BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF010G02

Length=410
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACJ71244.1|  catalase 2                                              235   3e-73   Vigna unguiculata
gb|ACJ71245.1|  catalase 2                                              235   3e-73   Vigna unguiculata
ref|NP_001237571.1|  catalase-4                                         234   2e-71   Glycine max [soybeans]
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              233   2e-71   Cicer arietinum [garbanzo]
gb|KEH36313.1|  catalase heme-binding enzyme                            232   2e-71   Medicago truncatula
gb|KJB14250.1|  hypothetical protein B456_002G115900                    233   2e-71   Gossypium raimondii
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            233   4e-71   Pisum sativum [garden pea]
gb|AFD29285.1|  catalase                                                233   4e-71   Vicia faba [broad bean]
ref|NP_001289779.1|  catalase isozyme 1                                 232   5e-71   Nelumbo nucifera [Indian lotus]
dbj|BAH37035.1|  catalase 1                                             232   5e-71   Pisum sativum [garden pea]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          232   5e-71   Vigna radiata var. radiata [golden gram]
gb|ADZ45555.1|  catalase                                                232   6e-71   Vigna radiata [mung bean]
gb|ADZ45556.1|  catalase                                                232   6e-71   Vigna radiata [mung bean]
gb|KHG25152.1|  Catalase isozyme 1                                      232   6e-71   Gossypium arboreum [tree cotton]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      232   7e-71   
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      230   7e-71   Nelumbo nucifera [Indian lotus]
gb|AAR84577.1|  catalase 1b                                             230   1e-70   Lotus japonicus
ref|XP_007018034.1|  Catalase 2                                         231   1e-70   
gb|KEH36312.1|  catalase heme-binding enzyme                            231   1e-70   Medicago truncatula
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      231   2e-70   Fragaria vesca subsp. vesca
gb|ACJ11733.1|  catalase                                                231   2e-70   Gossypium hirsutum [American cotton]
gb|AGV54297.1|  peroxisomal catalase                                    231   2e-70   Phaseolus vulgaris [French bean]
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      231   2e-70   Nelumbo nucifera [Indian lotus]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      231   2e-70   
ref|NP_001235974.1|  catalase-3                                         231   2e-70   Glycine max [soybeans]
ref|NP_001237556.1|  catalase-1/2                                       231   2e-70   Glycine max [soybeans]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    230   2e-70   Gossypium raimondii
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             230   3e-70   Phaseolus vulgaris [French bean]
ref|NP_001240021.1|  catalase                                           230   3e-70   Glycine max [soybeans]
gb|AAR84578.1|  catalase 1a                                             230   3e-70   Lotus japonicus
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      230   4e-70   
gb|AET97564.1|  catalase                                                230   4e-70   Ziziphus jujuba [Chinese jujube]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             229   5e-70   Prunus persica
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             229   5e-70   Phaseolus vulgaris [French bean]
emb|CAD42908.1|  catalase                                               229   5e-70   Prunus persica
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          229   6e-70   Soldanella alpina
tpg|DAA43177.1|  TPA: catalase2                                         229   6e-70   
gb|AGC65520.1|  catalase                                                229   7e-70   Eriobotrya japonica [loquat]
gb|ABF93811.1|  Catalase-1, putative, expressed                         226   8e-70   Oryza sativa Japonica Group [Japonica rice]
gb|AGE15298.2|  catalase 1                                              229   8e-70   Eriobotrya japonica [loquat]
gb|AJE26131.1|  catalase                                                229   1e-69   Salix matsudana [tortured willow]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      229   1e-69   Prunus mume [ume]
emb|CDP07288.1|  unnamed protein product                                228   1e-69   Coffea canephora [robusta coffee]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               228   2e-69   Gossypium hirsutum [American cotton]
tpg|DAA43178.1|  TPA: catalase2                                         229   2e-69   
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               228   2e-69   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AIA61608.1|  catalase                                                228   2e-69   Gynostemma pentaphyllum [jiaogulan]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 228   2e-69   Populus euphratica
ref|XP_007046520.1|  Catalase 2                                         228   2e-69   Theobroma cacao [chocolate]
gb|ADU56189.1|  catalase 1                                              217   2e-69   Jatropha curcas
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 228   3e-69   Cucumis melo [Oriental melon]
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               227   4e-69   Ricinus communis
emb|CBI29557.3|  unnamed protein product                                217   4e-69   Vitis vinifera
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         227   5e-69   Oryza brachyantha
gb|KJB17474.1|  hypothetical protein B456_003G002800                    226   5e-69   Gossypium raimondii
gb|EPS69543.1|  catalase                                                227   6e-69   Genlisea aurea
gb|ADC95629.1|  catalase                                                226   8e-69   Bruguiera gymnorhiza [Burma mangrove]
gb|ABM47415.1|  catalase                                                226   8e-69   Prunus avium [gean]
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     224   9e-69   Eucalyptus grandis [rose gum]
dbj|BAA34205.1|  catalase                                               226   1e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002301920.1|  catalase family protein                            226   1e-68   Populus trichocarpa [western balsam poplar]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           226   1e-68   
gb|ABK24453.1|  unknown                                                 226   1e-68   Picea sitchensis
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           226   1e-68   Sesamum indicum [beniseed]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    226   1e-68   Gossypium raimondii
emb|CAI43948.1|  catalase                                               226   1e-68   Populus deltoides
gb|ABY21704.1|  catalase-1 precursor                                    226   1e-68   Panax ginseng [Asiatic ginseng]
ref|NP_001048861.1|  Os03g0131200                                       226   1e-68   
gb|ACL35349.1|  catalase                                                226   1e-68   Picea glauca
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             224   1e-68   
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      226   1e-68   Elaeis guineensis
ref|NP_001291326.1|  catalase isozyme 1                                 226   1e-68   Sesamum indicum [beniseed]
gb|KHG12976.1|  Catalase isozyme 2                                      226   1e-68   Gossypium arboreum [tree cotton]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               226   1e-68   Gossypium hirsutum [American cotton]
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             225   1e-68   
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      226   1e-68   Cucumis melo [Oriental melon]
ref|XP_002306976.2|  catalase family protein                            226   2e-68   
gb|AAC19397.1|  leaf catalase                                           225   2e-68   Mesembryanthemum crystallinum
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               225   2e-68   Cucurbita pepo
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      225   2e-68   Populus euphratica
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                225   2e-68   Erythranthe guttata [common monkey flower]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 225   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF19965.1|AF207906_1  catalase 1                                    225   2e-68   Zantedeschia aethiopica [arum-lily]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 225   3e-68   Phoenix dactylifera
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      225   3e-68   Vitis vinifera
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      225   3e-68   Phoenix dactylifera
gb|AFU90823.1|  catalase                                                224   4e-68   Populus x beijingensis
ref|XP_010094556.1|  Catalase isozyme 1                                 225   4e-68   Morus notabilis
gb|AAC84138.1|  catalase                                                215   4e-68   Cichorium intybus [radicchio]
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 223   4e-68   
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             224   5e-68   Populus trichocarpa [western balsam poplar]
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 223   6e-68   
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 224   6e-68   Eucalyptus grandis [rose gum]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      224   7e-68   Nicotiana tomentosiformis
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 224   7e-68   Prunus mume [ume]
emb|CDP07287.1|  unnamed protein product                                224   7e-68   Coffea canephora [robusta coffee]
emb|CAD42909.1|  catalase                                               224   7e-68   Prunus persica
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         224   7e-68   Tarenaya hassleriana [spider flower]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             224   7e-68   Prunus persica
gb|AFU90822.1|  catalase                                                224   7e-68   Populus tomentosa [Chinese white poplar]
ref|XP_002521709.1|  catalase, putative                                 224   7e-68   Ricinus communis
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                224   8e-68   Erythranthe guttata [common monkey flower]
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             224   8e-68   
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      224   8e-68   Nicotiana sylvestris
dbj|BAJ90861.1|  predicted protein                                      224   8e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    224   8e-68   
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      224   9e-68   Eucalyptus grandis [rose gum]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      224   1e-67   Solanum tuberosum [potatoes]
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     223   1e-67   Eucalyptus grandis [rose gum]
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       223   1e-67   Cucumis sativus [cucumbers]
ref|XP_003558892.1|  PREDICTED: catalase-1                              223   1e-67   Brachypodium distachyon [annual false brome]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         223   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      223   2e-67   Phoenix dactylifera
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg             214   2e-67   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      223   2e-67   
gb|ACL27272.1|  catalase                                                223   2e-67   Nicotiana benthamiana
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         223   2e-67   Jatropha curcas
ref|XP_010530333.1|  PREDICTED: catalase-2                              223   2e-67   Tarenaya hassleriana [spider flower]
gb|AAO17721.1|  catalase                                                223   2e-67   Hypericum perforatum
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      223   2e-67   Elaeis guineensis
ref|XP_001752315.1|  predicted protein                                  223   2e-67   
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              223   2e-67   
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          223   3e-67   Amborella trichopoda
gb|ACB11496.1|  catalase                                                223   3e-67   Pinus sylvestris [Scotch pine]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      223   3e-67   Nicotiana sylvestris
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 223   3e-67   Oryza brachyantha
dbj|BAA34714.1|  catalase                                               223   3e-67   Oryza sativa [red rice]
gb|AIS20825.1|  CAT                                                     222   3e-67   Pyrus x bretschneideri [bai li]
emb|CCP37650.1|  catalase-1                                             222   3e-67   Nicotiana tabacum [American tobacco]
gb|AAB71764.1|  catalase 1                                              222   3e-67   Nicotiana tabacum [American tobacco]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 222   4e-67   Solanum tuberosum [potatoes]
ref|XP_001784759.1|  predicted protein                                  222   4e-67   
emb|CDX72514.1|  BnaC07g45360D                                          222   4e-67   
emb|CDX69111.1|  BnaC01g03420D                                          221   5e-67   
dbj|BAH19523.1|  AT4G35090                                              221   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031791.1|  catalase 2                                         221   5e-67   Arabidopsis thaliana [mouse-ear cress]
gb|ACA50528.1|  putative catalase 2                                     222   6e-67   Brassica napus [oilseed rape]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    222   6e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              222   6e-67   Populus euphratica
ref|NP_001058635.1|  Os06g0727200                                       222   6e-67   
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          222   6e-67   
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 221   6e-67   Nicotiana sylvestris
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               221   6e-67   Zea mays [maize]
emb|CAA64220.1|  catalase                                               221   7e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AAX88799.1|  catalase                                                221   7e-67   Euphorbia characias
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 221   7e-67   Nicotiana tomentosiformis
gb|AAD17935.1|  catalase                                                221   7e-67   Brassica juncea [brown mustard]
dbj|BAA34204.1|  catalase                                               221   7e-67   Oryza sativa Japonica Group [Japonica rice]
gb|AAM97542.1|  catalase 3                                              221   7e-67   Capsicum annuum
ref|NP_195235.1|  catalase 2                                            221   7e-67   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30147.1|  catalase                                                221   7e-67   Arabis alpina [alpine rockcress]
gb|ACV92695.1|  catalase                                                221   7e-67   Brassica oleracea
prf||1803522A  catalase                                                 221   7e-67
gb|AFN81243.1|  catalase 1                                              221   7e-67   Brassica rapa subsp. pekinensis [bai cai]
gb|AAK96854.1|  catalase                                                221   7e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061175.1|  PREDICTED: catalase-like                           221   8e-67   Eucalyptus grandis [rose gum]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     223   8e-67   Eucalyptus grandis [rose gum]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             221   8e-67   Capsella rubella
dbj|BAJ33995.1|  unnamed protein product                                221   8e-67   Eutrema halophilum
gb|AAD17933.1|  catalase                                                221   8e-67   Brassica juncea [brown mustard]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             221   8e-67   Eutrema salsugineum [saltwater cress]
ref|XP_009138342.1|  PREDICTED: catalase-2                              221   8e-67   Brassica rapa
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             221   8e-67   
gb|AAF71742.1|AF248491_1  catalase                                      221   8e-67   Raphanus sativus
emb|CDY40645.1|  BnaA03g53180D                                          221   8e-67   Brassica napus [oilseed rape]
gb|AIU99479.1|  catalase                                                221   8e-67   Saccharum arundinaceum
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               221   9e-67   Zea mays [maize]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             222   9e-67   Eutrema salsugineum [saltwater cress]
gb|AIU99487.1|  catalase                                                221   9e-67   Saccharum hybrid cultivar ROC22
gb|AIU99480.1|  catalase                                                221   9e-67   Saccharum spontaneum [fodder cane]
ref|NP_001241808.1|  catalase isozyme B                                 221   9e-67   Zea mays [maize]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      221   9e-67   Solanum lycopersicum
gb|AIU99488.1|  catalase                                                221   9e-67   Saccharum hybrid cultivar ROC22
emb|CAA42720.1|  catalase-1                                             221   1e-66   Zea mays [maize]
gb|AIZ77475.1|  catalase                                                221   1e-66   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001105415.1|  catalase isozyme 1                                 221   1e-66   
gb|AIM43584.1|  catalase                                                221   1e-66   Saccharum hybrid cultivar Yacheng05-179
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             221   1e-66   Eutrema salsugineum [saltwater cress]
gb|AIU99486.1|  catalase                                                221   2e-66   Saccharum spontaneum [fodder cane]
ref|XP_009106100.1|  PREDICTED: catalase-2                              221   2e-66   Brassica rapa
gb|AHA50082.1|  catalase                                                220   2e-66   Eleutherococcus senticosus
gb|AAF61732.1|AF243517_1  catalase 2                                    220   2e-66   Helianthus annuus
gb|AFU48609.1|  catalase 1                                              220   2e-66   Nicotiana benthamiana
ref|NP_001105310.1|  catalase isozyme 2                                 220   2e-66   
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         220   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010437527.1|  PREDICTED: catalase-2                              220   2e-66   Camelina sativa [gold-of-pleasure]
ref|NP_001234186.1|  catalase isozyme 2                                 220   2e-66   
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         220   2e-66   Camelina sativa [gold-of-pleasure]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       220   3e-66   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 220   3e-66   Elaeis guineensis
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    220   3e-66   Arabis alpina [alpine rockcress]
gb|AIU99481.1|  catalase                                                219   3e-66   Saccharum spontaneum [fodder cane]
emb|CAG23920.1|  catalase                                               219   3e-66   Festuca arundinacea [tall fescue]
gb|ADU56199.1|  catalase                                                219   3e-66   Hevea brasiliensis [jebe]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          219   4e-66   Helianthus annuus
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      219   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|AII23739.1|  catalase                                                219   5e-66   Zostera marina
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      219   5e-66   Nicotiana tomentosiformis
gb|AIX10947.1|  putative catalase                                       219   6e-66   Gardenia jasminoides
emb|CDP01803.1|  unnamed protein product                                219   7e-66   Coffea canephora [robusta coffee]
gb|AAD17936.1|  catalase                                                219   7e-66   Brassica juncea [brown mustard]
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 220   8e-66   
ref|XP_009103333.1|  PREDICTED: catalase-1                              219   8e-66   Brassica rapa
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      219   8e-66   Citrus sinensis [apfelsine]
emb|CDY01363.1|  BnaA07g11360D                                          219   9e-66   
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             219   9e-66   Citrus clementina [clementine]
emb|CDY31877.1|  BnaC07g15270D                                          219   9e-66   Brassica napus [oilseed rape]
dbj|BAA05494.1|  catalase                                               219   9e-66   Oryza sativa Japonica Group [Japonica rice]
gb|AAY59707.1|  catalase                                                218   1e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      218   1e-65   Brachypodium distachyon [annual false brome]
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              219   1e-65   Brassica rapa
gb|ACH63223.1|  catalase                                                218   1e-65   Rheum australe [Himalayan rhubarb]
gb|AAF61734.1|AF243519_1  catalase 4                                    218   1e-65   Helianthus annuus
gb|AAC39465.1|  catalase 3                                              206   1e-65   Arabidopsis thaliana [mouse-ear cress]
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       216   2e-65   Cucumis sativus [cucumbers]
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             218   2e-65   
gb|AIU99482.1|  catalase                                                218   2e-65   Saccharum hybrid cultivar ROC22
prf||1906388A  catalase                                                 218   2e-65
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              217   2e-65   
gb|AAK67359.2|AF390210_1  catalase                                      218   2e-65   Suaeda salsa
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              218   2e-65   
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 224   2e-65   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             218   2e-65   Selaginella moellendorffii
ref|XP_010692546.1|  PREDICTED: catalase                                218   2e-65   Beta vulgaris subsp. vulgaris [field beet]
prf||2104177A  catalase                                                 218   2e-65
gb|AIU99485.1|  catalase                                                217   3e-65   Saccharum spontaneum [fodder cane]
gb|AHB72694.1|  catalase                                                217   3e-65   Beta vulgaris subsp. maritima [sea beet]
gb|AHF21552.1|  catalase                                                217   3e-65   Hylocereus undatus [dragon fruit]
gb|AIU99483.1|  catalase                                                217   4e-65   Saccharum hybrid cultivar ROC22
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             217   4e-65   
gb|AGI65617.1|  catalase                                                216   4e-65   Fragaria x ananassa
gb|ACJ22771.1|  catalase 1                                              216   5e-65   Jatropha curcas
gb|AIU99484.1|  catalase                                                216   6e-65   Saccharum arundinaceum
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         216   8e-65   Setaria italica
gb|AAG43363.1|AF151368_1  catalase                                      216   9e-65   Hevea brasiliensis [jebe]
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         216   1e-64   Triticum aestivum [Canadian hard winter wheat]
gb|AIP93616.1|  CAT1                                                    216   1e-64   Bassia scoparia [burning bush]
emb|CAA45564.1|  catalase                                               216   1e-64   Arabidopsis thaliana [mouse-ear cress]
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               216   1e-64   Hordeum vulgare [barley]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 215   2e-64   Vitis vinifera
ref|NP_001268098.1|  catalase                                           215   2e-64   Vitis vinifera
gb|AAB86582.2|  catalase                                                215   2e-64   Raphanus sativus
gb|AAP80622.1|AF475100_1  catalase isozyme                              208   2e-64   Triticum aestivum [Canadian hard winter wheat]
gb|AAF61733.1|AF243518_1  catalase 3                                    215   3e-64   Helianthus annuus
gb|ABK41476.1|  catalase                                                215   3e-64   Haematococcus lacustris
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         214   4e-64   Camelina sativa [gold-of-pleasure]
dbj|BAC79443.1|  catalase                                               214   5e-64   Acacia ampliceps
ref|XP_010477308.1|  PREDICTED: catalase-1                              214   5e-64   Camelina sativa [gold-of-pleasure]
gb|AAC17731.1|  catalase 1                                              214   6e-64   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564121.1|  catalase 1                                            214   6e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             214   6e-64   
gb|AAB70006.1|  catalase                                                214   8e-64   Chlamydomonas reinhardtii
ref|XP_001696763.1|  catalase/peroxidase                                213   1e-63   Chlamydomonas reinhardtii
gb|AAD50974.1|AF170272_1  catalase CAT1                                 213   1e-63   Manihot esculenta [manioc]
gb|AAB62892.1|  catalase-1                                              213   1e-63   Nicotiana glutinosa
gb|EMS61345.1|  Catalase isozyme 1                                      215   2e-63   Triticum urartu
dbj|BAJ88747.1|  predicted protein                                      213   3e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK24543.1|  unknown                                                 212   4e-63   Picea sitchensis
ref|XP_002950455.1|  catalase                                           212   4e-63   Volvox carteri f. nagariensis
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          211   5e-63   Amborella trichopoda
ref|XP_011396830.1|  Catalase isozyme 2                                 211   5e-63   Auxenochlorella protothecoides
gb|AAB07026.1|  catalase 1                                              211   5e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         211   6e-63   Camelina sativa [gold-of-pleasure]
emb|CDX76313.1|  BnaA08g10870D                                          211   6e-63   
emb|CDY17510.1|  BnaC03g65530D                                          211   7e-63   Brassica napus [oilseed rape]
ref|XP_002510677.1|  catalase, putative                                 217   8e-63   
gb|ADN94253.1|  catalase                                                211   8e-63   Puccinellia chinampoensis
gb|ACL81498.1|  catalase                                                211   8e-63   Ginkgo biloba [ginkgo]
ref|XP_005645077.1|  catalase                                           211   9e-63   Coccomyxa subellipsoidea C-169
emb|CAE82295.1|  catalase                                               211   1e-62   Homogyne alpina
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              211   1e-62   Populus euphratica
emb|CDY52649.1|  BnaAnng11640D                                          209   1e-62   Brassica napus [oilseed rape]
gb|ABK24449.1|  unknown                                                 210   2e-62   Picea sitchensis
emb|CDY29518.1|  BnaA06g14520D                                          210   2e-62   Brassica napus [oilseed rape]
ref|XP_009149540.1|  PREDICTED: catalase-1                              210   2e-62   Brassica rapa
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          210   2e-62   Ipomoea batatas [batate]
emb|CDY31490.1|  BnaC05g15990D                                          210   2e-62   Brassica napus [oilseed rape]
emb|CAA73663.1|  catalase                                               209   3e-62   Chlamydomonas reinhardtii
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 209   6e-62   Tarenaya hassleriana [spider flower]
gb|ADB03784.1|  catalase                                                209   6e-62   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              208   7e-62   
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               208   8e-62   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               208   9e-62   
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      208   1e-61   
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         207   1e-61   
gb|AEB22071.1|  catalase 2                                              196   3e-61   
gb|AHF27433.1|  catalase                                                207   3e-61   
gb|AAM97541.1|  catalase 2                                              206   3e-61   
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             204   4e-61   
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     206   6e-61   
gb|AHF27430.1|  catalase                                                206   8e-61   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      206   9e-61   
ref|NP_973873.1|  catalase 3                                            204   1e-60   
gb|AFR53082.1|  CAT                                                     205   1e-60   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 205   1e-60   
emb|CDY29519.1|  BnaA06g14510D                                          205   2e-60   
ref|XP_009149539.1|  PREDICTED: catalase-3                              206   2e-60   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    204   2e-60   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             204   2e-60   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               204   3e-60   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               204   3e-60   
emb|CDY01364.1|  BnaA07g11370D                                          205   3e-60   
gb|AAD30291.2|AF139538_1  catalase 2                                    204   3e-60   
gb|AAM65021.1|  unknown                                                 204   4e-60   
ref|NP_564120.1|  catalase 3                                            204   4e-60   
gb|AAD30292.1|AF139539_1  catalase 3                                    204   4e-60   
emb|CDY33636.1|  BnaC08g19360D                                          204   4e-60   
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         204   4e-60   
ref|NP_001031073.1|  catalase 3                                         204   4e-60   
dbj|BAH56915.1|  AT1G20620                                              204   4e-60   
ref|XP_009110221.1|  PREDICTED: catalase-3                              204   4e-60   
emb|CDY31878.1|  BnaC07g15280D                                          204   4e-60   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    203   5e-60   
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      203   5e-60   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      203   6e-60   
gb|AAC19398.1|  root catalase                                           203   6e-60   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          203   7e-60   
ref|XP_009362858.1|  PREDICTED: catalase-4-like                         192   8e-60   
gb|ABV55108.1|  catalase 2                                              203   9e-60   
gb|ADM96039.1|  catalase                                                203   9e-60   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               203   9e-60   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          203   9e-60
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      202   1e-59   
ref|NP_001274863.1|  catalase isozyme 1                                 202   1e-59   
gb|ACJ76836.3|  catalase                                                202   1e-59   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               202   1e-59   
ref|NP_001234827.1|  catalase isozyme 1                                 202   1e-59   
gb|ADQ28492.1|  catalase                                                202   1e-59   
dbj|BAF91369.1|  catalase                                               202   1e-59   
gb|ABB88582.1|  catalase                                                202   2e-59   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             201   2e-59   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 201   2e-59   
ref|XP_010692544.1|  PREDICTED: catalase-like                           201   3e-59   
gb|ABC01913.1|  catalase isozyme 1-like protein                         201   3e-59   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      201   4e-59   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    201   4e-59   
gb|EMT05040.1|  Catalase-1                                              202   4e-59   
gb|AAC49807.1|  catalase 3                                              201   4e-59   
gb|ABB51561.1|  truncated catalase 2                                    199   5e-59   
gb|AAC48918.1|  salicylic acid binding catalase                         201   5e-59   
gb|AAR97905.1|  catalase                                                201   5e-59   
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      201   6e-59   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             201   6e-59   
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               200   8e-59   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      200   8e-59   
emb|CAA85470.1|  catalase                                               200   8e-59   
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      199   2e-58   
gb|ADU56198.1|  catalase                                                199   2e-58   
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          199   2e-58   
gb|AAF79625.1|AC027665_26  F5M15.5                                      205   2e-58   
ref|XP_010498496.1|  PREDICTED: catalase-3                              199   3e-58   
gb|ABB72796.1|  catalase isozyme 1-like protein                         198   7e-58   
ref|XP_002890395.1|  F5M15.5                                            203   9e-58   
ref|XP_001779509.1|  predicted protein                                  195   8e-57   
gb|AAR14052.2|  catalase                                                194   1e-56   
gb|AAG61140.2|AF332973_1  catalase 2                                    194   2e-56   
emb|CDY31488.1|  BnaC05g15970D                                          193   4e-56   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    193   7e-56   
dbj|BAQ21275.1|  catalase                                               192   7e-56   
gb|AEQ30070.1|  catalase                                                192   1e-55   
gb|KDD77132.1|  catalase                                                192   1e-55   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      191   2e-55   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               191   4e-55   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           190   5e-55
gb|ABN71233.2|  catalase                                                190   5e-55   
ref|NP_001045673.1|  Os02g0115700                                       190   5e-55   
gb|AHZ13843.1|  catalase                                                190   6e-55   
gb|AFW66787.1|  catalase3                                               190   6e-55   
gb|AGT16310.1|  catalase                                                190   7e-55   
gb|AFW66788.1|  catalase3                                               189   1e-54   
emb|CAH61266.1|  catalase                                               188   3e-54   
dbj|BAJ92414.1|  predicted protein                                      188   3e-54   
gb|ADY02963.1|  catalase                                                188   3e-54   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               188   3e-54   
gb|AFW66785.1|  catalase3 isoform 1                                     191   5e-54   
emb|CAA43814.1|  catalase                                               187   7e-54   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      187   1e-53   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      187   2e-53   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                182   4e-52   
gb|AGT16203.1|  catalase                                                182   4e-52   
gb|AGT16054.1|  catalase                                                182   4e-52   
gb|AGT16188.1|  catalase                                                182   4e-52   
gb|AJF34884.1|  catalase                                                182   5e-52   
gb|EMS51034.1|  Catalase isozyme 2                                      182   6e-52   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          182   8e-52   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 182   8e-52   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   183   1e-51   
gb|AGT15888.1|  catalase                                                181   2e-51   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        180   4e-51   
ref|NP_001105416.1|  catalase isozyme 3                                 180   5e-51   
gb|EMT06167.1|  Catalase isozyme 2                                      181   1e-50   
ref|XP_005708279.1|  catalase                                           172   3e-48   
gb|KHG11966.1|  Catalase isozyme 2                                      160   5e-45   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          163   9e-45   
gb|AAZ29552.1|  catalase-C                                              160   7e-44   
gb|KHG21219.1|  Catalase isozyme 1                                      159   9e-44   
ref|XP_005536240.1|  catalase                                           160   1e-43   
gb|AHG98056.1|  catalase                                                154   5e-43   
gb|ADI58890.1|  catalase                                                150   8e-43   
gb|AHF27429.1|  catalase                                                154   2e-41   
gb|AHF27432.1|  catalase                                                154   2e-41   
gb|ADR01107.1|  catalase 3                                              151   5e-41   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          152   6e-41   
dbj|BAH20307.1|  AT1G20620                                              151   1e-40   
ref|XP_011022275.1|  PREDICTED: catalase-like                           151   2e-40   
gb|ABR16304.1|  unknown                                                 148   2e-39   
ref|XP_005647994.1|  catalase-domain-containing protein                 142   4e-37   
ref|XP_005642928.1|  catalase                                           141   1e-36   
ref|XP_005644653.1|  catalase-domain-containing protein                 139   7e-36   
gb|AIM05077.1|  catalase                                                132   1e-35   
ref|XP_005712277.1|  unnamed protein product                            137   3e-35   
ref|WP_016090862.1|  catalase                                           130   5e-35   
ref|XP_006380544.1|  hypothetical protein POPTR_0007s08910g             132   9e-35   
ref|WP_034700019.1|  catalase                                           135   1e-34   
ref|WP_036667842.1|  catalase                                           134   4e-34   
ref|WP_011983963.1|  catalase                                           134   4e-34   
gb|AAS40190.1|  catalase                                                133   6e-34   
ref|WP_001069175.1|  catalase                                           133   7e-34   
ref|WP_043068684.1|  catalase                                           133   7e-34   
ref|WP_001069190.1|  catalase                                           133   7e-34   
ref|WP_036612802.1|  catalase                                           133   7e-34   
ref|WP_018976489.1|  catalase                                           133   7e-34   
ref|WP_001069174.1|  catalase                                           133   7e-34   
ref|WP_001069173.1|  catalase                                           133   7e-34   
ref|WP_002202803.1|  catalase                                           133   7e-34   
ref|WP_016122096.1|  catalase                                           133   7e-34   
ref|WP_001069182.1|  MULTISPECIES: catalase                             133   7e-34   
ref|WP_001069191.1|  catalase                                           133   7e-34   
ref|WP_002201400.1|  catalase                                           133   7e-34   
ref|WP_002194469.1|  catalase                                           133   7e-34   
ref|WP_016104158.1|  catalase                                           133   7e-34   
ref|WP_001069183.1|  catalase                                           133   7e-34   
ref|WP_044741157.1|  catalase                                           133   8e-34   
ref|WP_017673056.1|  catalase                                           133   8e-34   
ref|WP_001069184.1|  MULTISPECIES: catalase                             133   8e-34   
ref|WP_002170801.1|  MULTISPECIES: catalase                             133   8e-34   
ref|WP_000184219.1|  catalase                                           133   8e-34   
ref|WP_001069170.1|  catalase                                           133   8e-34   
ref|WP_001069185.1|  catalase                                           133   8e-34   
ref|WP_006679508.1|  catalase                                           133   8e-34   
ref|WP_016088914.1|  catalase                                           133   8e-34   
ref|WP_001069187.1|  catalase                                           133   8e-34   
ref|WP_001069172.1|  catalase                                           133   8e-34   
ref|WP_000184218.1|  catalase                                           133   8e-34   
ref|WP_001069171.1|  catalase                                           133   8e-34   
ref|WP_001069186.1|  catalase                                           133   8e-34   
ref|WP_002125906.1|  MULTISPECIES: catalase                             133   8e-34   
ref|WP_001069189.1|  catalase                                           133   8e-34   
ref|WP_001069169.1|  MULTISPECIES: catalase                             133   8e-34   
ref|WP_001069179.1|  MULTISPECIES: catalase                             133   8e-34   
ref|WP_033673856.1|  catalase                                           133   8e-34   
ref|WP_002134937.1|  catalase                                           133   8e-34   
ref|WP_002011249.1|  catalase                                           133   8e-34   
ref|WP_044437756.1|  catalase                                           133   9e-34   
ref|WP_016101561.1|  catalase                                           133   9e-34   
ref|WP_016119811.1|  catalase                                           133   9e-34   
ref|WP_002188737.1|  catalase                                           133   9e-34   
ref|WP_002149880.1|  catalase                                           133   9e-34   
ref|WP_001069177.1|  MULTISPECIES: catalase                             133   9e-34   
ref|WP_002140813.1|  MULTISPECIES: catalase                             132   9e-34   
ref|WP_002030287.1|  MULTISPECIES: catalase                             132   9e-34   
ref|WP_035435964.1|  catalase                                           132   9e-34   
ref|WP_002087018.1|  catalase                                           132   9e-34   
ref|WP_043936623.1|  MULTISPECIES: catalase                             132   9e-34   
ref|WP_001069176.1|  MULTISPECIES: catalase                             132   1e-33   
ref|WP_002978792.1|  catalase                                           132   1e-33   
ref|WP_009590324.1|  catalase                                           132   1e-33   
ref|WP_024632816.1|  MULTISPECIES: catalase                             132   1e-33   
ref|WP_016093086.1|  catalase                                           132   1e-33   
ref|WP_001069188.1|  catalase                                           132   1e-33   
ref|WP_015737807.1|  catalase                                           132   1e-33   
ref|WP_043072359.1|  catalase                                           132   1e-33   
ref|WP_002186432.1|  MULTISPECIES: catalase                             132   1e-33   
ref|WP_001069178.1|  catalase                                           132   1e-33   
ref|WP_042982436.1|  catalase                                           132   1e-33   
ref|WP_016103618.1|  catalase                                           132   1e-33   
ref|WP_002168907.1|  catalase                                           132   1e-33   
ref|WP_036662024.1|  catalase                                           132   1e-33   
ref|WP_001069154.1|  MULTISPECIES: catalase                             132   1e-33   
ref|WP_001069158.1|  MULTISPECIES: catalase                             132   1e-33   
ref|WP_001069155.1|  catalase                                           132   1e-33   
ref|WP_001069198.1|  catalase                                           132   1e-33   
ref|WP_028402967.1|  catalase                                           132   1e-33   
ref|WP_001069157.1|  MULTISPECIES: catalase                             132   1e-33   
ref|WP_002114641.1|  catalase                                           132   1e-33   
ref|WP_001069156.1|  catalase                                           132   1e-33   
ref|WP_001069159.1|  catalase                                           132   1e-33   
ref|WP_044306649.1|  catalase                                           132   1e-33   
ref|WP_001069152.1|  catalase                                           132   1e-33   
ref|WP_001069153.1|  catalase                                           132   1e-33   
ref|WP_002162341.1|  catalase                                           132   1e-33   
dbj|GAE06714.1|  catalase                                               129   1e-33   
ref|WP_001069193.1|  catalase                                           132   1e-33   
ref|WP_026975362.1|  catalase                                           132   1e-33   
ref|WP_044792704.1|  catalase                                           132   1e-33   
ref|WP_002130360.1|  catalase                                           132   1e-33   
ref|WP_001069160.1|  catalase                                           132   1e-33   
ref|WP_020060313.1|  catalase                                           132   1e-33   
ref|WP_002116977.1|  catalase                                           132   1e-33   
ref|WP_030023914.1|  catalase                                           132   2e-33   



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/114 (98%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/114 (98%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAP+WNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSA++SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/114 (98%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPS+AF SPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPVWNNN+SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   232 bits (592),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPVWNNN+SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   232 bits (591),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPVWNNN+SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   232 bits (591),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVI+RFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVILRFSTVIHERGSPE  114



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   232 bits (591),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   230 bits (587),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFW+TNSGAPVWNNNSSLTVGTRGPI+LEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNN+S+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTP+I+RFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPE  114



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSA++SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA+ SPFWTTNSGAPVWNNNSSLT+G RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISH+TCADFLRAPGVQTPVI+RFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHVTCADFLRAPGVQTPVILRFSTVIHERGSPE  114



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPV+NNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFW+TNSGAPVWNNNSSLTVGTRGPI+LEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAP+WNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAP+WNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAP+WNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPV+NNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNN+S+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTP+I+RFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPE  114



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   230 bits (586),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHL CADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLXCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   230 bits (586),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SP+WTTNSGAP+WNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   229 bits (585),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   229 bits (585),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPS+AF+SPFWTTNSGAP+WNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   229 bits (585),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+R SSAF++PFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF++P+WTTNSGAPVWNN+SSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   229 bits (584),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTN+GAPVWNNNSSLTVG+RGP+LLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   226 bits (576),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS+F+ P W+TNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTN+GAPVWNNNSSLTVG+RGP+LLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAFS+P+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKHRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTT+SGAPVW+NNSSLTVGTRGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTSSGAPVWDNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SPFWTTNSGAPVWNNNSSLTVG RG  LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF++P+WTTNSGAPVWNN+SSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA +SPFWTTNSGAPVWNNNSS+TVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAFS+P+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPV+NNNSSL+VG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ADU56189.1| catalase 1 [Jatropha curcas]
Length=152

 Score =   217 bits (553),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKH PSSA ++PFWTTN+GAPVWNNNSS+TVG RGPILLEDYH++EKLANFDRERIP
Sbjct  1    MDPYKHCPSSAHNTPFWTTNAGAPVWNNNSSMTVGQRGPILLEDYHMLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARG SAKGFFEVTH+IS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGMSAKGFFEVTHEISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA+++PFWTTNSGAPVWNNNS+LT+G+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   227 bits (579),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY++RPSS F++PFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>emb|CBI29557.3| unnamed protein product [Vitis vinifera]
 emb|CBI37654.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   217 bits (552),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SP++TTN+GAPV+NN+SSLTVG+RGP+LLEDYHLVEKLANF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+S LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   227 bits (579),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS+F+ P W+TNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSS+F SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   227 bits (578),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPFWTTNSGAPVWNNN SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLT ADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTSADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   226 bits (577),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPFWT NSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   226 bits (577),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF +PFWTTNSGAPVWNN+SSLTVG+RGP+LLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFDTPFWTTNSGAPVWNNDSSLTVGSRGPVLLEDYHLVEKLATFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KCW68093.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=399

 Score =   224 bits (570),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA+ S FWTTN GAPVWNN+SSLTVGTRGPILLEDYHL+EKLANF+RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS+F+ P W+TNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF +P+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPS AF+SPF TTNSGAPVWNNN SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSA++SPFWTTNSGAPVWNNNSSLT+G+RGPILLEDYHLVEK+A FDRER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCAD LRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPE  114



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPS AF+SPF TTNSGAPVWNNN SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSS+F SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF +P+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSSAF+S +WTTNSGAPVWNNNSSLTVGTRGPILLEDY LVEK+ANFDRERIP
Sbjct  1    MDPYQHRPSSAFNSSYWTTNSGAPVWNNNSSLTVGTRGPILLEDYQLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS+F+ P W+TNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSA++SPFWTTNSGAPVWNNNSSLT+G+RGPILLEDYHLVEK+A FDRER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCAD LRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPE  114



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVT+DISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYH++EKLA FDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSS+F SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSS+F SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVT+DISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSS +++PFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SP+WTTNSGA VWNNNSSLTVG+RGPILLEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+L+CADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SP++TTNSGAPV+NNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSSAF++PFWTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYRHRPSSAFNAPFWTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI++L+CADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+SP+WTTNSGA VWNNNSSLTVG+RGPILLEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+L+CADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPVWNNN+SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS ++SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPE  114



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSAF+SPFWTTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYH++EKLA FDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVT+D+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTNDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFE THDIS+LTCADFLRAPGVQTPVI+RFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQTPVILRFSTVIHERGSPE  114



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA +SPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYH++EKLA FDRERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +3

Query  72   DPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPE  251
            DPYK+RPSSAF +P+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  252  RVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            RVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  113



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAC84138.1| catalase [Cichorium intybus]
Length=182

 Score =   215 bits (548),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA++SPFWTTN+G PV+NN +SLTVG RGPILLEDYHL+EKLANF RERIP
Sbjct  1    MDPYKQRPSSAYNSPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ER+VHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP IVRFSTVIHERGSPE
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPE  114



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTN+GAPV NNNSSLTVG RGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVT+DISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   223 bits (569),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTN+GAPV NNNSSLTVG RGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   224 bits (571),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA+ S FWTTN GAPVWNN+SSLTVGTRGPILLEDYHL+EKLANF+RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLIEKLANFERERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   224 bits (571),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA +SPF TTNSGAPVWNNNSS+TVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   224 bits (571),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF SP+WTTN+GAPVWNN+SSLTVG RGP+LLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   224 bits (571),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDP K+RPSSAF+SPFWTTNSGA VWNNNSSLTVGTRGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   224 bits (571),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF SP+WTTN+GAPVWNN+SSLTVG RGP+LLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   224 bits (571),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA SSPF+TTNSGAPVWNNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHER SPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERASPE  114



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   224 bits (571),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF SP+WTTN+GAPVWNN+SSLTVG RGP+LLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   224 bits (570),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +3

Query  72   DPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPE  251
            DPYK+RPSSAF +P+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  252  RVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            RVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  113



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   224 bits (571),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA++SPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTH+ISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHNISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   224 bits (571),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPVWNNN+SLTVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLR PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRGPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVT+DISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA +SPF TTNSGAPVWNNNSS+TVGTRGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS+F+SP W+TNSGAPVWNN++SLTVG+RGPILLEDYHLVEK+A+FDRERIP
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDP+K+RPSSAF++ FWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   224 bits (570),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA+ S FWTTN GAPVWNN+SSLTVGTRGPILLEDYHL+EKLANF+RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPVWNNNSSLTVG RGP+LLEDYHLVEKLANFDRERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDP+K+RPSSAF++ FWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSS +++PFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI++L+CADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS+F+ P W+TNSGAPVWNN++SLTVG RGPILLEDYHLVEK+ANFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPMWSTNSGAPVWNNDNSLTVGPRGPILLEDYHLVEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLR PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRGPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  ++PFWTTNSGAPVWNNNSSLTVG+RGP+ LEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPE  114



>ref|XP_006306503.1| hypothetical protein CARUB_v10012491mg [Capsella rubella]
 gb|EOA39401.1| hypothetical protein CARUB_v10012491mg [Capsella rubella]
Length=201

 Score =   214 bits (546),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLTVGTRGPILLEDYHL+EK+ANFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+ LT ADFLR PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010061173.1| PREDICTED: catalase isozyme 2-like isoform X1 [Eucalyptus grandis]
Length=496

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA+ S FWTTN GAPVWNN+SSLTVGTRGPILLEDYHL+EKLANF+RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPV+NNNSSLTVG RGPILLEDYHLVEKLANFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA +SPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+ +SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPV++N+ SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSS  ++PFWTTNSGAPVWNNNSSLTVG+RGPILLEDYH++EKLA FDRERIP
Sbjct  1    MDPYRHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHVIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS + +PFWTTN GAPVWNNN+SLTVG RGP+LLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/110 (96%), Positives = 110/110 (100%), Gaps = 0/110 (0%)
 Frame = +3

Query  81   KHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERVV  260
            +HRPSSAF+SPFWTTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIPERVV
Sbjct  6    QHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  65

Query  261  HARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            HARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  66   HARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  115



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA + PF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SPFWTTN+GAPVWNNNSSLT+G+RGPILLEDYHLVEK+A FDRER+P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRA GVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAAGVQTPLIVRFSTVIHERGSPE  114



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPV+NNNSSLTVG RGP+LLEDYHLVEKLANFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSA +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSASNSSFWTTNSGAPVWNNNSALTVGHRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSS+F+ P W+TNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKGRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPFWTTNSGAPV NNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHL+CADFLRAPGVQTPVIVRFSTVIHE GSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHEHGSPE  114



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPV+NNNSSLTVG RGP+LLEDYHLVEKLANFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPV+NNNSSLTVG RGP+LLEDYHLVEKLANFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA +SPF TTNSGAPV+NNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS +++PFWTTN G+PVWNNN+SLTVG RGP+LLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVT+DISHLTCADFLRAPGVQTPVIVRFSTVIHE GSPE
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPE  114



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPVWNNNSSLTVGTRGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLR+PGVQTPVIVRFSTV +ERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVTNERGSPE  114



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 1/114 (1%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF++P+WTTNSGAPVWNN+SSLTVG RGPILLEDYH  EKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  113



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA++S F+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFF+VTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFQVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPVWNNNSSLTVGTRGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLR+PGVQTPVIVRFSTV +ERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVTNERGSPE  114



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSA +SP+WTTNSGAPV+NNNSSLTVG RGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKHRPSSAANSPYWTTNSGAPVYNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITRLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>prf||1803522A catalase
Length=491

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 1/114 (1%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF++P+WTTNSGAPVWNN+SSLTVG RGPILLEDYH  EKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  113



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA  S FWTTNSGAPVWNNN+SLTVGTRGP+LLEDYHL+EK+ANFDRERIP
Sbjct  1    MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +3

Query  45   LLSHLSSSMDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLA  224
            ++S   ++MDPYK+RPSSA  S FWTTNSGAPVWNNN+SLTVGTRGP+LLEDYHL+EK+A
Sbjct  85   VVSRPPTAMDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIA  144

Query  225  NFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGS  404
            NFDRERIPERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGS
Sbjct  145  NFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGS  204

Query  405  PE  410
            PE
Sbjct  205  PE  206



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   221 bits (563),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>sp|P18122.1|CATA1_MAIZE RecName: Full=Catalase isozyme 1 [Zea mays]
Length=492

 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   222 bits (565),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   221 bits (563),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   221 bits (563),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   221 bits (563),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   221 bits (563),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA +SPF TTNSGAPV+NNNSSLTVGTRGPILLEDYHL+EK+ANFDRERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   221 bits (563),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+F++P W+TNSGAPVWNN++SLTVG+RGPILLEDYHLVEK+A+FDRERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|NP_001105415.1| catalase isozyme 1 [Zea mays]
 emb|CAA31056.1| unnamed protein product [Zea mays]
Length=492

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSSA  SPF+TTNSGAPVWNNNSSL+VGTRGPILLEDYHL+EK+ANFDRERIP
Sbjct  1    MDPYRHRPSSAHDSPFFTTNSGAPVWNNNSSLSVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLR PGVQTPVI RFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIARFSTVIHERGSPE  114



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SP+WTTNSGAP WNNNSSLTVGTRGPILLEDY LVE +ANFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPAWNNNSSLTVGTRGPILLEDYQLVEIIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFS VIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISKLTCADFLRAPGVQTPVIVRFSIVIHERGSPE  114



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA+++PFWTTN GAPV+NN+SSLTVGTRGPILLEDYH VEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAYNAPFWTTNYGAPVYNNDSSLTVGTRGPILLEDYHFVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISALTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +3

Query  72   DPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPE  251
            DPYK+RPSSAF+SPF TTNSGAPV+NNNSSLTVG RGPILLEDYHLVEKLANFDRER+PE
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVPE  60

Query  252  RVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            RVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  113



>ref|NP_001105310.1| catalase isozyme 2 [Zea mays]
 gb|AAA33440.1| catalase [Zea mays]
Length=491

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 110/114 (96%), Gaps = 1/114 (1%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSSAF+ P+WTTNSGAPVWNN+SSLTVG RGPILLEDYH  EKLANFDRERIP
Sbjct  1    MDPYKHRPSSAFNPPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  113



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+SPF TTNSGAPV+NNNSSLTVG RGP+LLEDYHLVEKLANFDRERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+F++P W+TNSGAPVWNN++SLTVG+RGPILLEDYHLVEK+A+FDRERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGA+AKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA +SPFWTTNSGAPVWNNNSSLTVG RGPILLEDYH++EKLA FDRERIP
Sbjct  1    MDPYKFRPSSANNSPFWTTNSGAPVWNNNSSLTVGNRGPILLEDYHVIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFL APGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLHAPGVQTPVIVRFSTVIHERGSPE  114



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLTVGTRGPILLEDYHL+EK+ANFDRERIP
Sbjct  1    MDPYRFRPSSANDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLR PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPE  114



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQ PVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQAPVIVRFSTVVHERGSPE  114



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS+F+ P W+TNSGAPVWNN++SLTVG+RGPILLEDYHLVEK+A+FDRERIP
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA +S F+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGAS+KGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASSKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+R SSA+++PFWTTNSGAPV+NNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSS ++SPFWTTNSGAPVWNNN+S+TVG+RGPILLEDYHLVEK+A FDRERIP
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLVEKIAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+S LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSRLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AII23739.1| catalase [Zostera marina]
Length=477

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDP K RPSS F+SP+WTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EK+A FDRERIP
Sbjct  1    MDPTKFRPSSDFNSPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKIAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAP VQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPAVQTPVIVRFSTVIHERGSPE  114



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSAF+S F TTNSGAPV+NNNSSLTVG RGP+LLEDYHLVEKLANFDRER+P
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   219 bits (558),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSAF++PFWTTN+G PVWNN+S+LTVGTRGPILLEDYHLVEKLAN+ RERIP
Sbjct  1    MDPYKFRPSSAFNTPFWTTNAGGPVWNNDSALTVGTRGPILLEDYHLVEKLANWTRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   219 bits (557),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA++S F+TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLR PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRTPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   219 bits (557),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTN GAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_004966515.1| PREDICTED: catalase isozyme 1-like [Setaria italica]
Length=547

 Score =   220 bits (560),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +3

Query  66   SMDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERI  245
            +MDPY+HRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERI
Sbjct  55   AMDPYRHRPSSGNNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERI  114

Query  246  PERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            PERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  115  PERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  169



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   219 bits (557),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLT GTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLR PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   219 bits (557),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RP+S+F++PF+TTNSGAPVWNNNSS+T+G RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+S+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLT GTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLR PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RP+S+F++PF+TTNSGAPVWNNNSS+T+G RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+S+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLT GTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLR PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPE  114



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHR SS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRASSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGS E
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSSE  114



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  ++ FW+TNSGAPVWNNN++LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGANAGFWSTNSGAPVWNNNNALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+T NSGAPVWNNNS +TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA  SP+WTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEK+ NFDRERIP
Sbjct  1    MDPYKFRPSSAHDSPYWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKIVNFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAK FFEVTHD+SHLTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKVFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA+ +PFWTTN+GAPV+NN +SLTVG RGPILLEDYHL+EKLANF RERIP
Sbjct  1    MDPYKQRPSSAYDTPFWTTNAGAPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ER+VHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAC39465.1| catalase 3 [Arabidopsis thaliana]
Length=115

 Score =   206 bits (525),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA+++PF+TTN GAPV NN SSLT+G RGP+LLEDYHL+EK+ANF RERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARG SAKGFFEVTHDIS+LTCADF+RAPGVQTPVIVRFSTV+HER SPE
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFVRAPGVQTPVIVRFSTVVHERASPE  114



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 108/112 (96%), Gaps = 1/112 (1%)
 Frame = +3

Query  78   YKH-RPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPER  254
            Y H RPSSAF +PFWTTNSGAPVWNNNS+LT+G+RGPILLEDYHLVEKLANFDRERIPER
Sbjct  2    YSHQRPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPER  61

Query  255  VVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            VVHARGASAKGFFEVTHDI+HLTCADFLRAPG QTPVIVRFSTVIHERGSPE
Sbjct  62   VVHARGASAKGFFEVTHDITHLTCADFLRAPGTQTPVIVRFSTVIHERGSPE  113



>ref|XP_002963086.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
 gb|EFJ36549.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
Length=484

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++S  +TTN+GAPVWNNN+SLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGA VWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGASVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>prf||1906388A catalase
Length=492

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RG ILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+T NSGAPVWNNNS +TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA +SP++T NSGAPVWNNN+SLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSANNSPYFTANSGAPVWNNNNSLTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLR+PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+T NSGAPVWNNNS +TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+HRPSS +++PFWTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI++L+CADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPE  114


 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 111/122 (91%), Gaps = 8/122 (7%)
 Frame = +3

Query  45   LLSHLSSSMDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLA  224
            L SHL+        RPSSAF +PFWTTNSGAPVWNNNS+LT+G+RGPILLEDYHLVEKLA
Sbjct  482  LASHLN--------RPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLA  533

Query  225  NFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGS  404
            NFDRERIPERVVHARGASAKGFFEVTHDI+HLTCADFLRAPG QTPVIVRFSTVIHERGS
Sbjct  534  NFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGTQTPVIVRFSTVIHERGS  593

Query  405  PE  410
            PE
Sbjct  594  PE  595



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++S  +TTN+GAPVWNNN+SLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA ++P+ TTNSGAPVWNNNSSLTV  RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADF+RAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPE  114



>prf||2104177A catalase
Length=492

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+R SSA+++PFWTTNSGAPV+NNN+SLTVG+RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTPVIVR STVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRLSTVIHERGSPE  114



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EK A FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKPAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA ++P+ TTNSGAPVWNNNSSLTV  RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDISHLTCADF+RAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS+F++ FWTTNSGAPVWNN S++T+G RGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNTTFWTTNSGAPVWNNTSAMTIGQRGPVLLEDYHLIEKITNFHRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ER+VHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERIVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AIU99483.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRPSS  +S FWTTNSGAPVWNNNS+LTVG RGPILLED+HL+EKLA FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDHHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERV HARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVAHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>ref|XP_002961779.1| hypothetical protein SELMODRAFT_140901 [Selaginella moellendorffii]
 ref|XP_002964850.1| hypothetical protein SELMODRAFT_167253 [Selaginella moellendorffii]
 gb|EFJ33688.1| hypothetical protein SELMODRAFT_167253 [Selaginella moellendorffii]
 gb|EFJ37039.1| hypothetical protein SELMODRAFT_140901 [Selaginella moellendorffii]
Length=492

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKH PSSAF+S F+TTNSG PVWNNNSSLTVG+RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHTPSSAFNSSFFTTNSGTPVWNNNSSLTVGSRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKG+FEVTHDIS+LTCADFLRAPGVQTP+IVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGYFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPE  114



>gb|AGI65617.1| catalase, partial [Fragaria x ananassa]
Length=467

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/107 (96%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +3

Query  90   PSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERVVHAR  269
            PSSA+ SPFWTTNSGAPVWNNNSSLT+G RGPILLEDYHLVEKLANFDRERIPERVVHAR
Sbjct  1    PSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIPERVVHAR  60

Query  270  GASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            GASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   GASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  107



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKH PSSA ++PFWTTN+GAPVWNNNSS+TVG RGPILLEDYH++EKLANFDRERIP
Sbjct  1    MDPYKHCPSSAHNTPFWTTNAGAPVWNNNSSMTVGQRGPILLEDYHMLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARG SAKGFFEVTH+IS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGMSAKGFFEVTHEISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   216 bits (551),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRP S  +S  WTTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPPSGSNSILWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   216 bits (550),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA + P W+TNSGAPVW+N+ SLTVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPSSAHNGPHWSTNSGAPVWSNDHSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   216 bits (550),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+ PS+A++  FWTTNSGAPVWNNNSSLTVG RGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKNLPSNAYNCSFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTH++S LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHNVSQLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>sp|P55313.1|CATA2_WHEAT RecName: Full=Catalase [Triticum aestivum]
 emb|CAA64077.1| catalase [Triticum aestivum]
Length=492

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRP+S  +S +WTTNSGAPVWNNN++LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPTSGANSAYWTTNSGAPVWNNNNALTVGHRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+S LTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSQLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA +SP +TTNSGAPVWN+NSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKFRPSSAHNSPHFTTNSGAPVWNDNSSMTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFE THDISHLTCADFLR+PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFETTHDISHLTCADFLRSPGVQTPVIVRFSTVIHERGSPE  114



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+TTNSGAPVWNNNSS+TVG RG ILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIH RGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHARGSPE  114



>sp|P55307.1|CATA1_HORVU RecName: Full=Catalase isozyme 1 [Hordeum vulgare]
 gb|AAA96947.1| catalase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ84783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08157.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYKHRP+S  +S +WTTNSGAPVWNNN++LTVG RGPILLEDYHL+EKLA FDRERIP
Sbjct  1    MDPYKHRPTSGANSAYWTTNSGAPVWNNNNALTVGHRGPILLEDYHLIEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+S LTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSQLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SP++TTN+GAPV+NN+SSLTVG+RGP+LLEDYHLVEKLANF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+S LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA++SP++TTN+GAPV+NN+SSLTVG+RGP+LLEDYHLVEKLANF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHD+S LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 112/114 (98%), Gaps = 1/114 (1%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RP+S+++SPF+T NSGAPVWNNNSS+TVG RGPILLEDYHLVEKLANFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFT-NSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  59

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS+LTCADFLRAPGVQTPVIVRFSTVIHERGSPE
Sbjct  60   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  113



>gb|AAP80622.1|AF475100_1 catalase isozyme, partial [Triticum aestivum]
Length=268

 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +3

Query  78   YKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIPERV  257
            YKHRP+S  +S +WTTNSGAPVWNNN++LTVG RGPILLEDYHL+EKLA FDRERIPERV
Sbjct  18   YKHRPTSGANSGYWTTNSGAPVWNNNNALTVGQRGPILLEDYHLIEKLAQFDRERIPERV  77

Query  258  VHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            VHARGASAKGFFEVTHD+S LTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  78   VHARGASAKGFFEVTHDVSQLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  128



>gb|AAF61733.1|AF243518_1 catalase 3 [Helianthus annuus]
Length=492

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK RPSSA+++PFWTTN+G PV+NN +SLTVG RGPILLEDYHL+EKLANF RERIP
Sbjct  1    MDPYKQRPSSAYNAPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ER+VHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP IVRFSTVIHERGSPE
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPE  114



>gb|ABK41476.1| catalase [Haematococcus pluvialis]
Length=492

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSSA+ S  WTTN+G PV+NNNSSLTVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct  1    MDPYKYRPSSAYDSAHWTTNTGMPVFNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGA AKGFFEVTHD+SHLTCADFLRAPGVQTPVIVRFSTV+HERGSPE
Sbjct  61   ERVVHARGAVAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPE  114



>ref|XP_010459749.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK  PSSA  SPF+TTNSGAPV+NNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKVVPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLR PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRGPGVQTPVIVRFSTVIHERGSPE  114



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK+RPSS F++PFWTTNSG PV+NN+S+LT+G+RGPILLEDYHLVEK+ANF RER P
Sbjct  1    MDPYKYRPSSTFNTPFWTTNSGTPVYNNDSALTIGSRGPILLEDYHLVEKIANFTRERTP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+HLTCADFLR PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPE  114



>ref|XP_010477308.1| PREDICTED: catalase-1 [Camelina sativa]
Length=492

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPYK  PSSA  SPF+TTNSGAPV+NNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYKVIPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDIS LTCADFLR PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRGPGVQTPVIVRFSTVIHERGSPE  114



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   214 bits (544),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+ LT ADFLR PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRFSTVIHERGSPE  114



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   214 bits (544),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  69   MDPYKHRPSSAFSSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  248
            MDPY+ RPSSA  SPF+TTNSGAPVWNNNSSLTVGTRGPILLEDYHL+EKLANFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  249  ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPE  410
            ERVVHARGASAKGFFEVTHDI+ LT ADFLR PGVQTPVIVRFSTVIHERGSPE
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRFSTVIHERGSPE  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566707135225