose 1,5 bisphosphate carboxylase small subunit     158   7e-46   
gb|AEB00556.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    159   7e-46   
gb|AAB95210.1|  ribulose 1,5 bisphosphate carboxylase small subunit     157   9e-46   
sp|Q39743.1|RBS1_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    159   9e-46   
gb|ABL97974.1|  ribulose bisphosphate carboxylase                       158   9e-46   
sp|Q39747.1|RBS5_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    158   1e-45   
gb|AFS41748.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    158   1e-45   
gb|AEX60843.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    158   1e-45   
sp|O24634.1|RBS1_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    158   1e-45   
gb|ABQ42090.1|  ribulose bisphosphate carboxylase small chain (Ru...    158   1e-45   
ref|XP_010916368.1|  PREDICTED: ribulose bisphosphate carboxylase...    158   1e-45   
ref|NP_001119331.1|  ribulose bisphosphate carboxylase small chai...    158   1e-45   
sp|Q39744.1|RBS2_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    158   2e-45   
sp|O22645.1|RBS5_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    157   2e-45   
ref|XP_011089882.1|  PREDICTED: ribulose bisphosphate carboxylase...    157   2e-45   
ref|XP_011099669.1|  PREDICTED: ribulose bisphosphate carboxylase...    157   2e-45   
gb|ADT78691.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    158   3e-45   
emb|CAA31948.1|  ribulose bisphosphate carboxylase                      157   3e-45   
gb|ABQ42164.1|  ribulose bisphosphate carboxylase small chain (Ru...    157   3e-45   
gb|ACS68693.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    157   3e-45   
gb|EYU45444.1|  hypothetical protein MIMGU_mgv1a014737mg                157   3e-45   
gb|ABL97962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    157   3e-45   
gb|ABQ42089.1|  ribulose bisphosphate carboxylase small chain (Ru...    157   3e-45   
emb|CAA30290.1|  rubisco ssu precursor                                  157   3e-45   
ref|XP_009390221.1|  PREDICTED: ribulose bisphosphate carboxylase...    157   3e-45   
gb|ABA46878.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    156   3e-45   
ref|XP_011099670.1|  PREDICTED: ribulose bisphosphate carboxylase...    157   4e-45   
sp|Q39748.1|RBS6_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    157   4e-45   
gb|ABA46879.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    156   4e-45   
sp|O22572.1|RBS2_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    157   4e-45   
ref|XP_008797838.1|  PREDICTED: ribulose bisphosphate carboxylase...    157   4e-45   
gb|ABA46901.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    157   5e-45   
gb|KHG18747.1|  Ribulose bisphosphate carboxylase small chain, ch...    157   5e-45   
gb|ABQ42552.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    157   5e-45   
gb|AAB95211.1|  ribulose 1,5 bisphosphate carboxylase small subunit     155   7e-45   
sp|O22573.1|RBS3_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    156   7e-45   
gb|AAB95217.1|  ribulose 1,5 bisphosphate carboxylase small subunit     155   7e-45   
sp|P07089.1|RBS_FLATR  RecName: Full=Ribulose bisphosphate carbox...    156   8e-45   
sp|O48550.1|RBS_ZANAE  RecName: Full=Ribulose bisphosphate carbox...    156   9e-45   
sp|P19309.1|RBS3_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    156   9e-45   
gb|AFS41772.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    155   1e-44   
gb|ABA46875.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    155   1e-44   
gb|AAB95214.1|  ribulose 1,5 bisphosphate carboxylase small subunit     155   1e-44   
gb|AAP31054.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    155   1e-44   
ref|XP_009403968.1|  PREDICTED: ribulose bisphosphate carboxylase...    155   2e-44   
gb|ABA46889.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    155   2e-44   
gb|AAA84592.1|  ribulose 1,5-bisphosphate carboxylase                   155   2e-44   
gb|ABA46911.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    155   2e-44   
gb|KJB10450.1|  hypothetical protein B456_001G201800                    155   2e-44   
gb|ABA46882.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    154   2e-44   
gb|ABA46877.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    154   2e-44   
dbj|BAA35165.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    154   2e-44   
dbj|BAA35153.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    154   2e-44   
gb|ABA46898.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    154   3e-44   
ref|XP_006663954.1|  PREDICTED: ribulose bisphosphate carboxylase...    154   3e-44   
gb|ABA46887.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    154   3e-44   
gb|ABA46910.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    154   3e-44   
gb|ABA46883.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    154   4e-44   
gb|AAP31053.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    154   4e-44   
ref|XP_007033269.1|  Ribulose bisphosphate carboxylase (small cha...    155   4e-44   
sp|P00872.2|RBS1_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    154   4e-44   
gb|ABA46900.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    154   4e-44   
dbj|BAJ40065.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    154   4e-44   
gb|KJB43046.1|  hypothetical protein B456_007G181300                    154   5e-44   
dbj|BAA35162.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    154   6e-44   
gb|ABA46888.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    153   6e-44   
sp|O24045.1|RBS_MUSAC  RecName: Full=Ribulose bisphosphate carbox...    154   6e-44   
gb|ABA46899.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    154   6e-44   
gb|ABA46892.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    153   7e-44   
ref|XP_010528479.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    154   7e-44   
gb|ABA46891.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    153   8e-44   
sp|Q41373.1|RBS_SACHY  RecName: Full=Ribulose bisphosphate carbox...    153   1e-43   
dbj|BAA35166.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    152   1e-43   
ref|NP_001105294.1|  ribulose bisphosphate carboxylase small chai...    153   1e-43   
gb|AAA33685.2|  ribulose 1,5 bisphosphate carboxylase                   152   1e-43   
gb|AIF75328.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    153   1e-43   
ref|XP_009380302.1|  PREDICTED: ribulose bisphosphate carboxylase...    153   1e-43   
gb|EMT21846.1|  Ribulose bisphosphate carboxylase small chain PW9...    153   1e-43   
gb|AFO59569.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    152   2e-43   
dbj|BAJ86022.1|  predicted protein                                      153   2e-43   
emb|CDY42338.1|  BnaC02g17150D                                          153   2e-43   
emb|CDY12616.1|  BnaA02g12840D                                          153   2e-43   
gb|ABA46909.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    152   2e-43   
ref|XP_002450304.1|  hypothetical protein SORBIDRAFT_05g003480          152   2e-43   
ref|XP_009127519.1|  PREDICTED: ribulose bisphosphate carboxylase...    152   2e-43   
gb|ABR25985.1|  ribulose bisphosphate carboxylase small chain c         151   2e-43   
dbj|BAA35167.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    152   2e-43   
ref|XP_009127518.1|  PREDICTED: ribulose bisphosphate carboxylase...    152   3e-43   
dbj|BAA35161.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    152   3e-43   
dbj|BAJ90202.1|  predicted protein                                      152   3e-43   
gb|AIF75326.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    152   3e-43   
dbj|BAK23964.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    152   3e-43   
ref|NP_001066606.1|  Os12g0291400                                       152   3e-43   
gb|AAB70543.1|  ribulose 1,5-bisphosphate carboxylase small subunit     152   3e-43   
gb|EPS63610.1|  ribulose bisphosphate carboxylase small chain           152   4e-43   
gb|AAC14064.1|  ribulose 1,5-bisphosphate carboxylase small subunit     152   4e-43   
ref|NP_001066604.1|  Os12g0291100                                       152   4e-43   
dbj|BAJ90404.1|  predicted protein                                      152   4e-43   
gb|EAY97115.1|  hypothetical protein OsI_19041                          152   4e-43   
dbj|BAA35156.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    151   5e-43   
dbj|BAA35158.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    151   5e-43   
dbj|BAB19812.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    151   5e-43   
ref|NP_001066559.1|  Os12g0274700                                       151   5e-43   
gb|EMT21850.1|  Ribulose bisphosphate carboxylase small chain PW9...    151   5e-43   
ref|XP_006842277.1|  hypothetical protein AMTR_s00079p00061090          152   6e-43   
gb|EMT06085.1|  hypothetical protein F775_43781                         151   6e-43   
dbj|BAJ89884.1|  predicted protein                                      151   6e-43   
dbj|BAA35148.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    151   7e-43   
gb|AAD27881.1|AF139469_1  ribulose-1,5-bisphosphate carboxylase s...    151   7e-43   
emb|CAA70416.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    151   7e-43   
dbj|BAA35147.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    150   7e-43   
ref|XP_009127523.1|  PREDICTED: ribulose bisphosphate carboxylase...    151   7e-43   
emb|CAA10496.1|  hypothetical protein                                   151   8e-43   
dbj|BAA35145.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    150   8e-43   
gb|ABY66908.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    150   9e-43   
gb|AIF75311.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    151   9e-43   
sp|P26667.1|RBS2_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    150   1e-42   
gb|EMT21848.1|  Ribulose bisphosphate carboxylase small chain PW9...    150   1e-42   
dbj|BAA35150.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    150   1e-42   
gb|EMS44969.1|  Ribulose bisphosphate carboxylase small chain PW9...    150   1e-42   
dbj|BAJ90550.1|  predicted protein                                      150   1e-42   
emb|CAA10497.1|  hypothetical protein                                   150   2e-42   
sp|P00871.2|RBS1_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    150   2e-42   
emb|CAD21856.1|  putative ribulose 1,5 biphosphate carboxylase sm...    150   2e-42   
dbj|BAA35169.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    149   2e-42   
gb|EMT25898.1|  Ribulose bisphosphate carboxylase small chain PWS...    150   2e-42   
gb|ABC86738.1|  ribulose-1,5-bisphophate carboxylase/oxygenase sm...    150   3e-42   
ref|NP_001066607.1|  Os12g0292400                                       149   3e-42   
gb|AAF07942.1|AF192773_1  ribulose-1,5-bisphosphate carboxylase s...    149   3e-42   
emb|CDY42337.1|  BnaC02g17140D                                          149   3e-42   
gb|AEA48975.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    149   4e-42   
gb|AAF17589.1|AF202645_1  ribulose-1,5-bisphosphate carboxylase s...    149   4e-42   
dbj|BAB19811.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    149   5e-42   
ref|XP_002276967.1|  PREDICTED: ribulose bisphosphate carboxylase...    149   5e-42   
dbj|BAB19814.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    149   5e-42   
emb|CAA68419.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        149   6e-42   
ref|XP_003576920.1|  PREDICTED: ribulose bisphosphate carboxylase...    149   6e-42   
gb|AAF17590.1|AF202646_1  ribulose-1,5-bisphosphate carboxylase s...    148   6e-42   
gb|AAC83374.1|  ribulose-1,5-bisphosphate carboxylase small subunit     148   6e-42   
ref|XP_006663961.1|  PREDICTED: ribulose bisphosphate carboxylase...    149   7e-42   
ref|XP_006663955.1|  PREDICTED: ribulose bisphosphate carboxylase...    148   7e-42   
ref|XP_006664952.1|  PREDICTED: ribulose bisphosphate carboxylase...    148   7e-42   
dbj|BAA35170.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    148   7e-42   
ref|XP_003581511.1|  PREDICTED: ribulose bisphosphate carboxylase...    148   7e-42   
gb|ABY66909.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    148   8e-42   
sp|Q38793.1|RBS_AEGTA  RecName: Full=Ribulose bisphosphate carbox...    148   9e-42   
ref|XP_003577109.1|  PREDICTED: ribulose bisphosphate carboxylase...    148   9e-42   
emb|CBI15452.3|  unnamed protein product                                147   1e-41   
gb|AAF07943.1|AF192774_1  ribulose-1,5-bisphosphate carboxylase s...    147   1e-41   
gb|AAF07949.1|AF192780_1  ribulose-1,5-bisphosphate carboxylase s...    147   1e-41   
gb|AAC83373.1|  ribulose-1,5-bisphosphate carboxylase small subunit     147   1e-41   
gb|AAF17591.1|AF202647_1  ribulose-1,5-bisphosphate carboxylase s...    147   1e-41   
gb|EMS50269.1|  Ribulose bisphosphate carboxylase small chain PW9...    148   1e-41   
gb|AAC78643.1|  ribulose-1,5-bisphosphate carboxylase small subunit     147   1e-41   
emb|CAH59401.1|  Rubisco SSU                                            148   1e-41   
ref|XP_003573910.1|  PREDICTED: ribulose bisphosphate carboxylase...    147   2e-41   
dbj|BAK23963.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    147   2e-41   
gb|AAF07946.1|AF192777_1  ribulose-1,5-bisphosphate carboxylase s...    147   2e-41   
gb|ABR26158.1|  ribulose bisphosphate carboxylase small chain c         146   2e-41   
gb|AAC67588.1|  ribulose-1,5-bisphosphate carboxylase small subunit     147   2e-41   
ref|XP_004962611.1|  PREDICTED: ribulose bisphosphate carboxylase...    147   2e-41   
ref|NP_001031981.1|  ribulose bisphosphate carboxylase small chai...    147   2e-41   
dbj|BAA35179.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    147   2e-41   
dbj|BAK23962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    147   3e-41   
gb|EAY82834.1|  hypothetical protein OsI_38046                          147   3e-41   
dbj|BAA00539.1|  small subunit of ribulose-1,5-bisphosphate carbo...    147   3e-41   
dbj|BAB19810.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    147   3e-41   
gb|AAF07947.1|AF192778_1  ribulose-1,5-bisphosphate carboxylase s...    146   4e-41   
emb|CAG25595.1|  putative rubisco small subunit                         146   6e-41   
dbj|BAA35164.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    145   9e-41   
ref|XP_004962302.1|  PREDICTED: ribulose bisphosphate carboxylase...    145   9e-41   
dbj|BAB19813.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    145   1e-40   
dbj|BAP82418.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    145   1e-40   
gb|AIF75330.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    145   2e-40   
gb|EMS44970.1|  Ribulose bisphosphate carboxylase small chain PWS...    145   2e-40   
dbj|BAA35178.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    144   2e-40   
gb|ABR25969.1|  ribulose bisphosphate carboxylase small chain c         144   2e-40   
ref|XP_004962301.1|  PREDICTED: ribulose bisphosphate carboxylase...    144   2e-40   
dbj|BAA35151.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    144   3e-40   
dbj|BAA35173.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    144   3e-40   
gb|AAF07945.1|AF192776_1  ribulose-1,5-bisphosphate carboxylase s...    144   3e-40   
gb|EMS50268.1|  Ribulose bisphosphate carboxylase small chain PWS...    145   5e-40   
ref|XP_007036525.1|  Ribulose bisphosphate carboxylase (small cha...    144   6e-40   
ref|XP_006485852.1|  PREDICTED: ribulose bisphosphate carboxylase...    145   7e-40   
sp|P00868.1|RBS1_PEA  RecName: Full=Ribulose bisphosphate carboxy...    142   1e-39   
emb|CAA42617.1|  ribulose bisphosphate carboxylase                      141   1e-39   
gb|EYU38175.1|  hypothetical protein MIMGU_mgv1a014707mg                142   1e-39   
dbj|BAA35172.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    142   1e-39   
gb|AAF07985.1|AF200303_1  ribulose-1,5-bisphosphate carboxylase s...    142   2e-39   
gb|AAF06097.1|  ribulose 1,5-bisphosphate carboxylase small chain...    141   4e-39   
gb|AFI60243.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    140   6e-39   
ref|XP_011101346.1|  PREDICTED: uncharacterized protein LOC105179425    147   8e-39   
gb|AHC28978.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    140   8e-39   
gb|ABR45726.1|  RBCS1                                                   140   9e-39   
ref|XP_009794476.1|  PREDICTED: ribulose bisphosphate carboxylase...    138   9e-39   
ref|XP_007044344.1|  Ribulose bisphosphate carboxylase small chai...    139   1e-38   
gb|AAC83372.1|  ribulose-1,5-bisphosphate carboxylase small subunit     139   2e-38   
sp|Q40004.1|RBS_HORVU  RecName: Full=Ribulose bisphosphate carbox...    139   2e-38   
ref|XP_003555148.2|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    139   3e-38   
ref|XP_009357814.1|  PREDICTED: ribulose bisphosphate carboxylase...    139   3e-38   
ref|XP_004962610.1|  PREDICTED: ribulose bisphosphate carboxylase...    139   4e-38   
emb|CAH59404.1|  Rubisco SSU                                            139   4e-38   
gb|AGJ76629.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    139   4e-38   
gb|AAP31674.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    137   5e-38   
gb|ABR45725.1|  RBCS1                                                   138   8e-38   
sp|P10053.1|RBS_PINTH  RecName: Full=Ribulose bisphosphate carbox...    137   1e-37   
ref|XP_008368661.1|  PREDICTED: ribulose bisphosphate carboxylase...    135   4e-37   
dbj|BAB13745.1|  ribulose 1,5 bisphosphate carboxylase small subunit    134   4e-37   
dbj|BAA35175.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    135   8e-37   
dbj|BAA35176.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    135   8e-37   
ref|XP_006482255.1|  PREDICTED: ribulose bisphosphate carboxylase...    134   1e-36   



>sp|P04715.1|RBS2_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU11A, 
chloroplastic; Short=RuBisCO small subunit SSU11A; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS1 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu11A) precursor - garden petunia
 emb|CAA27445.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   193 bits (490),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSV+SS A+A+   AAQASMVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQV
Sbjct  1    MASSVMSSAAVATSTNAAQASMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP+G KK+ETLSYLP L+ EQLLK++EYLLNKGWVPCLEFETE GFVYRE+HASP YYD
Sbjct  61   WPPYGKKKYETLSYLPDLTDEQLLKEIEYLLNKGWVPCLEFETEHGFVYREYHASPRYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>gb|AFK40375.1| unknown [Medicago truncatula]
Length=180

 Score =   189 bits (479),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL+
Sbjct  25   PFTGLKSSAAFPVTKKTNNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTEEQLV  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWVPCLEFE EKGFVYRE H+SPGYYDGRYWTMWK
Sbjct  85   KEVEYLIRKGWVPCLEFELEKGFVYRENHSSPGYYDGRYWTMWK  128



>sp|P04714.1|RBS1_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU8, 
chloroplastic; Short=RuBisCO small subunit SSU8; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS8 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu8) precursor - garden petunia
 emb|CAA27444.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   188 bits (477),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSV+SS A+A+R   AQASMVAPF GLKS  SFPV+ K   D TSI++NG RVQCMQV
Sbjct  1    MASSVISSAAVATRTNVAQASMVAPFNGLKSAVSFPVSSKQNLDITSIASNGGRVQCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP+G KK+ETLSYLP L+ EQLLK++EYLLNKGWVPCLEFETE GFVYRE+HASP YYD
Sbjct  61   WPPYGKKKYETLSYLPDLTDEQLLKEIEYLLNKGWVPCLEFETEHGFVYREYHASPRYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>ref|XP_003618736.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|ACJ84141.1| unknown [Medicago truncatula]
 gb|AES74954.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=180

 Score =   187 bits (476),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  25   PFTGLKSSAAFPVTKKTNNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTEEQLA  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWVPCLEFE EKGFVYRE H+SPGYYDGRYWTMWK
Sbjct  85   KEVEYLIRKGWVPCLEFELEKGFVYRENHSSPGYYDGRYWTMWK  128



>gb|AFK42721.1| unknown [Lotus japonicus]
Length=182

 Score =   187 bits (475),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 92/104 (88%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FPV +K+  D TSI++NG RVQCMQVWPP G KKFETLSYLPPL+TEQLL
Sbjct  28   PFTGLKSMAGFPV-RKANNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPPLTTEQLL  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWK
Sbjct  87   KEVEYLLRKGWVPCLEFETEKGFVYRENHKSPGYYDGRYWTMWK  130



>gb|AFK36660.1| unknown [Lotus japonicus]
 gb|AFK45650.1| unknown [Lotus japonicus]
Length=177

 Score =   186 bits (473),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FPVT+K+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  22   PFTGLKSMAGFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTVEQLA  81

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWK
Sbjct  82   KEVEYLIRKGWVPCLEFETEKGFVYRENHKSPGYYDGRYWTMWK  125



>gb|AHI85721.1| stress-induced protein 16 [Capsicum annuum]
Length=180

 Score =   186 bits (473),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSV+SS A+A+R    QASMVAPFTGLKS ASFPVT+K+  D TSI++NG RVQCM V
Sbjct  1    MASSVISSAAVATRTNVTQASMVAPFTGLKSAASFPVTRKNNLDITSIASNGGRVQCMLV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP   KK+ETLSYLP LS EQLLK++EYLL KGWVPCLEFETE GFVYRE H SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>ref|XP_009595081.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009609566.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 gb|AAP03874.1| putative ribulose bisphosphate carboxylase small subunit protein 
precursor [Nicotiana tabacum]
Length=180

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSVLSS A+A+R   AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQV
Sbjct  1    MASSVLSSAAVATRTNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP+G KK+ETLSYLP LS EQLL ++EYLL  GWVPCLEFETE+GFVYRE + SPGYYD
Sbjct  61   WPPYGKKKYETLSYLPDLSEEQLLSEIEYLLKNGWVPCLEFETERGFVYRENNKSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>sp|P26573.1|RBS8_NICPL RecName: Full=Ribulose bisphosphate carboxylase small chain 8B, 
chloroplastic; Short=RuBisCO small subunit 8B; Flags: Precursor 
[Nicotiana plumbaginifolia]
 emb|CAA31994.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
 gb|AAA34110.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
Length=180

 Score =   186 bits (471),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSVLSS A+A+R+  AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQV
Sbjct  1    MASSVLSSAAVATRSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP   KK+ETLSYLP LS EQLL ++EYLL  GWVPCLEFETE+GFVYRE H SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSQEQLLSEIEYLLKSGWVPCLEFETERGFVYREHHHSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>ref|XP_003618735.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|AES74953.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=177

 Score =   185 bits (470),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ +QL 
Sbjct  22   PFTGLKSSAGFPVTKKTNNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTEDQLA  81

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWVPCLEFE EKGFVYRE H+SPGYYDGRYWTMWK
Sbjct  82   KEVEYLIRKGWVPCLEFELEKGFVYRENHSSPGYYDGRYWTMWK  125



>gb|AFK48034.1| unknown [Lotus japonicus]
Length=181

 Score =   186 bits (471),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FPV +K   D TSI+ NG RVQCMQVWPP G KKFETLSYLPPL+TEQLL
Sbjct  27   PFTGLKSMAGFPV-RKVNNDITSIANNGGRVQCMQVWPPIGKKKFETLSYLPPLTTEQLL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWK
Sbjct  86   KEVEYLLRKGWVPCLEFETEKGFVYRENHKSPGYYDGRYWTMWK  129



>ref|XP_006363111.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 ref|XP_006363112.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 sp|P26577.1|RBSC_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic; Short=RuBisCO small subunit 2C; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49416.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   185 bits (470),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSV+SS A+A+R   AQASMVAPFTGLKSTASFPV++K   D TSI++NG RV+CMQV
Sbjct  1    MASSVMSSAAVATRGNGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVRCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>sp|P07180.1|RBS3A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3A/3C, 
chloroplastic; Short=RuBisCO small subunit 3A/3C; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA29402.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 emb|CAA29404.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 gb|AAA34190.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   185 bits (469),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSV+SS A+A+R   AQASMVAPFTGLKSTASFPV++K   D TSI++NG RV CMQV
Sbjct  1    MASSVMSSAAVATRGNGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVSCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP  +KK+ETLSYLP LS EQLL ++EYLL  GWVPCLEFETE GFVYRE H SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>sp|P26576.1|RBSB_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49415.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   184 bits (468),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASS++SS A+A+RA  AQASMV PFTGLKSTASFPV++K   D TSI++NG RV+CMQV
Sbjct  1    MASSIVSSAAVATRANGAQASMVGPFTGLKSTASFPVSRKQNLDITSIASNGGRVRCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>ref|XP_004232356.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic [Solanum lycopersicum]
 sp|P05349.1|RBS3B_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA29403.1| ribulose 1,5-bisphosphate carboxylase/oxyenase [Solanum lycopersicum]
 dbj|BAA01888.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   184 bits (467),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASS++SS A+A+R   AQASMVAPFTGLKSTASFPV++K   D TSI++NG RV CMQV
Sbjct  1    MASSIVSSAAVATRGNGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVSCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP  +KK+ETLSYLP LS EQLL ++EYLL  GWVPCLEFETE GFVYRE H SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>sp|O65194.1|RBS_MEDSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Medicago sativa]
 gb|AAC13293.1| ribulose-1,5-bisphosphate carboxylase small subunit [Medicago 
sativa]
Length=180

 Score =   184 bits (466),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  25   PFTGLKSSAGFPVTKKTNNDITSIASNGGRVNCMQVWPPVGKKKFETLSYLPPLTEEQLA  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGW+PCLEFE EKGFVYRE H SPGYYDGRYWTMW+
Sbjct  85   KEVEYLIRKGWIPCLEFELEKGFVYRENHRSPGYYDGRYWTMWR  128



>gb|AFB70994.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Nicotiana attenuata]
Length=180

 Score =   184 bits (466),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSVLSS A+A+R+  AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQV
Sbjct  1    MASSVLSSAAVATRSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP   KK+ETLSYLP LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSQEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>sp|P32764.1|RBS3_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49417.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQ  224
            MASS++SS A+A+R+  AQASMVAPFTGLKS ASFPVTKK+   D TS+++NG RV+CMQ
Sbjct  1    MASSIVSSAAVATRSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE H SPGYY
Sbjct  61   VWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  121  DGRYWTMWK  129



>gb|AAA34192.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=180

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSV+SS A+A+R+   QASMVAPFTGLKS+A+FPVTKK   D TSI++NG RV CMQV
Sbjct  1    MASSVISSAAVATRSNVTQASMVAPFTGLKSSATFPVTKKQNLDITSIASNGGRVSCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP  +KK+ETLSYLP LS EQLL +VEYLL  GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>ref|XP_008368660.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Malus domestica]
Length=179

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASS++SS  +A+ +  AQA MVAPFTGLKS+++FPVT+KS  D TSI++NG RVQCMQV
Sbjct  1    MASSMISSGTVATVSAPAQARMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQV  59

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP GLKKFETLSYLPPLSTE L K+V+YLL K WVPCLEFE E GFVYRE H SPGYYD
Sbjct  60   WPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYD  119

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  120  GRYWTMWK  127



>sp|P26575.1|RBSA_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49414.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   183 bits (465),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSV+SS A+A+R   AQASMVAPFTGLKS ASFPV++K   D TSI++NG RV+CMQV
Sbjct  1    MASSVMSSAAVATRGNGAQASMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVRCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>sp|Q41351.1|RBS_STELP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Stellaria longipes]
 gb|AAA69018.1| ribulose 1,5-bisphosphate carboxylase small subunit [Stellaria 
longipes]
Length=180

 Score =   183 bits (465),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASS++SS A+A+R+  AQASMVAPFTGLKS ASFPV++K+  D TSI++NG RV+CMQV
Sbjct  1    MASSIMSSAAVATRSNGAQASMVAPFTGLKSNASFPVSRKTNLDITSIASNGGRVRCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP  +KK+ETLSYLP LS+EQLL ++EYLL  GWVPCLEFETE GFVYRE  +SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSSEQLLSEIEYLLKNGWVPCLEFETEHGFVYREHTSSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>ref|XP_004234568.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic [Solanum lycopersicum]
 sp|P07179.2|RBS2A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; AltName: Full=LESS 
5; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34189.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
(EC 4.1.1.39) [Solanum lycopersicum]
 emb|CAA29401.2| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=180

 Score =   183 bits (465),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSV+SS A+A+R+   QASMVAPFTGLKS+A+FPVTKK   D TSI++NG RV CMQV
Sbjct  1    MASSVISSAAVATRSNVTQASMVAPFTGLKSSATFPVTKKQNLDITSIASNGGRVSCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP  +KK+ETLSYLP LS EQLL ++EYLL  GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>gb|AFK33868.1| unknown [Lotus japonicus]
Length=177

 Score =   182 bits (463),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FPVT+K+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  22   PFTGLKSMAGFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTVEQLA  81

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWVPCLEFETEKGFVYRE   SPGYYDGRYWTMWK
Sbjct  82   KEVEYLIRKGWVPCLEFETEKGFVYRENLKSPGYYDGRYWTMWK  125



>ref|XP_010693099.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=181

 Score =   182 bits (463),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKST++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPL+TEQLL
Sbjct  26   PFNGLKSTSAFPVTRKSNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLTTEQLL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             +V YLL KGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWK
Sbjct  86   AEVNYLLVKGWIPCLEFEIKDGFVYREHNKSPGYYDGRYWTMWK  129



>ref|XP_009795055.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009795056.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009772497.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 sp|P69249.1|RBS_TOBAC RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; AltName: Full=TSSU3-8; 
Flags: Precursor [Nicotiana tabacum]
 sp|P69250.1|RBS1_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA25862.1| unnamed protein product [Nicotiana sylvestris]
 emb|CAA26208.1| small subunit ribulose 1,5-bisphosphate carboxylase [Nicotiana 
tabacum]
 prf||1103193A carboxylase,RBP
Length=180

 Score =   182 bits (463),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSVLSS A+A+R+  AQA+MVAPFTGLKS ASFPV++K   D TSI++NG RVQCMQV
Sbjct  1    MASSVLSSAAVATRSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP   KK+ETLSYLP LS EQLL +VEYLL  GWVPCLEFETE GFVYRE + SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>ref|NP_001275244.1| ribulose bisphosphate carboxylase small chain C, chloroplastic 
[Solanum tuberosum]
 sp|P10647.1|RBS0_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain C, 
chloroplastic; Short=RuBisCO small subunit C; Flags: Precursor 
[Solanum tuberosum]
 gb|AAA33838.1| ribulose bisphosphate carboxylase (EC 4.1.1.39) [Solanum tuberosum]
Length=181

 Score =   182 bits (461),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQ  224
            MASS++SS A+A+R+  AQASMVAPFTGLKS ASFPVTKK+   D TS+++NG RV+CMQ
Sbjct  1    MASSIVSSAAVATRSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWVPCLEFETE GFVYRE ++SPGYY
Sbjct  61   VWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYREHNSSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  121  DGRYWTMWK  129



>gb|AGT97045.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=180

 Score =   182 bits (461),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSV+S   +A+ A AAQASM+A F GLKS ASFPVT+K   D TSI++NG RVQCM V
Sbjct  1    MASSVMSIATVATGANAAQASMIASFNGLKSAASFPVTRKQDLDITSIASNGGRVQCMLV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP   KK+ETLSYLP LS EQLLK++EYLL KGWVPCLEFETE GFVYRE H SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>gb|AAR83879.1| Cristal-Glass1 protein [Capsicum annuum]
Length=180

 Score =   182 bits (461),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSV+S+  +A+ A AAQASM+A F GLKS ASFPVT+K   D TSI++NG RVQCM V
Sbjct  1    MASSVMSTATVATGANAAQASMIASFNGLKSAASFPVTRKQDLDITSIASNGGRVQCMLV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP   KK+ETLSYLP LS EQLLK++EYLL KGWVPCLEFETE GFVYRE H SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>ref|XP_010044264.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic-like [Eucalyptus grandis]
 dbj|BAI53120.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
 gb|KCW86324.1| hypothetical protein EUGRSUZ_B03013 [Eucalyptus grandis]
Length=179

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+KS+ D TS+S+NG RVQCMQVWPP G KKFETLSYLPPLS E L 
Sbjct  24   PFTGLKSASAFPVTRKSSEDITSLSSNGGRVQCMQVWPPIGKKKFETLSYLPPLSPESLA  83

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL  GWVPCLEFE E GFVYRE H+SPGYYDGRYWTMWK
Sbjct  84   KEVDYLLRSGWVPCLEFELEHGFVYREHHSSPGYYDGRYWTMWK  127



>gb|AAA33866.1| ribulose 1,5-bisphosphate carboxylase small subunit [Malus domestica 
x Pyrus communis]
Length=179

 Score =   181 bits (459),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASS++SS  +A+ +  AQA MVAPFTGLKS+++FPVT+KS  D TSI++NG RVQCMQV
Sbjct  1    MASSMISSGTVATVSAPAQARMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQV  59

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP GLKKFETLSYLPPLSTE L K+V+YLL K WVPCLEFE E GFVYRE + SPGYYD
Sbjct  60   WPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENNRSPGYYD  119

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  120  GRYWTMWK  127



>gb|AIF75357.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75358.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP+G KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYLPDLSEEQLL  69

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             ++EYLL  GWVPCLEFETE+GFVYRE + SPGYYDGRYWTMWK
Sbjct  70   SEIEYLLKNGWVPCLEFETERGFVYRENNKSPGYYDGRYWTMWK  113



>sp|O65349.1|RBS_CAPAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Capsicum annuum]
 gb|AAC17126.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=187

 Score =   181 bits (459),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSV+S+  +A+ A AAQASM+A F GLKS ASFPVT+K   D TSI++NG RV+CM V
Sbjct  1    MASSVMSTATVATGANAAQASMIASFNGLKSAASFPVTRKQDLDITSIASNGGRVECMLV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP   KK+ETLSYLP LS EQLLK++EYLL KGWVPCLEFETE GFVYRE H SPGYYD
Sbjct  61   WPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>ref|XP_002521232.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
 gb|EEF41184.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
Length=181

 Score =   180 bits (457),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ASFPVT+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  24   PFTGLKSAASFPVTRKANNDITSIASNGGRVQCMQVWPPLGKKKFETLSYLPDLTDEQLA  83

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL KGW+PCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  84   KEVDYLLRKGWIPCLEFELEHGFVYRENHRSPGYYDGRYWTMWK  127



>sp|P17673.1|RBS_TRIRP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Trifolium repens]
 emb|CAA36542.1| ribulose bisphosphate carboxylase [Trifolium repens]
Length=178

 Score =   180 bits (457),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A FPVTKK+  D TSI++NGSRV CMQVWPP G KKFETLSYLPPL+ EQLL
Sbjct  24   PFTGLKSSAGFPVTKKNN-DITSITSNGSRVNCMQVWPPVGKKKFETLSYLPPLTDEQLL  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGWVPC+EFE EKGFV+R++++SPGYYDGRYWTMW+
Sbjct  83   KEVEYLLRKGWVPCVEFELEKGFVHRQYNSSPGYYDGRYWTMWR  126



>ref|XP_008381263.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Malus domestica]
Length=183

 Score =   180 bits (457),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+E L 
Sbjct  29   PFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLA  87

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  88   KEVDYLLRKNWVPCLEFELEHGFVYRENHKSPGYYDGRYWTMWK  131



>ref|XP_006482254.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=182

 Score =   180 bits (456),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+++FP TKK+  D TSI++NG RVQCM+VWPP GLKKFETLSYLPPLS E LL
Sbjct  27   PFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALL  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K++ YLL  GW+PCLEFE EKG+VYRE H+SPGYYDGRYWTMWK
Sbjct  87   KEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWK  130



>ref|XP_009342656.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Pyrus x bretschneideri]
Length=183

 Score =   180 bits (456),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+E L 
Sbjct  29   PFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLA  87

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  88   KEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWK  131



>sp|P26574.1|RBS1_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49413.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   179 bits (455),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqa-smvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSV+SS A+A+R    QA SM+APFTGLKS A+FPV++K   D TSI++NG RV+CMQ
Sbjct  1    MASSVISSAAVATRTNVTQAGSMIAPFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP  +KK+ETLSYLP L+ EQLLK+VEYLL  GWVPCLEFETE GFVYRE H SPGYY
Sbjct  61   VWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  121  DGRYWTMWK  129



>gb|AIR75142.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Chenopodium album]
Length=164

 Score =   179 bits (453),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPL+TE LL
Sbjct  17   PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPVGKKKFETLSYLPPLTTESLL  75

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             +V+YLLNKGWVPCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  76   SEVQYLLNKGWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWK  119



>gb|ABY21253.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   179 bits (454),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqa-smvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSV+SS A+A+R    QA SM+APFTGLKS A+FPV++K   D TSI++NG RV+CMQ
Sbjct  1    MASSVISSAAVATRTNVTQAGSMIAPFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP  +KK+ETLSYLP L+ EQLLK+VEYLL  GWVPCLEFETE GFVYRE H SPGYY
Sbjct  61   VWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  121  DGRYWTMWK  129



>ref|XP_010036887.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW48548.1| hypothetical protein EUGRSUZ_K02223 [Eucalyptus grandis]
Length=181

 Score =   179 bits (454),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+KSA D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E+LL
Sbjct  27   PFTGLKSASAFPVTRKSA-DITSLASNGGRVQCMQVWPPIGKKKFETLSYLPPLSREELL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K++EYLL   WVPCLEFE EKGFVYR+ H SPGYYDGRYWTMWK
Sbjct  86   KEIEYLLRMNWVPCLEFELEKGFVYRDNHKSPGYYDGRYWTMWK  129



>ref|XP_009357812.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=183

 Score =   179 bits (454),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  29   PFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSPESLA  87

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  88   KEVDYLLRKNWVPCLEFELETGFVYRENHKSPGYYDGRYWTMWK  131



>gb|AFW90575.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Solanum tuberosum]
Length=181

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaias-rataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSV+SS A+A+       +SMVAPFTGLKSTA+FPV++K   D TSI++NG RV+CMQ
Sbjct  1    MASSVISSAAVATRTNVTQASSMVAPFTGLKSTATFPVSRKQNLDITSIASNGGRVRCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP  +KK+ETLSYLP L+ EQLLK+VEYLL  GWVPCLEFETE GFVYRE + SPGYY
Sbjct  61   VWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  121  DGRYWTMWK  129



>dbj|BAI53119.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+KSA D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E+LL
Sbjct  27   PFTGLKSASAFPVTRKSA-DITSLASNGGRVQCMQVWPPIGKKKFETLSYLPPLSREELL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K++EYLL   WVPCLEFE EKGFVYR+ H SPGYYDGRYWTMWK
Sbjct  86   KEIEYLLRMNWVPCLEFELEKGFVYRDNHKSPGYYDGRYWTMWK  129



>gb|KCW52064.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=192

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL 
Sbjct  27   PFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YLL  GWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWK
Sbjct  86   KEIDYLLRSGWVPCLEFETEKGFVYREHHHSPGYYDGRYWTMWK  129



>gb|ABK96567.1| unknown [Populus trichocarpa x Populus deltoides]
Length=181

 Score =   179 bits (453),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSV+SS A+A+     AQA+MVAPF GLKST++FPVT+K+  D TSI++NG RVQCMQ
Sbjct  1    MASSVISSAAVATVNRTPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP GLKKFETLSYLP L+TEQL +++EYLL   WVPCLEFE EKG+VYRE H SPGYY
Sbjct  61   VWPPTGLKKFETLSYLPDLTTEQLAREIEYLLRNKWVPCLEFELEKGWVYREHHQSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  121  DGRYWTMWK  129



>ref|XP_010693054.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=179

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASS++S+ A  + A+ AQA+MVAPF GLKS ++FPVT+KS  D TSI++NG RVQCMQV
Sbjct  1    MASSLMSNAAAVAAASIAQANMVAPFNGLKSASAFPVTRKSN-DITSIASNGGRVQCMQV  59

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+PCLEFE + GFVYRE + SPGYYD
Sbjct  60   WPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPCLEFEVKDGFVYREHNNSPGYYD  119

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  120  GRYWTMWK  127



>gb|AIF75298.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis duranensis]
Length=160

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  19   PFTGLKSLAGFPVTRKANNDITSVTNNGGRVQCMQVWPPVGKKKFETLSYLPDLTDEQLR  78

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL KGWVPCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  79   KEVDYLLRKGWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWK  122



>ref|XP_009800809.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaiasr-ataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSV+SS    +  A AAQASMVAPFTGLKS +SFPVT+K   D TSI++NG RVQCMQ
Sbjct  1    MASSVISSAVAVATGANAAQASMVAPFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP   KK+ETLSYLP LS EQLL++VEYLL  GWVPCLEFETE GFVYRE + SPGYY
Sbjct  61   VWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  121  DGRYWTMWK  129



>ref|XP_010693073.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=180

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = +3

Query  48   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSVLSSTA+A+ +   AQASMVAPF GLKST +FPVTKK+  D TS+++NG RVQCMQ
Sbjct  1    MASSVLSSTAVATVSRTPAQASMVAPFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQ  59

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+PCLEFE + GFVYRE + SPGYY
Sbjct  60   VWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPCLEFEVKDGFVYREHNKSPGYY  119

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  120  DGRYWTMWK  128



>gb|ABK96590.1| unknown [Populus trichocarpa x Populus deltoides]
Length=189

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSV+SS A+A+     AQA+MVAPF GLKST++FPVT+K+  D TSI++NG RVQCMQ
Sbjct  1    MASSVISSAAVATVNRTPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP GLKKFETLSYLP L+TEQL +++EYLL   WVPCLEFE EKG+VYRE H SPGYY
Sbjct  61   VWPPTGLKKFETLSYLPDLTTEQLAREIEYLLRNKWVPCLEFELEKGWVYREHHQSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  121  DGRYWTMWK  129



>gb|AIF75299.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
 gb|AIF75304.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis ipaensis]
 gb|AIF75305.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
Length=160

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  19   PFTGLKSLAGFPVTRKANNDITSVANNGGRVQCMQVWPPVGKKKFETLSYLPDLTDEQLR  78

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL KGWVPCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  79   KEVDYLLRKGWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWK  122



>ref|XP_006383456.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95904.1| unknown [Populus trichocarpa]
 gb|ABK96181.1| unknown [Populus trichocarpa]
 gb|ERP61253.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=181

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSV+SS A+A+     AQA+MVAPF GLKST++FPVT+K+  D TSI++NG RVQCMQ
Sbjct  1    MASSVISSAAVATVNRTPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP GLKKFETLSYLP L+TEQL +++EYLL   WVPCLEFE EKG+VYRE H SPGYY
Sbjct  61   VWPPTGLKKFETLSYLPDLTTEQLAQEIEYLLRNKWVPCLEFELEKGWVYREHHQSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  121  DGRYWTMWK  129



>ref|XP_011015710.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like, 
partial [Populus euphratica]
Length=167

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSV+SS A+A+     AQA+MVAPF GLKST++FPVT+K+  D TSI++NG RVQCMQ
Sbjct  1    MASSVISSAAVATVNRTPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP GLKKFETLSYLP L+TEQL K+++YLL   WVPCLEFE EKG+VYRE H SPGYY
Sbjct  61   VWPPTGLKKFETLSYLPDLTTEQLAKEIDYLLRMKWVPCLEFELEKGWVYREHHRSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  121  DGRYWTMWK  129



>ref|XP_006430779.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
 gb|ESR44019.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
Length=182

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+++FP TKK+  D TSI++NG RVQCM+VWPP GLKKFETLSYLPPLS E LL
Sbjct  27   PFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALL  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K++ YL+  GW+PCLEFE EKG+VYRE H SPGYYDGRYWTMWK
Sbjct  87   KEISYLIRSGWIPCLEFELEKGWVYREHHRSPGYYDGRYWTMWK  130



>sp|P24007.1|RBS_PYRPY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Pyrus pyrifolia]
 dbj|BAA00450.1| RuBisCO small subunit [Pyrus pyrifolia var. culta]
Length=183

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+E L 
Sbjct  29   PFNGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLA  87

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  88   KEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWK  131



>dbj|BAI53118.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL 
Sbjct  27   PFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YLL  GWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWK
Sbjct  86   KEIDYLLRSGWVPCLEFETEKGFVYREHHHSPGYYDGRYWTMWK  129



>ref|XP_010032637.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Eucalyptus grandis]
Length=181

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL 
Sbjct  27   PFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YLL  GWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWK
Sbjct  86   KEIDYLLRSGWVPCLEFETEKGFVYREHHHSPGYYDGRYWTMWK  129



>gb|AIF75353.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75354.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   177 bits (449),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  113



>gb|ABY21254.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqa-smvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSV+SS A+A+R    QA SM+APFTGLKS A+FPV++K   D TSI++NG RV+CMQ
Sbjct  1    MASSVISSAAVATRTNVTQAGSMIAPFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP   KK+ETLSYLP L+ EQLLK+VEYLL  GWVPCLEFETE GFVYRE H SPGYY
Sbjct  61   VWPPINTKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  121  DGRYWTMWK  129



>ref|XP_010693059.1| PREDICTED: ribulose bisphosphate carboxylase small chain [Beta 
vulgaris subsp. vulgaris]
Length=180

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = +3

Query  48   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSV+SSTA+A+ +   AQASMVAPF GLKST +FPVTKK+  D TS+++NG RVQCMQ
Sbjct  1    MASSVISSTAVATVSRTPAQASMVAPFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQ  59

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+PCLEFE + GFVYRE + SPGYY
Sbjct  60   VWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPCLEFEVKDGFVYREHNKSPGYY  119

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  120  DGRYWTMWK  128



>ref|XP_011021244.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Populus euphratica]
Length=181

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSV+SS A+A+     AQA+MVAPF GLKST++FPVT+K+  D TSI++NG RVQCMQ
Sbjct  1    MASSVISSAAVATVNRTPAQANMVAPFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP GLKKFETLSYLP L+TEQL K+++YLL   WVPCLEFE EKG+VYRE H SPGYY
Sbjct  61   VWPPTGLKKFETLSYLPDLTTEQLAKEIDYLLRMKWVPCLEFELEKGWVYREHHRSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  121  DGRYWTMWK  129



>gb|AIR75141.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   177 bits (449),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP G+KK+ETLSYLPPL+TE LL
Sbjct  18   PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPIGMKKYETLSYLPPLTTESLL  76

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             +V+YLLNKGW+PCLEFETE GFVYRE   +PGYYDGRYWTMWK
Sbjct  77   AEVQYLLNKGWIPCLEFETEHGFVYREHGNTPGYYDGRYWTMWK  120



>sp|Q02980.1|RBS_MALSP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Malus sp.]
 emb|CAA46475.1| ribulose bisphosphate carboxylase [Malus sp.]
Length=183

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+++ PVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLSTE L 
Sbjct  29   PFTGLKSSSASPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLA  87

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  88   KEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWK  131



>emb|CAD11990.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
 emb|CAD11991.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
Length=181

 Score =   177 bits (450),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLK+ +SFP++KKS  D TS++TNG RVQCMQVWPP GLKK+ETLSYLP L+ EQLL
Sbjct  27   PFNGLKAASSFPISKKSV-DITSLATNGGRVQCMQVWPPRGLKKYETLSYLPDLTDEQLL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YL+  GWVPCLEFE EKGFVYRE+H SPGYYDGRYWTMWK
Sbjct  86   KEIDYLIRSGWVPCLEFELEKGFVYREYHRSPGYYDGRYWTMWK  129



>sp|Q96542.1|RBS_BETPN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Betula pendula]
 emb|CAA69102.1| ribulose-bisphosphate carboxylase [Betula pendula]
Length=182

 Score =   177 bits (449),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFT LKST++FPVT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+EQL 
Sbjct  27   PFTCLKSTSAFPVTQKTNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSEQLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL K  +PCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  87   KEVDYLLRKNLIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWK  130



>gb|AIF75349.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75350.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   176 bits (446),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLL  69

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++V+YLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  70   REVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  113



>gb|AIF75346.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75347.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
 gb|AIF75348.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   176 bits (446),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLL  69

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             +VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  70   SEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  113



>ref|XP_002532149.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30223.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=185

 Score =   177 bits (449),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST++FPVT+K+  D T+++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  27   PFTGLKSTSAFPVTRKTNTDITTLANNGGRVQCMQVWPPLGKKKFETLSYLPDLTREQLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGWVPCLEFE E GFVYRE   SPGYYDGRYWTMWK
Sbjct  87   KEVEYLLRKGWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWK  130



>gb|AIF75359.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75360.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS +SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  113



>ref|XP_006358055.1| PREDICTED: ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Solanum tuberosum]
Length=181

 Score =   177 bits (448),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaias-rataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSV+SS A+A+       +SMVAPFTGLKST +FPV++K   D TSI++NG RV+CMQ
Sbjct  1    MASSVISSAAVATRTNVTQASSMVAPFTGLKSTPTFPVSRKQNLDITSIASNGGRVRCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP  +KK+ETLSYLP L+ EQLLK+VEYLL  GWVPCLEFETE GFVYRE + SPGYY
Sbjct  61   VWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  121  DGRYWTMWK  129



>gb|AIF75367.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75368.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSVEQLL  69

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  113



>gb|KEH21530.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWK
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWK  129



>ref|XP_004303137.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=182

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FP+T+K+ +D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL++E L 
Sbjct  27   PFTGLKSASAFPITRKTNSDITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTSESLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V++LL   WVPCLEFE EKGFVYRE H SPGYYDGRYWTMWK
Sbjct  87   KEVDFLLRNKWVPCLEFELEKGFVYRENHKSPGYYDGRYWTMWK  130



>gb|KEH21531.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWK
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWK  129



>gb|KEH21538.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWK
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWK  129



>ref|XP_003637843.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWK
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWK  129



>gb|AIF75351.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75352.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  113



>gb|AIR75140.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQ WPP G+KK+ETLSYLPPL+TE LL
Sbjct  18   PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQAWPPIGMKKYETLSYLPPLTTESLL  76

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             +V+YLLNKGW+PCLEFETE GFVYRE   +PGYYDGRYWTMWK
Sbjct  77   AEVQYLLNKGWIPCLEFETEHGFVYREHGNTPGYYDGRYWTMWK  120



>ref|XP_003600302.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWK
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWK  129



>gb|ACJ85905.1| unknown [Medicago truncatula]
 gb|AFK33847.1| unknown [Medicago truncatula]
 gb|KEH21532.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWK
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWK  129



>gb|KEH21536.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A FP+TK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPITKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWK
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWK  129



>ref|XP_009758143.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana sylvestris]
 sp|P22433.1|RBS2_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain S41, 
chloroplastic; Short=RuBisCO small subunit S41; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA37516.1| NySS41 [Nicotiana sylvestris]
Length=181

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  26   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  86   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  129



>ref|XP_003636970.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A FP+TK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPITKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWK
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWK  129



>ref|XP_004233493.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Solanum lycopersicum]
 sp|P08706.2|RBS1_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; AltName: Full=LESS 
17; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34188.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
 emb|CAA29400.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=181

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQL  296
            PFTGLKS ASFPVTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSYLP LS EQL
Sbjct  25   PFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQL  84

Query  297  LKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            L ++EYLL  GWVPCLEFETE+GFVYRE ++SPGYYDGRYWTMWK
Sbjct  85   LSEIEYLLKNGWVPCLEFETERGFVYRENNSSPGYYDGRYWTMWK  129



>sp|Q42516.1|RBS1_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37438.1|AF150665_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
 emb|CAA60636.1| ribulose 1,5-bisphosphate carboxylase-oxygenase [Amaranthus hypochondriacus]
Length=183

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A+FP+TKKS+ DF+S+ +NG RVQCMQVWPP G KKFETLSYLPPLS  QLL
Sbjct  27   PFNGLKSFATFPITKKSSNDFSSLPSNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLL  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             QV+YLLNKGW+PC+EFE E  FVYRE H SPGY DGRYWTMWK
Sbjct  87   AQVQYLLNKGWIPCIEFELEHPFVYRENHRSPGYQDGRYWTMWK  130



>gb|KEH21539.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   175 bits (444),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A FP+TK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPITKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWK
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWK  129



>ref|XP_010669829.1| PREDICTED: ribulose bisphosphate carboxylase small chain 6, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=183

 Score =   175 bits (444),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A+FPVTK S+ D +S+ +NG RVQCMQVWPP G KKFETLSYLPPL+TE LL
Sbjct  29   PFTGLKSIAAFPVTK-SSNDLSSLPSNGGRVQCMQVWPPLGKKKFETLSYLPPLTTEALL  87

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             +V+YLLNKGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWK
Sbjct  88   GEVQYLLNKGWIPCLEFEVKDGFVYREHNNSPGYYDGRYWTMWK  131



>gb|AIF75364.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75366.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   174 bits (442),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSAYSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  113



>ref|XP_009767108.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   175 bits (444),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  26   PFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++V+YLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  86   REVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  129



>gb|AIF75355.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75356.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   174 bits (441),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++V+YLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  70   REVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  113



>sp|O22077.1|RBS_FAGCR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Fagus crenata]
 dbj|BAA23214.1| small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase 
[Fagus crenata]
Length=182

 Score =   175 bits (444),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKSTA+FP T+KS  D TS+++NG RVQCM+VWPP GL+KFETLSYLPPLS E L 
Sbjct  27   PFTGLKSTAAFPATRKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYLPPLSIESLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            KQ+EYL+ KGW+PCLEFE E  FVYRE + SPGYYDGRYW MWK
Sbjct  87   KQIEYLILKGWIPCLEFELEHPFVYRENNRSPGYYDGRYWVMWK  130



>gb|KEH21537.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=192

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWK
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWK  129



>ref|XP_009625434.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana tomentosiformis]
Length=181

 Score =   175 bits (443),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS +SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  26   PFTGLKSASSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  86   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  129



>gb|AIR75143.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum virgatum]
Length=139

 Score =   173 bits (439),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP  +KK+ETLSYLPPL+TE LL
Sbjct  5    PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPTNMKKYETLSYLPPLTTESLL  63

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             +V+YLLNKGW+PCLEFETE GFVYRE   SPGYYDGRYWTMWK
Sbjct  64   AEVQYLLNKGWIPCLEFETEHGFVYREHGNSPGYYDGRYWTMWK  107



>gb|AIR75144.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum bonus-henricus]
Length=150

 Score =   174 bits (440),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP  +KK+ETLSYLPPL+TE LL
Sbjct  18   PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPTNMKKYETLSYLPPLTTESLL  76

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             +V+YLLNKGW+PCLEFETE GFVYRE   +PGYYDGRYWTMWK
Sbjct  77   AEVQYLLNKGWIPCLEFETEHGFVYREHGNTPGYYDGRYWTMWK  120



>sp|Q9XGX5.1|RBS2_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37439.1|AF150666_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=184

 Score =   174 bits (442),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS ASFPVT+KS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS  QLL
Sbjct  29   PFNGLKSIASFPVTRKSN-DITSIASNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLL  87

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             QV+YLLNKGW+PC+EFE E  FVYRE H SPGY DGRYWTMWK
Sbjct  88   AQVQYLLNKGWIPCIEFELEHPFVYRENHRSPGYQDGRYWTMWK  131



>gb|ABY21255.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   174 bits (442),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqa-smvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSV+SS A+A+R    QA SM+APFTGLKS A+FPV++K   D TSI++NG RV+CMQ
Sbjct  1    MASSVISSAAVATRTNVTQAGSMIAPFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQ  60

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWPP   KK+ETLSYLP L+ EQLLK+VEYLL  GWVPCLEFETE G VYRE H SPGYY
Sbjct  61   VWPPINTKKYETLSYLPDLTDEQLLKEVEYLLKNGWVPCLEFETEHGIVYREKHKSPGYY  120

Query  405  DGRYWTMWK  431
            DGRYW MWK
Sbjct  121  DGRYWNMWK  129



>gb|AAA33036.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   174 bits (441),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVTKKS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  24   PFTGLKSVSAFPVTKKSN-DITSIASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWK
Sbjct  83   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWK  126



>gb|AAW31667.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ammopiptanthus mongolicus]
Length=174

 Score =   174 bits (441),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ASFPV +K  +D T+I+ NG RVQCM VWPP G KKFETLSYLPPLS E L 
Sbjct  17   PFTGLKSMASFPVPRKVNSDITTIANNGGRVQCMLVWPPLGRKKFETLSYLPPLSIESLT  76

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGWVPCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  77   KEVEYLLRKGWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWK  120



>sp|Q04450.1|RBS2_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03694.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   174 bits (441),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVTKKS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  24   PFTGLKSVSAFPVTKKSN-DITSIASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWK
Sbjct  83   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWK  126



>gb|AAU14862.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Fagus sylvatica]
Length=181

 Score =   174 bits (441),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKSTA+FP T+KS  D TS+++NG RVQCM+VWPP GL+KFETLSYLPPLS E L 
Sbjct  27   PFTGLKSTAAFPATQKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYLPPLSLESLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            KQ+EYL+ KGW+PCLEFE E  FVYRE + SPGYYDGRYW MWK
Sbjct  87   KQIEYLILKGWIPCLEFELEHPFVYRENNRSPGYYDGRYWVMWK  130



>emb|CAA10290.1| ribulose 1,5-bisphosphate carboxylase small subunit [Cicer arietinum]
Length=181

 Score =   174 bits (441),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A FPV +K   D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQLL
Sbjct  27   PFVGLKSMAGFPV-RKVNNDITSIASNGGRVHCMQVWPPIGKKKFETLSYLPPLTEEQLL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGWVPCLEFE EKGFVYRE + SPGYYDGRYWTMWK
Sbjct  86   KEVEYLLRKGWVPCLEFELEKGFVYREHNNSPGYYDGRYWTMWK  129



>sp|Q08186.1|RBS6_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03698.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=186

 Score =   174 bits (441),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+KS+ D +++ +NG +VQCMQVWPP G KKFETLSYLPPLS E LL
Sbjct  29   PFTGLKSVSAFPVTRKSSNDLSTVPSNGGKVQCMQVWPPLGKKKFETLSYLPPLSEESLL  88

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWK
Sbjct  89   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWK  132



>gb|AAA34191.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=181

 Score =   174 bits (441),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQL  296
            PFTGLKS ASFPVTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSYLP  S EQL
Sbjct  25   PFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDFSDEQL  84

Query  297  LKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            L ++EYLL  GWVPCLEFETE+GFVYRE ++SPGYYDGRYWTMWK
Sbjct  85   LSEIEYLLKNGWVPCLEFETERGFVYRENNSSPGYYDGRYWTMWK  129



>sp|P07689.1|RBS3_PEA RecName: Full=Ribulose bisphosphate carboxylase small chain 3A, 
chloroplastic; Short=RuBisCO small subunit 3A; Flags: Precursor 
[Pisum sativum]
 emb|CAA27864.1| ribulose bisphosphate carboxylase [Pisum sativum]
 prf||1211236A carboxylase,ribulose bisphosphate
Length=180

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS   FPV KK   D TSI++NG RV+CMQVWPP G KKFETLSYLPPL+ +QLL
Sbjct  26   PFGGLKSMTGFPV-KKVNTDITSITSNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLL  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGWVPCLEFE EKGFVYRE + SPGYYDGRYWTMWK
Sbjct  85   KEVEYLLRKGWVPCLEFELEKGFVYREHNKSPGYYDGRYWTMWK  128



>sp|P16032.2|RBS1_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03693.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 prf||1802403A RuBisCO:SUBUNIT=small
Length=182

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A+FPVTKK+  D TS++TNG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  26   PFNGLKSVAAFPVTKKNN-DITSVATNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWK
Sbjct  85   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWK  128



>dbj|BAE46384.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Panax ginseng]
Length=183

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKSTA+FPVT+K   D TS+ +NG RVQCM+VWPP GLKKFETLSYLP L+ EQL 
Sbjct  27   PFTGLKSTAAFPVTRK-VNDITSLPSNGGRVQCMKVWPPLGLKKFETLSYLPQLTQEQLS  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL  GWVPCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  86   KEVDYLLRSGWVPCLEFELEHGFVYREHHHSPGYYDGRYWTMWK  129



>gb|AIF75361.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75362.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   173 bits (438),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS + FPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASFFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  113



>gb|ABS72189.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
1A [Corchorus olitorius]
Length=183

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MAS+++SS  + +RA+ AQA++VAPFTGLKS ++FP T+K+  D TSI++NG RVQCMQV
Sbjct  1    MASAMMSSATVVNRASPAQATLVAPFTGLKSASAFPTTRKNNRDITSIASNGGRVQCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP G KKFETLSYLP L+  QL K+V+YLL  GW+PCLEFE E GFVYRE H SPGYYD
Sbjct  61   WPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSGWIPCLEFELEHGFVYREHHHSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>sp|P00869.1|RBS2_PEA RecName: Full=Ribulose bisphosphate carboxylase small chain 3C, 
chloroplastic; Short=RuBisCO small subunit 3C; AltName: Full=PSS15; 
Flags: Precursor [Pisum sativum]
 emb|CAA27865.1| ribulose 1.5-bisphosphate carboxylase (RBC) [Pisum sativum]
 emb|CAA25390.1| ribulose bisphosphate carboxylase [Pisum sativum]
 prf||1211236B carboxylase,ribulose bisphosphate
Length=180

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS   FPV KK   D TSI++NG RV+CMQVWPP G KKFETLSYLPPL+ +QLL
Sbjct  26   PFGGLKSMTGFPV-KKVNTDITSITSNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLL  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGWVPCLEFE EKGFVYRE + SPGYYDGRYWTMWK
Sbjct  85   KEVEYLLRKGWVPCLEFELEKGFVYREHNKSPGYYDGRYWTMWK  128



>gb|AIF75363.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS + FPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASFFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  113



>gb|AAA33035.1| ribulose-1-5-bisphosphate carboxylase [Mesembryanthemum crystallinum]
Length=182

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A+FPVTKK+  D TS++TNG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  26   PFNGLKSVAAFPVTKKNN-DITSVATNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWK
Sbjct  85   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWK  128



>gb|AAF19793.1|AF162210_1 ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Lactuca sativa]
Length=181

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS  +FPVTKK+  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYLPPLS E L 
Sbjct  25   PFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALS  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YL+   WVPCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  85   KEIDYLIRNKWVPCLEFELEHGFVYREHHHSPGYYDGRYWTMWK  128



>sp|Q40250.1|RBS_LACSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Lactuca sativa]
 dbj|BAA03103.1| riburose-1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Lactuca sativa]
Length=181

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS  +FPVTKK+  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYLPPLS E L 
Sbjct  25   PFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALS  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YL+   W+PCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  85   KEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWK  128



>ref|XP_010263805.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+K+  D TS+S+NG RVQCMQVWPP   KKFETLSYLPPLS E L 
Sbjct  27   PFTGLKSVSAFPVTRKTNNDITSLSSNGGRVQCMQVWPPIAKKKFETLSYLPPLSPESLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL  GW+PCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  87   KEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGYYDGRYWTMWK  130



>sp|Q9XGX4.1|RBS3_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37440.1|AF150667_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=180

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS ASFPVT+KS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS  QLL
Sbjct  26   PFNGLKSIASFPVTRKSN-DITSIASNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLL  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             QV+YLLN GW+PC+EFE E  FVYRE H SPGY DGRYWTMWK
Sbjct  85   AQVQYLLNNGWIPCIEFELEHPFVYRENHRSPGYQDGRYWTMWK  128



>gb|AGV08375.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Arachis hypogaea]
Length=182

 Score =   172 bits (437),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  27   PFTGLKSLAGFPVTRKANNDITSVANNGGRVQCMQVWPPVGKKKFETLSYLPDLTDEQLR  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL KGWVPCLEFE   GF YRE H SPGYYDGRYWTMWK
Sbjct  87   KEVDYLLRKGWVPCLEFEVGYGFPYRENHRSPGYYDGRYWTMWK  130



>ref|XP_008244506.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Prunus mume]
Length=182

 Score =   172 bits (437),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FP TKK+  D TSI++NG RVQCM+VWP  GLKKFETLSYLPPLS E L 
Sbjct  28   PFTGLKSASAFPGTKKTN-DITSIASNGGRVQCMKVWPTVGLKKFETLSYLPPLSPESLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL K WVPCLEFE EKGFVYRE H SPGYYDGRYWTMWK
Sbjct  87   KEVDYLLRKNWVPCLEFELEKGFVYRENHRSPGYYDGRYWTMWK  130



>ref|XP_010521010.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Tarenaya hassleriana]
Length=180

 Score =   172 bits (436),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASSV+SS    +  + +Q++++APFTGLKS A+FPVT+K+ AD TS+++NGS+V CMQV
Sbjct  1    MASSVVSSATTVAGVSRSQSAVIAPFTGLKSAAAFPVTRKNNADLTSLASNGSKVNCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WP  GL+KFETLSYLP LS  +L K+V+YLL   W+PCLEFE    FVYRE H SPGYYD
Sbjct  61   WPTTGLRKFETLSYLPDLSDTELAKEVDYLLRNNWIPCLEFELGNAFVYRENHRSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>ref|XP_008446602.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Cucumis melo]
Length=185

 Score =   172 bits (436),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +3

Query  48   MASSVLsstaiasrata--aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCM  221
            MASS+LSS A+AS  +A  AQASMVAPFTGLKS A+FPVT+K+  D T++++NG RVQCM
Sbjct  1    MASSILSSAAVASVNSASPAQASMVAPFTGLKSAAAFPVTRKNN-DITTLASNGGRVQCM  59

Query  222  QVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGY  401
            +VWPP GLKKFETLSYLP +S EQL K+V+YLL KGW+PC+EF+   GFVYRE H SPGY
Sbjct  60   KVWPPLGLKKFETLSYLPDMSNEQLGKEVDYLLRKGWIPCIEFDIHSGFVYRENHRSPGY  119

Query  402  YDGRYWTMWK  431
            YDGRYWTMWK
Sbjct  120  YDGRYWTMWK  129



>ref|XP_002305162.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95372.1| unknown [Populus trichocarpa]
 gb|ABK95841.1| unknown [Populus trichocarpa]
 gb|EEE85673.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=182

 Score =   172 bits (435),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+ E+L 
Sbjct  27   PFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEEELA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YLL   WVPCLEFE EKG+VYRE H+SPGYYDGRYWTMWK
Sbjct  87   KEIDYLLRSKWVPCLEFELEKGWVYREHHSSPGYYDGRYWTMWK  130



>gb|AFO67218.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Aralia elata]
Length=183

 Score =   172 bits (435),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKSTA+FPVT+K   D TS+ +NG RVQCM+VWPP GLKKFETLSYLPPL+ E+L 
Sbjct  27   PFTGLKSTAAFPVTRK-VNDITSLPSNGGRVQCMKVWPPLGLKKFETLSYLPPLTNEELA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL  GWVPCLEFE E G+VYRE H SPGYYDGRYWTMWK
Sbjct  86   KEVDYLLRSGWVPCLEFELEHGWVYRENHRSPGYYDGRYWTMWK  129



>gb|ABK95229.1| unknown [Populus trichocarpa]
 gb|ABK95250.1| unknown [Populus trichocarpa]
Length=182

 Score =   172 bits (435),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+ E+L 
Sbjct  27   PFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEEELA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YLL   WVPCLEFE EKG+VYRE H+SPGYYDGRYWTMWK
Sbjct  87   KEIDYLLRSKWVPCLEFELEKGWVYREHHSSPGYYDGRYWTMWK  130



>gb|ABK96431.1| unknown [Populus trichocarpa x Populus deltoides]
Length=182

 Score =   172 bits (435),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKSTA+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+ E+L 
Sbjct  27   PFNGLKSTAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEEELA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YLL   WVPCLEFE EKG+V+RE H+SPGYYDGRYWTMWK
Sbjct  87   KEIDYLLRSKWVPCLEFELEKGWVHREHHSSPGYYDGRYWTMWK  130



>gb|AEJ33935.1| chloroplast putative ribulose-1,5-bisphosphate carboxylase/oxygenase 
small subunit [Wolffia australiana]
Length=177

 Score =   171 bits (434),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASS++ S+A  +RAT AQ++MVAPF GL+S+A+ P T+K+ AD +++ +NG + +CMQV
Sbjct  1    MASSMMVSSAAVARATPAQSNMVAPFNGLRSSAALPATRKANADLSTLLSNGGKARCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP GLKKFETLSYLPPLSTE L K+VEYL+  GW+PC+EF  E GFVYRE+HASPGYYD
Sbjct  61   WPPEGLKKFETLSYLPPLSTEALAKEVEYLIRNGWIPCIEFSKE-GFVYREYHASPGYYD  119

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  120  GRYWTMWK  127



>gb|KCW52065.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=180

 Score =   171 bits (434),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL 
Sbjct  27   PFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWK
Sbjct  86   KEIDYLLRSGWVPCLEFETE-GFVYREHHHSPGYYDGRYWTMWK  128



>sp|Q08184.1|RBS4_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA33038.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 gb|AAA03696.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   172 bits (435),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G+KKFETLSYLPPLS E LL
Sbjct  27   PFNGLKSISAFPVTRKNN-DITSVASNGGRVQCMQVWPPLGMKKFETLSYLPPLSEESLL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWK
Sbjct  86   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWK  129



>gb|AIF75365.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSAYSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTM K
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMRK  113



>ref|XP_010265138.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  48   MASSVLsstaiasrata--aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCM  221
            MASSVLSS A+A+ + A  AQASMVAPF+GLKS  +FPVT+K+  D +S+ +NG RVQCM
Sbjct  1    MASSVLSSAAVATVSRATPAQASMVAPFSGLKSAXAFPVTRKANNDISSLPSNGGRVQCM  60

Query  222  QVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGY  401
            QVWPP G KKFETLSYLPPLS E L K+V+YLL  GW+PCLEFE E GFVYRE + SPGY
Sbjct  61   QVWPPLGKKKFETLSYLPPLSPESLAKEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGY  120

Query  402  YDGRYWTMWK  431
            YDGRYWTMWK
Sbjct  121  YDGRYWTMWK  130



>ref|XP_007215051.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
 gb|EMJ16250.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
Length=183

 Score =   171 bits (433),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FP  KK+  D TSI++NG RVQCM+VWP  GLKKFETLSYLPPLS E L 
Sbjct  29   PFTGLKSASAFPGAKKTN-DITSIASNGGRVQCMKVWPTVGLKKFETLSYLPPLSPESLA  87

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL K WVPCLEFE EKGFVYRE H SPGYYDGRYWTMWK
Sbjct  88   KEVDYLLRKNWVPCLEFELEKGFVYRENHRSPGYYDGRYWTMWK  131



>ref|XP_004299075.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=180

 Score =   171 bits (433),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS ++FPVT+K A D T++++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  26   PFNGLKSASAFPVTRK-ANDITTLASNGGRVQCMQVWPPVGLKKFETLSYLPPLSVESLA  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL   WVPCLEFE E GFVYRE   SPGYYDGRYWTMWK
Sbjct  85   KEVEYLLRNKWVPCLEFELEHGFVYREHGNSPGYYDGRYWTMWK  128



>ref|XP_002531624.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30752.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=180

 Score =   171 bits (433),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASS++ ST  +    A QASMVAPFTGLKS++ FPVT+K   D T++++NG +V CMQV
Sbjct  1    MASSIVPSTMASLNRAAPQASMVAPFTGLKSSSVFPVTRKQNNDITTLASNGGKVHCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP G KKFETLSYLPPLS E L K+V+YLL  GWVPCLEFE E GFVYRE H SPGYYD
Sbjct  61   WPPVGKKKFETLSYLPPLSEESLAKEVDYLLRMGWVPCLEFELEHGFVYRENHRSPGYYD  120

Query  408  GRYWTMWK  431
            GR WTMWK
Sbjct  121  GRCWTMWK  128



>ref|XP_004135094.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164158.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 gb|KGN52085.1| hypothetical protein Csa_5G609710 [Cucumis sativus]
Length=185

 Score =   171 bits (432),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 108/130 (83%), Gaps = 2/130 (2%)
 Frame = +3

Query  48   MASSVLsstaiasrata--aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCM  221
            MASS+LSS A+AS  +A  AQASMVAPFTGLKS+A FP+T+K+  D T++++NG +VQCM
Sbjct  1    MASSILSSAAVASVNSASPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNGGKVQCM  60

Query  222  QVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGY  401
            +VWPP GL+KFETLSYLP +S EQL K+ +YLL  GWVPC+EF+   GFVYRE H SPGY
Sbjct  61   KVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGY  120

Query  402  YDGRYWTMWK  431
            YDGRYWTMWK
Sbjct  121  YDGRYWTMWK  130



>ref|XP_011035062.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Populus euphratica]
Length=181

 Score =   171 bits (432),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS A+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+  +L 
Sbjct  26   PFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEAELA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YLL   WVPCLEFE EKG+VYRE H SPGYYDGRYWTMWK
Sbjct  86   KEIDYLLRSKWVPCLEFELEKGWVYRENHRSPGYYDGRYWTMWK  129



>gb|ABK55670.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Cucumis sativus]
Length=125

 Score =   168 bits (426),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A FP+T+K+  D T++++NG +VQCM+VWPP GL+KFETLSYLP +S EQL 
Sbjct  18   PFTGLKSSAGFPITRKNNVDITTLASNGGKVQCMKVWPPLGLRKFETLSYLPDMSNEQLS  77

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+ +YLL  GWVPC+EF+   GFVYRE H SPGYYDGRYWTMWK
Sbjct  78   KECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGYYDGRYWTMWK  121



>emb|CCF55356.1| ribulose-1,5-bisphosphate carboxylase small subunit [Cucumis 
sativus]
Length=185

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  48   MASSVLsstaiasrata--aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCM  221
            MASS+LSS  +AS  +A  AQASMVAPFTGLKS+A FP+T+K+  D T++++NG +VQCM
Sbjct  1    MASSILSSAVVASVNSASPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNGGKVQCM  60

Query  222  QVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGY  401
            +VWPP GL+KFETLSYLP +S EQL K+ +YLL  GWVPC+EF+   GFVYRE H SPGY
Sbjct  61   KVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGY  120

Query  402  YDGRYWTMWK  431
            YDGRYWTMWK
Sbjct  121  YDGRYWTMWK  130



>gb|KDP20120.1| hypothetical protein JCGZ_05889 [Jatropha curcas]
Length=181

 Score =   170 bits (431),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKSTA FP  +K+  D TSI++NG RVQCM+VWP  GLKKFETLSYLPPL+ EQL 
Sbjct  27   PFTGLKSTAGFPA-RKTTNDITSIASNGGRVQCMKVWPTQGLKKFETLSYLPPLTREQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL  GWVPCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  86   KEVEYLLRSGWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWK  129



>ref|XP_008352922.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score =   170 bits (431),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+++FPVT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  28   PFTGLKSSSAFPVTRK-ANDITSIASNGGRVQCMQVWPPIGLKKFETLSYLPPLSPESLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL K WVP LEFE E+ FVYRE ++SPGYYDGRYWTMWK
Sbjct  87   KEVDYLLRKNWVPTLEFELERPFVYREHNSSPGYYDGRYWTMWK  130



>gb|ABK15574.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia sinensis]
Length=176

 Score =   170 bits (430),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST++FPVT+K   D TS+++NG RVQCM+VWPP GLKKFETLSYLPPL+  QL 
Sbjct  21   PFTGLKSTSAFPVTRKLDTDITSLASNGGRVQCMKVWPPLGLKKFETLSYLPPLTQAQLG  80

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YL+  GW+PCLEF  + GFVYRE + SPGYYDGRYWTMWK
Sbjct  81   KEVDYLIRLGWIPCLEFSVQGGFVYREHNKSPGYYDGRYWTMWK  124



>sp|Q43832.1|RBS2_SPIOL RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA66201.1| ribulose-bisphosphate carboxylase [Spinacia oleracea]
Length=180

 Score =   170 bits (431),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = +3

Query  48   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSVLSS A+A+ +   AQASMVAPFTGLKST  FP TKK+  D TS+++NG RVQCM+
Sbjct  1    MASSVLSSAAVATVSRTPAQASMVAPFTGLKSTVGFPATKKND-DITSLASNGGRVQCMK  59

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWP   +K++ETLSYLPPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYY
Sbjct  60   VWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYY  119

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  120  DGRYWTMWK  128



>ref|XP_008339672.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score =   170 bits (430),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+++FPVT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  28   PFTGLKSSSAFPVTRK-ANDITSIASNGGRVQCMQVWPPIGLKKFETLSYLPPLSPESLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL K WVP LEFE E+ FVYRE ++SPGYYDGRYWTMWK
Sbjct  87   KEVDYLLRKNWVPTLEFELERPFVYREHNSSPGYYDGRYWTMWK  130



>gb|AAB81105.1| ribulose 1,5-bisphosphate carboxylase small subunit [Spinacia 
oleracea]
Length=180

 Score =   170 bits (430),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 107/129 (83%), Gaps = 2/129 (2%)
 Frame = +3

Query  48   MASSVLsstaiasrata-aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQ  224
            MASSVLSS  +A+ +   AQASMVAPFTGLKST  FP TKK+  D TS+++NG RVQCM+
Sbjct  1    MASSVLSSARVATVSRTPAQASMVAPFTGLKSTVGFPATKKND-DITSLASNGGRVQCMK  59

Query  225  VWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYY  404
            VWP   +K++ETLSYLPPL+T+QL +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYY
Sbjct  60   VWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYY  119

Query  405  DGRYWTMWK  431
            DGRYWTMWK
Sbjct  120  DGRYWTMWK  128



>gb|AAF03096.1|AF162195_1 ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Lactuca sativa]
Length=174

 Score =   169 bits (429),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS  +FPVTKK+  DF+S+ +NG RVQCM+VWPP GLKK+ETLS LPPLS E L 
Sbjct  25   PFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSCLPPLSDEALS  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YL+   W+PCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  85   KEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWK  128



>ref|XP_010551266.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Tarenaya hassleriana]
Length=180

 Score =   169 bits (429),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASS++SS A  S  + AQ++++APFTGLKS+A+FPVT+K+ AD TS+++NGS+V CM+V
Sbjct  1    MASSIVSSAATVSGVSRAQSAVIAPFTGLKSSAAFPVTRKNNADITSLASNGSKVNCMKV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WP  GL+KFETLSYLP L+  +L K+V+YLL   W+PCLEFE    FVYRE H SPGYYD
Sbjct  61   WPTTGLRKFETLSYLPDLTDAELAKEVDYLLRNNWIPCLEFELGNAFVYRENHRSPGYYD  120

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  121  GRYWTMWK  128



>gb|AIR75139.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia turkestanica]
Length=165

 Score =   169 bits (427),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL 
Sbjct  18   PFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLA  76

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWK
Sbjct  77   RQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWK  120



>ref|XP_009774104.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   169 bits (429),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS  SFPV++K     TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  26   PFTGLKSATSFPVSRKQNLYITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++V+YLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  86   REVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  129



>gb|AIR75138.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia tetrandra]
Length=165

 Score =   169 bits (427),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL 
Sbjct  18   PFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLA  76

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWK
Sbjct  77   RQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWK  120



>gb|ADB85091.1| ribulose 1,5-bisphosphate carboxylase small subunit [Jatropha 
curcas]
Length=181

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKSTA FP  +K+  D TSI+ NG RVQCM+VWP  GLKKFETLSYLPPL+ EQL 
Sbjct  27   PFTGLKSTAGFPA-RKTTNDITSIAGNGGRVQCMKVWPTQGLKKFETLSYLPPLTREQLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL  GWVPCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  86   KEVEYLLRSGWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWK  129



>gb|AAA33037.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  27   PFNGLKSVSAFPVTRKNN-DITSVASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLI  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWK
Sbjct  86   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWK  129



>ref|NP_001235314.1| uncharacterized protein LOC100500504 [Glycine max]
 gb|ACU15604.1| unknown [Glycine max]
 gb|KHN47663.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPDLDDAQLA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWK  126



>sp|Q08183.1|RBS3_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03695.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  27   PFNGLKSVSAFPVTRKNN-DITSVASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWK
Sbjct  86   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWK  129



>gb|AIR75136.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
 gb|AIR75137.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   169 bits (427),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL 
Sbjct  18   PFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLA  76

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWK
Sbjct  77   RQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWK  120



>gb|AIL82451.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   169 bits (427),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL 
Sbjct  18   PFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLA  76

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWK
Sbjct  77   RQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWK  120



>gb|AAG24884.1|AF303941_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS3 [Glycine 
max]
Length=178

 Score =   169 bits (427),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWK  126



>ref|NP_001241137.1| ribulose bisphosphate carboxylase small chain 1, chloroplastic-like 
[Glycine max]
 gb|AAG24882.1|AF303939_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS1 [Glycine 
max]
 gb|AAA81328.1| ribulose-1,5-bisphosphate carboxylase small subunit [Glycine 
max]
 gb|KHN07517.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
 gb|KHN07519.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   169 bits (427),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWK  126



>gb|AIB04188.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia oleifera]
Length=176

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST++FPVT+K   D TS+++NG RVQCM+VWPP GLKKFETLSYLPPL+  QL 
Sbjct  21   PFTGLKSTSAFPVTRKLDTDITSLASNGGRVQCMKVWPPLGLKKFETLSYLPPLTQVQLG  80

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YL+  GW+PCLEF    GFVYRE + SPGYYDGRYWTMWK
Sbjct  81   KEVDYLIRLGWIPCLEFSVVGGFVYREHNKSPGYYDGRYWTMWK  124



>gb|AIF75300.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis duranensis]
 gb|AIF75310.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
Length=159

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF+GLKS   FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  19   PFSGLKSLGGFPVTRKTN-DITSVTNNGGRVQCMQVWPPLGKKKFETLSYLPDLNEEQLR  77

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL KGWVPCLEFE E GF YRE H SPGYYDGRYWTMWK
Sbjct  78   KEVDYLLRKGWVPCLEFEVEYGFPYRENHRSPGYYDGRYWTMWK  121



>gb|AIF75302.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis duranensis]
 gb|AIF75308.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis ipaensis]
 gb|AIF75309.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
Length=159

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF+GLKS   FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  19   PFSGLKSLGGFPVTRKTN-DITSVANNGGRVQCMQVWPPLGKKKFETLSYLPDLNEEQLR  77

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL KGWVPCLEFE E GF YRE H SPGYYDGRYWTMWK
Sbjct  78   KEVDYLLRKGWVPCLEFEVEYGFPYRENHRSPGYYDGRYWTMWK  121



>gb|AIF75301.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
 gb|AIF75303.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
 gb|AIF75306.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis ipaensis]
 gb|AIF75307.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arachis hypogaea]
Length=159

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF+GLKS   FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  19   PFSGLKSLGGFPVTRKTN-DITSVANNGGRVQCMQVWPPLGKKKFETLSYLPDLNEEQLR  77

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL KGWVPCLEFE E GF YRE H SPGYYDGRYWTMWK
Sbjct  78   KEVDYLLRKGWVPCLEFEVEYGFPYRENHRSPGYYDGRYWTMWK  121



>gb|AAF06098.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
 gb|AAF06101.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
Length=184

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST++FP T K++AD TS+++NG RVQCMQVWP  G KKFETLSYLPPLS EQL 
Sbjct  27   PFTGLKSTSAFPATTKTSADITSLASNGGRVQCMQVWPTRGKKKFETLSYLPPLSREQLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             +++YLL  GW+PCLEFE E GFVYR   + PGYYDGRYWTMWK
Sbjct  87   SEIDYLLRSGWIPCLEFELEHGFVYRAHGSLPGYYDGRYWTMWK  130



>ref|XP_009602965.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=179

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 86/104 (83%), Gaps = 2/104 (2%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS  QLL
Sbjct  26   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLS--QLL  83

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWK
Sbjct  84   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWK  127



>ref|XP_009356790.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Pyrus x bretschneideri]
Length=182

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  28   PFTGLKSFSAFPVTRK-ANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPPLSPESLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL K WVP LEFE E+ FVYRE ++SPGYYDGRYWTMWK
Sbjct  87   KEVDYLLRKNWVPTLEFELERPFVYREHNSSPGYYDGRYWTMWK  130



>sp|P08705.1|RBS_HELAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Helianthus annuus]
 emb|CAA68490.1| ribulose bisphosphate carboxylase [Helianthus annuus]
 emb|CAA28737.1| RuBisCO (SSU) [Helianthus annuus]
Length=178

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A+FP TKK A DF+++ +NG RVQCM+VWPP GLKK+ETLSYLPPL+  QL 
Sbjct  24   PFTGLKSNAAFPTTKK-ANDFSTLPSNGGRVQCMKVWPPLGLKKYETLSYLPPLTETQLA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL K WVPCLEFE E GFVYRE   SPGYYDGRYWTMWK
Sbjct  83   KEVDYLLRKKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWK  126



>emb|CBY05833.1| Ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
 emb|CBY89197.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
Length=181

 Score =   167 bits (423),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLK+ +SFP++KKS  D TS++TNG RVQCMQVWPP G  K ET SYLP L+ EQLL
Sbjct  27   PFTGLKAASSFPISKKSV-DITSLATNGGRVQCMQVWPPTGKLKNETFSYLPDLTDEQLL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YL+  GW+PCLEFE EKG VYRE+H SPGYYDGRYWTMWK
Sbjct  86   KEIDYLIRNGWIPCLEFELEKGHVYREYHRSPGYYDGRYWTMWK  129



>sp|P08474.1|RBS_CUCSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Cucumis sativus]
 gb|AAA33131.1| ribulose bisphosphate carboxylase/oxygenase precursor peptide 
[Cucumis sativus]
Length=189

 Score =   167 bits (424),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  48   MASSVLsstaiasrata--aqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCM  221
            MASS+LSS A+AS  +A  AQASMVAPFTGLKS+A FP+T+K+  D T++++N  +VQCM
Sbjct  1    MASSILSSAAVASVNSASPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNAGKVQCM  60

Query  222  QVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGY  401
            +VWPP GL+KFETLSYLP +S EQL K+ +YLL  GWVPC+EF+   GFVYRE H SPG+
Sbjct  61   KVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGF  120

Query  402  YDGRYWTMWK  431
            YDGRYWTMWK
Sbjct  121  YDGRYWTMWK  130



>ref|XP_010263795.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=184

 Score =   167 bits (423),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSIS--TNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQ  293
            PFTGLKS ++FPVT+K+  D TS+   +NG RVQCMQVWPP G KKFETLSYLPPLS E 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLPLPSNGGRVQCMQVWPPTGKKKFETLSYLPPLSPES  86

Query  294  LLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            L K+V+YLL  GW+PCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  87   LAKEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGYYDGRYWTMWK  132



>sp|P19311.1|RBS5_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5A, 
chloroplastic; Short=RuBisCO small subunit SSU5A; Flags: 
Precursor [Lemna gibba]
 emb|CAA35099.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   167 bits (422),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASS+++STA  +RA  AQ+SMVAPF GL+S+ +FP T+K+  D +++ +NG RV CMQV
Sbjct  1    MASSMMASTAAVARAGPAQSSMVAPFNGLRSSVAFPATRKANNDLSTLPSNGGRVSCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP GLKKFETLSYLPPLS E L K+V+YLL   WVPC+EF  E GFVYRE HASPGYYD
Sbjct  61   WPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYD  119

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  120  GRYWTMWK  127



>sp|P19312.1|RBS6_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5B, 
chloroplastic; Short=RuBisCO small subunit SSU5B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35100.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   167 bits (422),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASS+++STA  +R   AQ +MVAPF GL+S+ +FP T+K+  D +++ +NG RV CMQV
Sbjct  1    MASSMMASTAAVARVGPAQTNMVAPFNGLRSSVAFPATRKANNDLSTLPSNGGRVSCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP GLKKFETLSYLPPLS E L K+V+YLL   WVPC+EF  E GFVYRE HASPGYYD
Sbjct  61   WPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYD  119

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  120  GRYWTMWK  127



>gb|AAA33686.1| ribulose 1,5-bisphosphate carboxylase small subunit propeptide, 
partial [Pisum sativum]
Length=156

 Score =   166 bits (419),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLK    FPV KK   D TSI++NG RV+CMQVWPP G KKFETLSYLPPL+ +QLL
Sbjct  2    PFGGLKFMTGFPV-KKVNTDITSITSNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLL  60

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGWVPCLEFE EKGFVYRE + SP YYDGRYWTMWK
Sbjct  61   KEVEYLLRKGWVPCLEFELEKGFVYREHNKSPRYYDGRYWTMWK  104



>sp|P18960.1|RBS_SILPR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Silene latifolia subsp. alba]
 gb|AAB39037.1| ribulose bisphosphate carboxylase precursor [Silene latifolia 
subsp. alba]
Length=177

 Score =   166 bits (421),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF+GLKST++FPV++KS  D TS++TNG RV CMQVWPP  LKKFETLSYLP LS E LL
Sbjct  24   PFSGLKSTSAFPVSRKSNVDITSLATNGGRVNCMQVWPPRNLKKFETLSYLPTLSEESLL  83

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K++ YLL KGWVPCLEFE     VYRE + SPGYYDGRYWTMWK
Sbjct  84   KEINYLLIKGWVPCLEFEVGPAHVYRENNKSPGYYDGRYWTMWK  127



>ref|XP_010926041.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Elaeis guineensis]
Length=180

 Score =   166 bits (421),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST++FPVT++++ DF+ + +NG RV+CMQVWP  G KKFETLSYLPPLS E LL
Sbjct  26   PFTGLKSTSAFPVTRRASNDFSKLPSNGGRVRCMQVWPIEGKKKFETLSYLPPLSIEALL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            KQ+EYLL  GW+PCLEF  + GFVYRE H SPGYYDGRYWTMWK
Sbjct  86   KQIEYLLRSGWIPCLEF-CKVGFVYRENHQSPGYYDGRYWTMWK  128



>sp|Q42915.1|RBS_MANES RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Manihot esculenta]
 gb|AAA99429.1| ribulose 1,5-bisphosphate carboxylase [Manihot esculenta]
 gb|AAF06099.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
Length=182

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST  FP T+K+ +D TSI++NG +VQCM+VWP  G+KKFETLSYLPPL+ EQL 
Sbjct  27   PFTGLKSTPVFPTTRKTNSDITSITSNGGKVQCMKVWPTLGMKKFETLSYLPPLTREQLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             +VEYLL  GW+PCLEFE E G VYRE    PGYYDGRYWTMWK
Sbjct  87   SEVEYLLRSGWIPCLEFELEHGLVYREHARVPGYYDGRYWTMWK  130



>gb|KDP29409.1| hypothetical protein JCGZ_18330 [Jatropha curcas]
Length=153

 Score =   165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST++F VT+K+  D TSIS+ G RVQCMQVWPP G K FETLSYLPPLS +QL 
Sbjct  4    PFTGLKSTSAFSVTRKNNTDITSISSKGGRVQCMQVWPPVGKKFFETLSYLPPLSQDQLA  63

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V YLL    VPCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  64   KEVHYLLRMDRVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWK  107



>gb|ACU13285.1| unknown [Glycine max]
Length=178

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVW P G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWAPVGKKKFETLSYLPDLDDAQLA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWK  126



>gb|AAO25119.1| ribulose-1,5-bisphosphate carboxylase small subunit [Chrysanthemum 
x morifolium]
Length=179

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS  +FPVTKKS  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYLPPL+  QL 
Sbjct  25   PFTGLKSNVAFPVTKKSN-DFSSLPSNGGRVQCMKVWPPLGLKKYETLSYLPPLTETQLA  83

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL   WVPCLEFE E GF YRE + SPGYYDGRYWTMWK
Sbjct  84   KEVEYLLRNKWVPCLEFELEHGFPYRENNRSPGYYDGRYWTMWK  127



>sp|P00865.1|RBS1_SOYBN RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Glycine max]
 emb|CAA23736.1| rubpcase [Glycine max]
Length=178

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPDLDDAQLA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGW+PCLEFE E GFVYRE + SP YYDGRYWTMWK
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPXYYDGRYWTMWK  126



>sp|Q42823.1|RBS_GLYTA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tabacina]
 gb|AAA82071.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tabacina]
Length=178

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 83/104 (80%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FP T+K+  D  SI++NG RVQCMQVWP  G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDIASIASNGGRVQCMQVWPTTGKKKFETLSYLPDLDDAQLA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGW+PCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHHRSPGYYDGRYWTMWK  126



>emb|CDP20139.1| unnamed protein product [Coffea canephora]
Length=158

 Score =   165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLK+ +SFP++KKS  D TS++TNG RVQCMQVWPP G  K ET SYLP L+ EQLL
Sbjct  4    PFTGLKAASSFPISKKSV-DITSLATNGGRVQCMQVWPPTGKLKNETFSYLPDLTDEQLL  62

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+++YL+  GW+PCLEFE EKG VYRE+H SPGYYDGRYWTMWK
Sbjct  63   KEIDYLIRNGWIPCLEFELEKGHVYREYHRSPGYYDGRYWTMWK  106



>ref|NP_001235266.1| ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
 gb|AAG24883.1|AF303940_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
Length=178

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FP T+K+  D  SI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDTISIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWK  126



>gb|AAA82069.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Glycine soja]
Length=178

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGR WTMWK
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRCWTMWK  126



>sp|Q42822.1|RBS_GLYTO RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tomentella]
 gb|AAA82070.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tomentella]
Length=178

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 83/104 (80%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A FP T+K+  D  SI++NG RVQCMQVWP  G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDIASIASNGGRVQCMQVWPTTGKKKFETLSYLPDLDDAQLA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGW+PCLEFE E GFVYRE H SPGYYDGRYWTMWK
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYRENHRSPGYYDGRYWTMWK  126



>sp|P08135.1|RBS_RAPSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Raphanus sativus]
 emb|CAA29801.1| carboxylase [Raphanus sativus]
 prf||1405335A ribulose bisphosphate carboxylase S
Length=181

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNTDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>ref|XP_007225932.1| hypothetical protein PRUPE_ppa012174mg [Prunus persica]
 gb|EMJ27131.1| hypothetical protein PRUPE_ppa012174mg [Prunus persica]
Length=181

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+K+  D TSIS+NG RVQCM+VWPP GLKKFETLSYLPPLS E L 
Sbjct  26   PFTGLKSASAFPVTRKANNDITSISSNGGRVQCMRVWPPIGLKKFETLSYLPPLSAESLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   WVP LEFE    FV+RE   SPGYYDGRYWTMWK
Sbjct  86   KEVDYLLRNNWVPTLEFELGNPFVHRENGNSPGYYDGRYWTMWK  129



>gb|AAF06100.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
Length=184

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST++F  T K++AD TS+++NG RVQCMQVWP  G KKFETLSYLPPLS EQL 
Sbjct  27   PFTGLKSTSAFTATTKTSADITSLASNGGRVQCMQVWPTRGKKKFETLSYLPPLSREQLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
             +++YLL  GW+PCLEFE E GFVYR   + PGYYDGRYWTMWK
Sbjct  87   SEIDYLLRSGWIPCLEFELEHGFVYRAHGSLPGYYDGRYWTMWK  130



>sp|Q08185.1|RBS5_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03697.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial [Mesembryanthemum crystallinum]
Length=182

 Score =   165 bits (417),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS ++FPVT+K+  D TS+++NG RVQCM VWPP G+KKFETLSYLPPLS E LL
Sbjct  27   PFNGLKSISAFPVTRKNN-DITSVASNGGRVQCM-VWPPLGMKKFETLSYLPPLSEESLL  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWK
Sbjct  85   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWK  128



>emb|CDY52468.1| BnaA04g27920D [Brassica napus]
Length=181

 Score =   164 bits (416),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>ref|XP_009140170.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Brassica rapa]
Length=181

 Score =   164 bits (416),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>gb|AIF75323.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   164 bits (415),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  122



>emb|CAA32701.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   164 bits (416),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  126



>gb|AIF75322.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   164 bits (415),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  122



>sp|P29684.1|RBS_HEVBR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Hevea brasiliensis]
 gb|AAA33361.1| ribulose-1,5-bisphosphate carboxylase small subunit [Hevea brasiliensis]
Length=183

 Score =   164 bits (416),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST++FP T+K+  D TSI++NG RVQCMQVWPP G K +ETLSYLPPL+ EQL 
Sbjct  27   PFTGLKSTSAFPTTRKTTTDITSIASNGGRVQCMQVWPPRGKKFYETLSYLPPLTREQLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGWVPCLEFE E G VYRE+H SPGYYDGRYWTMWK
Sbjct  87   KEVEYLLRKGWVPCLEFELEHGTVYREYHRSPGYYDGRYWTMWK  130



>gb|AIF75321.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
Length=177

 Score =   164 bits (415),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  122



>ref|NP_198658.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
 sp|P10797.2|RBS2B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB09354.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL24421.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32515.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32536.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32621.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAM13287.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAN72105.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO00914.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO29974.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AED94314.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
Length=181

 Score =   164 bits (415),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  126



>ref|XP_002888576.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64835.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
Length=180

 Score =   164 bits (415),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPVGKKKFETLSYLPDLTDSELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   SPGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWK  126



>gb|AFS41770.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium gossypioides]
Length=168

 Score =   164 bits (414),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  19   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  78

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PCLEFE E+GFV+R++ + PGYYDGRYWTMWK
Sbjct  79   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPGYYDGRYWTMWK  122



>ref|XP_008243231.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Prunus mume]
Length=181

 Score =   164 bits (415),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+ +  D TSIS+NG RVQCMQVWPP GLKKFETLSYLPPL+ E L 
Sbjct  26   PFTGLKSASAFPVTRNANKDITSISSNGGRVQCMQVWPPIGLKKFETLSYLPPLTAESLA  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   WVP LEFE    FV+RE   SPGYYDGRYWTMWK
Sbjct  86   KEVDYLLRNNWVPTLEFELGNPFVHRENGNSPGYYDGRYWTMWK  129



>gb|AIF75340.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75341.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   164 bits (415),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+KS  D TSI+ NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKSNTDITSIANNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  122



>gb|AIF75285.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75286.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
 gb|AIF75287.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
Length=163

 Score =   163 bits (413),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  11   PFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  70

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  114



>ref|XP_007151650.1| hypothetical protein PHAVU_004G064800g [Phaseolus vulgaris]
 ref|XP_007151651.1| hypothetical protein PHAVU_004G064900g [Phaseolus vulgaris]
 gb|ESW23644.1| hypothetical protein PHAVU_004G064800g [Phaseolus vulgaris]
 gb|ESW23645.1| hypothetical protein PHAVU_004G064900g [Phaseolus vulgaris]
Length=180

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS   FP ++K   D TS++ NG RVQC+QVWP  G KKFETLSYLPPL+ EQL 
Sbjct  26   PFTGLKSLGGFP-SRKMNNDITSVANNGGRVQCIQVWPTVGKKKFETLSYLPPLTKEQLA  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL KGWVPCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  85   KEVDYLLRKGWVPCLEFELEHGFVYREHNKSPGYYDGRYWTMWK  128



>ref|XP_002868775.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45034.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
Length=181

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSIS+NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSATFPVTRKANNDITSISSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  126



>ref|XP_006285820.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
 gb|EOA18718.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
Length=181

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELG  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>sp|P19308.1|RBS2_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU26, 
chloroplastic; Short=RuBisCO small subunit SSU26; Flags: 
Precursor [Lemna gibba]
 emb|CAA35101.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +3

Query  48   MASSVLsstaiasrataaqasmvaPFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQV  227
            MASS+++STA  +RA  AQ++MVAPF GL+S+ +FP T+K+  + +++ +NG +V CMQV
Sbjct  1    MASSMMASTAAVARAGPAQSNMVAPFNGLRSSVAFPATRKANKNLSTLPSNGGKVSCMQV  60

Query  228  WPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYD  407
            WPP GLKKFETLSYLPPLS E L K+V+YLL   WVPC+EF  E GFVYRE HASPGYYD
Sbjct  61   WPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYD  119

Query  408  GRYWTMWK  431
            GRYWTMWK
Sbjct  120  GRYWTMWK  127



>gb|AGV54682.1| ribulose bisphosphate carboxylase [Phaseolus vulgaris]
Length=180

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS   FP ++K   D TS++ NG RVQC+QVWP  G KKFETLSYLPPL+ EQL 
Sbjct  26   PFTGLKSLGGFP-SRKMNNDITSVANNGGRVQCIQVWPTVGKKKFETLSYLPPLTQEQLA  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL KGWVPCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  85   KEVDYLLRKGWVPCLEFELEHGFVYREHNKSPGYYDGRYWTMWK  128



>ref|NP_198657.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 sp|P10798.2|RBS3B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK25834.1|AF360124_1 putative ribulose bisphosphate carboxylase small chain 3b precursor 
[Arabidopsis thaliana]
 gb|AAK95300.1|AF410314_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAL58912.1|AF462822_1 At5g38410/F1O19.10 [Arabidopsis thaliana]
 dbj|BAB09353.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAK93702.1| putative RuBisCO small 3b subunit precursor [Arabidopsis thaliana]
 gb|AAK96743.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAL47390.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAM19980.1| At5g38410/F1O19.10 [Arabidopsis thaliana]
 gb|AAN31863.1| putative ribulose bisphosphate carboxylase small chain 3b precursor 
(RuBisCO small subunit 3b) [Arabidopsis thaliana]
 gb|AED94311.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=181

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  126



>ref|NP_198659.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
 sp|P10796.1|RBS1B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1B, 
chloroplastic; Short=RuBisCO small subunit 1B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK95269.1|AF410283_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 emb|CAA32700.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
 dbj|BAB09355.1| ribulose bisphosphate carboxylase small chain 1b precursor (RuBisCO 
small subunit 1b) [Arabidopsis thaliana]
 gb|AAN28753.1| At5g38430/F1O19.10 [Arabidopsis thaliana]
 gb|AED94315.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
Length=181

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  126



>gb|ACQ90230.1| virus-resistance protein [Brassica rapa subsp. chinensis]
Length=249

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  91   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  150

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  151  KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  194



>gb|AIF75292.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   163 bits (412),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSIS+NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFTGLKSSAAFPVTRKANNDITSISSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  70

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  114



>emb|CAA32702.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNKDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  126



>emb|CDX99682.1| BnaC04g34390D [Brassica napus]
Length=189

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+KS  D TSI+ NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKSNTDITSIANNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>sp|P12468.1|RBS4_SOYBN RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Glycine max]
 gb|AAA34008.1| ribulose 1,5-bisphosphate carboxylase [Glycine max]
 prf||1306410A ribulose bisphosphate carboxylase S
Length=178

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 83/104 (80%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS A  P T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGLP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+VEYLL KGW+PCLEFE E GFVYRE + S GYYDGRYWTMWK
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSLGYYDGRYWTMWK  126



>ref|XP_006391132.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
 gb|ESQ28418.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
Length=182

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT K+  D TS+++NGS+V CMQVWPP G KKFETLSYLP LS   L 
Sbjct  27   PFTGLKSSAAFPVTHKTNFDITSLASNGSKVHCMQVWPPVGKKKFETLSYLPDLSEVSLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  87   KEVDYLLRNKWIPCVEFELEHGFVYREHNKSPGYYDGRYWTMWK  130



>gb|AIF75289.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75290.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   162 bits (411),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  11   PFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  70

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  114



>gb|AIF75288.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   162 bits (411),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  11   PFTGLKSSAAFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  70

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  114



>emb|CDX67402.1| BnaA07g14420D [Brassica napus]
Length=181

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWPPVGKKKFETLSYLPDLTDVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  126



>ref|XP_010450911.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>gb|AIF75324.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75325.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   162 bits (411),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  122



>ref|XP_010450912.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic [Camelina sativa]
Length=181

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>ref|XP_006405770.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
 gb|ESQ47223.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
Length=181

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNTDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTEVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFV+RE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELENGFVHREHGSTPGYYDGRYWTMWK  126



>ref|XP_010440948.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>ref|XP_010450913.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>ref|XP_010435745.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>gb|AIF75296.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75297.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   162 bits (409),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+ASFP T+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFTGLKSSASFPATRKANNDITSITSNGGRVNCMKVWPPVGKKKFETLSYLPDLTDSELA  70

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  114



>ref|XP_010435743.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X1 [Camelina sativa]
 ref|XP_010435744.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X2 [Camelina sativa]
Length=181

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>ref|XP_006285696.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
 gb|EOA18594.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
Length=181

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF+GLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFSGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELG  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>gb|AIF75291.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75293.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
Length=163

 Score =   162 bits (409),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  70

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  114



>ref|XP_006391472.1| hypothetical protein EUTSA_v10019202mg [Eutrema salsugineum]
 gb|ESQ28758.1| hypothetical protein EUTSA_v10019202mg [Eutrema salsugineum]
Length=181

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPDLTEVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E  FV+RE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELENAFVHREHGSTPGYYDGRYWTMWK  126



>emb|CAA42618.1| ribulose bisphosphate carboxylase [Phaseolus vulgaris]
 emb|CAA40339.1| small subunit of ribulose 1,5-bisphosphate carboxylase/oxygenase 
[Phaseolus vulgaris]
Length=180

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS   FP ++K   D TS++ NG RVQC+QVWP  G KKFETLSYLPPL+ +QL 
Sbjct  26   PFTGLKSLGGFP-SRKMNNDITSVANNGGRVQCIQVWPTVGKKKFETLSYLPPLTKQQLA  84

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL KGWVPCLEFE E GFVYRE + SPGYYDGRYWTMWK
Sbjct  85   KEVDYLLRKGWVPCLEFELEHGFVYREHNKSPGYYDGRYWTMWK  128



>ref|NP_176880.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
 sp|P10795.2|RBS1A_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic; Short=RuBisCO small subunit 1A; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG40363.1|AF325011_1 000C10C11 [Arabidopsis thaliana]
 gb|AAK95277.1|AF410291_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAD10655.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAK96772.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL06849.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24219.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24422.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32690.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32789.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL38277.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13379.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13387.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM19882.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAN15681.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAN72087.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 dbj|BAE98610.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98685.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98695.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98874.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 gb|AEE34594.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
Length=180

 Score =   162 bits (410),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YL+   W+PC+EFE E GFVYRE   SPGYYDGRYWTMWK
Sbjct  83   KEVDYLIRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWK  126



>gb|AIF75283.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75284.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   162 bits (409),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELA  70

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YL+   W+PC+EFE E GFVYRE   SPGYYDGRYWTMWK
Sbjct  71   KEVDYLIRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWK  114



>ref|XP_006284616.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
 gb|EOA17514.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
Length=181

 Score =   162 bits (410),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG +V CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGKVSCMKVWPPIGKKKFETLSYLPDLSDVELG  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>gb|AIF75294.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   161 bits (408),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  70

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  114



>gb|AIF75344.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75345.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   162 bits (409),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKTDTDITSIASNGGRVNCMKVWPPVGKKKFETLSYLPDLTDVELS  78

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  122



>ref|XP_009125072.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Brassica rapa]
Length=181

 Score =   162 bits (409),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP ++  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWPPVGKKKFETLSYLPDVTDVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  126



>ref|XP_009139778.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic isoform X1 [Brassica rapa]
 sp|P27985.1|RBS2_BRANA RecName: Full=Ribulose bisphosphate carboxylase small chain F1, 
chloroplastic; Short=RuBisCO small subunit F1; Flags: Precursor 
[Brassica napus]
 emb|CAA39402.1| ribulose bisphosphate carboxylase /oxygenase small subunit [Brassica 
napus]
 emb|CDY71122.1| BnaAnng36210D [Brassica napus]
Length=181

 Score =   162 bits (409),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTEVELG  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>gb|AIF75317.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75318.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75319.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75320.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75334.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75335.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75336.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   162 bits (409),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTEVELG  78

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  122



>gb|AIF75295.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   161 bits (407),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  70

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  114



>gb|AEX60835.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=171

 Score =   161 bits (408),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWK
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWK  130



>gb|ABB51649.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit precursor [Brassica napus]
Length=181

 Score =   162 bits (409),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTEVELG  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>ref|XP_002868776.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45035.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score =   162 bits (409),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF+GLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFSGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  126



>gb|AIF75337.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75338.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   161 bits (408),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+++FPVT+K+  D TSI +NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSSAFPVTRKANNDITSIVSNGGRVSCMQVWPPIGKKKFETLSYLPDLTEVELG  78

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  122



>gb|AFS41765.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium armourianum]
 gb|AFS41767.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium davidsonii]
Length=168

 Score =   161 bits (407),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  19   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  78

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWK
Sbjct  79   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWK  122



>emb|CDY01665.1| BnaC04g30870D [Brassica napus]
Length=181

 Score =   161 bits (408),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+++FPVT+K+  D TSI +NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSSAFPVTRKANNDITSIVSNGGRVSCMQVWPPIGKKKFETLSYLPDLTEVELG  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>ref|XP_010440945.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440946.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440947.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PF GLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFNGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWK  126



>ref|XP_008807113.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Phoenix dactylifera]
Length=180

 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKST++FP T++++ DF+ + +NG RVQCM+VWP  G+KKFETLSYLPPL  E LL
Sbjct  26   PFTGLKSTSAFPATRRASNDFSKLPSNGGRVQCMKVWPIEGVKKFETLSYLPPLPIEALL  85

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            KQ+EYLL   W+PCLEF  + GFVYRE H SPGYYDGRYWTMWK
Sbjct  86   KQIEYLLRSRWIPCLEF-CKIGFVYRENHRSPGYYDGRYWTMWK  128



>gb|AEX60840.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=165

 Score =   160 bits (406),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWK
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWK  127



>emb|CDY67657.1| BnaCnng55860D [Brassica napus]
Length=181

 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS+A+FPVT+K+  D TS+++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTDTDITSMASNGGRVNCMKVWPPVGKKKFETLSYLPDLTDVELS  82

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWK
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWK  126



>gb|AFS41762.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium herbaceum]
Length=168

 Score =   160 bits (406),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  19   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  78

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWK
Sbjct  79   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWK  122



>gb|AFS41744.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  299
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  300  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWK  431
            K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWK
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWK  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 550993649940