BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF010F18

Length=422
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011084184.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    126   1e-30   
ref|XP_009618666.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   7e-30   Nicotiana tomentosiformis
ref|XP_009618667.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   7e-30   
gb|EYU29231.1|  hypothetical protein MIMGU_mgv1a002140mg                123   1e-29   Erythranthe guttata [common monkey flower]
ref|XP_006364269.1|  PREDICTED: serine/arginine repetitive matrix...    122   5e-29   Solanum tuberosum [potatoes]
gb|EYU29230.1|  hypothetical protein MIMGU_mgv1a002072mg                121   6e-29   Erythranthe guttata [common monkey flower]
ref|XP_009783532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    121   7e-29   Nicotiana sylvestris
ref|XP_009783537.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    121   7e-29   Nicotiana sylvestris
ref|XP_004245196.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    120   2e-28   Solanum lycopersicum
gb|EPS68763.1|  hypothetical protein M569_06004                         118   1e-27   Genlisea aurea
emb|CDP04788.1|  unnamed protein product                                117   1e-27   Coffea canephora [robusta coffee]
gb|KHN08115.1|  Peptidyl-prolyl cis-trans isomerase D                   117   2e-27   Glycine soja [wild soybean]
gb|KHN07093.1|  Peptidyl-prolyl cis-trans isomerase D                   117   2e-27   Glycine soja [wild soybean]
ref|XP_006581365.1|  PREDICTED: serine/arginine repetitive matrix...    117   2e-27   
ref|XP_010648638.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    117   2e-27   Vitis vinifera
ref|XP_002285000.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    117   2e-27   Vitis vinifera
ref|XP_003523694.1|  PREDICTED: serine/arginine repetitive matrix...    117   2e-27   
ref|XP_003526420.1|  PREDICTED: serine/arginine repetitive matrix...    117   2e-27   
ref|XP_011081940.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    117   2e-27   
emb|CBI21007.3|  unnamed protein product                                114   2e-27   Vitis vinifera
gb|AES58972.2|  peptidyl-prolyl cis-trans isomerase                     117   3e-27   Medicago truncatula
ref|XP_006483322.1|  PREDICTED: serine/arginine repetitive matrix...    117   3e-27   Citrus sinensis [apfelsine]
ref|XP_006450486.1|  hypothetical protein CICLE_v10007495mg             117   3e-27   Citrus clementina [clementine]
ref|XP_006483320.1|  PREDICTED: serine/arginine repetitive matrix...    117   3e-27   Citrus sinensis [apfelsine]
ref|XP_006450487.1|  hypothetical protein CICLE_v10007495mg             117   3e-27   Citrus clementina [clementine]
ref|XP_008445168.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   4e-27   Cucumis melo [Oriental melon]
ref|XP_004138866.1|  PREDICTED: uncharacterized protein LOC101210345    116   4e-27   
gb|KGN62922.1|  hypothetical protein Csa_2G380020                       116   4e-27   Cucumis sativus [cucumbers]
emb|CAN80313.1|  hypothetical protein VITISV_020758                     116   5e-27   Vitis vinifera
gb|KDP33623.1|  hypothetical protein JCGZ_07194                         116   5e-27   Jatropha curcas
ref|XP_008394052.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   6e-27   
ref|XP_008394051.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   6e-27   
ref|XP_004501305.1|  PREDICTED: serine/arginine repetitive matrix...    115   1e-26   Cicer arietinum [garbanzo]
gb|KHG19968.1|  Peptidyl-prolyl cis-trans isomerase cyp5                115   1e-26   Gossypium arboreum [tree cotton]
ref|XP_007161232.1|  hypothetical protein PHAVU_001G053000g             115   1e-26   Phaseolus vulgaris [French bean]
ref|XP_010670670.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    115   1e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008347718.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    106   1e-26   
ref|XP_007161231.1|  hypothetical protein PHAVU_001G052900g             115   1e-26   Phaseolus vulgaris [French bean]
ref|XP_010670673.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    115   1e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004164532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    111   2e-26   
ref|XP_007161230.1|  hypothetical protein PHAVU_001G052800g             115   2e-26   Phaseolus vulgaris [French bean]
ref|XP_007225294.1|  hypothetical protein PRUPE_ppa001326mg             114   2e-26   Prunus persica
ref|XP_002324283.2|  hypothetical protein POPTR_0018s01460g             114   2e-26   
ref|XP_011026475.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   2e-26   Populus euphratica
ref|XP_011026473.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   2e-26   Populus euphratica
ref|XP_011019778.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   2e-26   Populus euphratica
ref|XP_011019776.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   2e-26   Populus euphratica
ref|XP_011019775.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   2e-26   Populus euphratica
ref|XP_007013817.1|  Peptidyl-prolyl cis-trans isomerase CYP19-2 ...    114   3e-26   
gb|KJB07784.1|  hypothetical protein B456_001G045000                    114   3e-26   Gossypium raimondii
ref|XP_011019781.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   3e-26   Populus euphratica
ref|XP_011019777.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   3e-26   Populus euphratica
ref|XP_007013820.1|  Peptidyl-prolyl cis-trans isomerase CYP19-2 ...    114   3e-26   
gb|KJB07776.1|  hypothetical protein B456_001G045000                    114   3e-26   Gossypium raimondii
gb|KJB07775.1|  hypothetical protein B456_001G045000                    114   3e-26   Gossypium raimondii
ref|XP_004498656.1|  PREDICTED: serine/arginine repetitive matrix...    114   3e-26   Cicer arietinum [garbanzo]
ref|XP_008219899.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   3e-26   Prunus mume [ume]
gb|KJB07770.1|  hypothetical protein B456_001G044900                    112   8e-26   Gossypium raimondii
ref|XP_009334770.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    112   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_009334769.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    112   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_009345297.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    112   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_004291478.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    111   2e-25   Fragaria vesca subsp. vesca
ref|XP_010048238.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    111   2e-25   Eucalyptus grandis [rose gum]
ref|XP_010048237.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    111   2e-25   Eucalyptus grandis [rose gum]
ref|XP_010048236.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    111   2e-25   Eucalyptus grandis [rose gum]
ref|XP_010048233.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    111   2e-25   Eucalyptus grandis [rose gum]
gb|KCW80440.1|  hypothetical protein EUGRSUZ_C01785                     110   3e-25   Eucalyptus grandis [rose gum]
ref|XP_008378304.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    111   3e-25   
ref|XP_008378303.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    109   4e-25   
gb|KCW80439.1|  hypothetical protein EUGRSUZ_C01785                     110   4e-25   Eucalyptus grandis [rose gum]
gb|AES73684.2|  peptidyl-prolyl cis-trans isomerase                     110   7e-25   Medicago truncatula
ref|XP_002515550.1|  peptidyl-prolyl cis-trans isomerase, putative      109   1e-24   
emb|CDX75243.1|  BnaA01g04590D                                          109   1e-24   
emb|CDX68845.1|  BnaC01g06080D                                          108   2e-24   
ref|XP_009126010.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   2e-24   
gb|KJB07786.1|  hypothetical protein B456_001G045000                    107   5e-24   Gossypium raimondii
ref|NP_001190888.1|  cyclophilin-like peptidyl-prolyl cis-trans i...    105   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194968.2|  cyclophilin-like peptidyl-prolyl cis-trans isom...    105   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010037119.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    3e-23   Eucalyptus grandis [rose gum]
ref|XP_002867244.1|  hypothetical protein ARALYDRAFT_491484             105   3e-23   
emb|CAA22569.1|  putative protein                                       105   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010249988.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   4e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010249986.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   4e-23   Nelumbo nucifera [Indian lotus]
ref|XP_006382072.1|  hypothetical protein POPTR_0006s26710g             105   5e-23   
ref|XP_007050461.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    103   6e-23   
ref|XP_010437912.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010447391.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   6e-23   Camelina sativa [gold-of-pleasure]
gb|KHG30308.1|  Peptidyl-prolyl cis-trans isomerase cyp5              99.8    7e-23   Gossypium arboreum [tree cotton]
ref|XP_010447392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   7e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010437913.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   7e-23   Camelina sativa [gold-of-pleasure]
ref|XP_007050460.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    103   8e-23   
ref|XP_010432721.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010432719.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010432723.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010432722.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006412476.1|  hypothetical protein EUTSA_v10024440mg             103   2e-22   
ref|XP_010028211.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    3e-22   Eucalyptus grandis [rose gum]
ref|XP_010646137.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   4e-22   Vitis vinifera
ref|XP_002280876.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   4e-22   Vitis vinifera
gb|AAM13845.1|  unknown protein                                         102   5e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CAN75764.1|  hypothetical protein VITISV_034442                     102   5e-22   Vitis vinifera
ref|XP_002520955.1|  cyclophilin, putative                              101   5e-22   Ricinus communis
ref|XP_008802286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   6e-22   Phoenix dactylifera
ref|XP_008802283.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   6e-22   Phoenix dactylifera
ref|XP_002306802.2|  hypothetical protein POPTR_0005s23730g             101   6e-22   Populus trichocarpa [western balsam poplar]
ref|XP_006443960.1|  hypothetical protein CICLE_v10019230mg             101   6e-22   Citrus clementina [clementine]
ref|XP_008802287.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   6e-22   Phoenix dactylifera
ref|XP_008802285.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   6e-22   Phoenix dactylifera
gb|KDO68605.1|  hypothetical protein CISIN_1g006162mg                   101   7e-22   Citrus sinensis [apfelsine]
gb|KDO68608.1|  hypothetical protein CISIN_1g006162mg                   101   7e-22   Citrus sinensis [apfelsine]
ref|XP_006443959.1|  hypothetical protein CICLE_v10019230mg             101   7e-22   
ref|XP_010110347.1|  Peptidyl-prolyl cis-trans isomerase 1              101   8e-22   
ref|XP_004498655.1|  PREDICTED: serine/arginine repetitive matrix...    101   1e-21   
gb|KDP21391.1|  hypothetical protein JCGZ_21862                         100   2e-21   Jatropha curcas
ref|XP_006838913.1|  hypothetical protein AMTR_s00002p00269760        99.8    4e-21   
ref|XP_006283087.1|  hypothetical protein CARUB_v10004106mg           99.4    5e-21   
ref|XP_010038050.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    6e-21   Eucalyptus grandis [rose gum]
ref|XP_010935780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    6e-21   Elaeis guineensis
ref|XP_010038051.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    6e-21   Eucalyptus grandis [rose gum]
ref|XP_011032623.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    8e-21   Populus euphratica
ref|XP_002302085.2|  hypothetical protein POPTR_0002s04800g           97.8    1e-20   
gb|AJA29688.1|  peptidyl-prolyl cis-trans isomerase                   97.8    1e-20   Betula luminifera [liang ye hua]
ref|XP_010527616.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.8    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010546569.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010527615.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.8    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010527620.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.4    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010527617.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.4    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010527621.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.4    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_010527619.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.4    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_010527622.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    2e-20   Tarenaya hassleriana [spider flower]
gb|KJB25951.1|  hypothetical protein B456_004G217800                  97.1    2e-20   Gossypium raimondii
ref|XP_010527623.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    2e-20   Tarenaya hassleriana [spider flower]
gb|KJB25952.1|  hypothetical protein B456_004G217800                  97.1    2e-20   Gossypium raimondii
ref|XP_010527624.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    2e-20   Tarenaya hassleriana [spider flower]
gb|KJB25950.1|  hypothetical protein B456_004G217800                  97.1    2e-20   Gossypium raimondii
gb|KJB25949.1|  hypothetical protein B456_004G217800                  97.1    2e-20   Gossypium raimondii
gb|KJB25953.1|  hypothetical protein B456_004G217800                  96.7    3e-20   Gossypium raimondii
emb|CDP03680.1|  unnamed protein product                              96.7    3e-20   Coffea canephora [robusta coffee]
ref|XP_008785212.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    4e-20   Phoenix dactylifera
ref|XP_010925250.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.3    5e-20   Elaeis guineensis
ref|XP_010274266.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.9    6e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010274264.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.9    6e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010274267.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.9    7e-20   Nelumbo nucifera [Indian lotus]
gb|KHG26228.1|  Peptidyl-prolyl cis-trans isomerase D                 91.3    7e-20   Gossypium arboreum [tree cotton]
ref|XP_007199724.1|  hypothetical protein PRUPE_ppa002435mg           95.5    7e-20   Prunus persica
ref|XP_010274268.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.9    7e-20   Nelumbo nucifera [Indian lotus]
ref|XP_008235346.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    9e-20   Prunus mume [ume]
ref|XP_008235345.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    9e-20   Prunus mume [ume]
ref|XP_008235347.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.1    1e-19   
ref|XP_009798520.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.7    1e-19   Nicotiana sylvestris
ref|XP_004493727.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.7    1e-19   Cicer arietinum [garbanzo]
ref|XP_008792090.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.1    2e-19   Phoenix dactylifera
ref|XP_003603433.1|  Peptidyl-prolyl cis-trans isomerase              95.1    2e-19   
gb|KEH23833.1|  peptidyl-prolyl cis-trans isomerase                   94.4    2e-19   Medicago truncatula
ref|XP_004146961.1|  PREDICTED: uncharacterized protein LOC101219904  94.7    2e-19   Cucumis sativus [cucumbers]
ref|XP_008451290.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.4    2e-19   Cucumis melo [Oriental melon]
ref|XP_004162194.1|  PREDICTED: uncharacterized LOC101219904          94.4    2e-19   
ref|XP_008355416.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.0    2e-19   
ref|XP_009601160.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  93.6    3e-19   Nicotiana tomentosiformis
ref|XP_009601158.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  93.6    3e-19   Nicotiana tomentosiformis
ref|XP_009370747.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  93.2    3e-19   
ref|XP_009419289.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.0    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010914920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  93.6    6e-19   Elaeis guineensis
ref|XP_006349731.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.8    6e-19   Solanum tuberosum [potatoes]
ref|XP_006604473.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.8    7e-19   Glycine max [soybeans]
ref|XP_006604472.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.8    7e-19   Glycine max [soybeans]
ref|XP_006604471.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.8    7e-19   Glycine max [soybeans]
ref|XP_004247203.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.8    7e-19   Solanum lycopersicum
ref|XP_010028213.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.4    7e-19   Eucalyptus grandis [rose gum]
ref|XP_006604469.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.8    8e-19   Glycine max [soybeans]
ref|XP_009381127.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.8    9e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010028212.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    1e-18   Eucalyptus grandis [rose gum]
ref|XP_008366534.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.3    1e-18   
ref|XP_008366532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.3    1e-18   
ref|XP_007162476.1|  hypothetical protein PHAVU_001G155500g           91.7    2e-18   Phaseolus vulgaris [French bean]
ref|NP_850740.1|  cyclophilin-like peptidyl-prolyl cis-trans isom...  89.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009399354.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.7    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399355.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.7    2e-18   
ref|XP_011458604.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  91.7    2e-18   Fragaria vesca subsp. vesca
ref|XP_456922.1|  DEHA2A13640p                                        89.4    2e-18   Debaryomyces hansenii CBS767
ref|XP_010028210.1|  PREDICTED: uncharacterized protein LOC104418...  86.7    3e-18   Eucalyptus grandis [rose gum]
ref|XP_011026088.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.9    4e-18   Populus euphratica
ref|XP_010028209.1|  PREDICTED: uncharacterized protein LOC104418...  86.3    4e-18   Eucalyptus grandis [rose gum]
dbj|BAH57223.1|  AT3G63400                                            90.1    5e-18   Arabidopsis thaliana [mouse-ear cress]
gb|EYU46533.1|  hypothetical protein MIMGU_mgv1a002319mg              90.1    6e-18   Erythranthe guttata [common monkey flower]
ref|NP_191899.1|  cyclophilin-like peptidyl-prolyl cis-trans isom...  89.7    6e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KHN10697.1|  Peptidyl-prolyl cis-trans isomerase                   90.1    6e-18   Glycine soja [wild soybean]
ref|XP_011079927.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    6e-18   Sesamum indicum [beniseed]
ref|XP_010679140.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    7e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679138.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    7e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679137.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    7e-18   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX93909.1|  BnaC04g20680D                                        89.7    7e-18   
gb|AAS75310.1|  multidomain cyclophilin type peptidyl-prolyl cis-...  89.7    7e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDK25020.1|  unnamed protein product                              87.8    8e-18   Kuraishia capsulata CBS 1993
ref|XP_009388658.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    9e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006647053.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.7    1e-17   Oryza brachyantha
ref|XP_006647052.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.7    1e-17   Oryza brachyantha
ref|XP_010268554.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.7    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_003521263.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  88.6    2e-17   
ref|XP_006290850.1|  hypothetical protein CARUB_v10016960mg           87.8    3e-17   
gb|EEC72707.1|  hypothetical protein OsI_06299                        88.6    3e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_006402278.1|  hypothetical protein EUTSA_v10006033mg           86.3    3e-17   
gb|EEE56526.1|  hypothetical protein OsJ_05815                        88.2    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002876720.1|  hypothetical protein ARALYDRAFT_324764           87.4    3e-17   
gb|EDM00869.1|  rCG62684, isoform CRA_b                               82.4    4e-17   Rattus norvegicus [brown rat]
gb|EPS61145.1|  hypothetical protein M569_13654                       87.4    4e-17   Genlisea aurea
ref|XP_001651471.1|  AAEL005799-PA                                    84.3    4e-17   
gb|EYU44370.1|  hypothetical protein MIMGU_mgv1a0089282mg             84.7    4e-17   Erythranthe guttata [common monkey flower]
ref|XP_010234012.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    4e-17   Brachypodium distachyon [annual false brome]
ref|XP_010234011.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    4e-17   Brachypodium distachyon [annual false brome]
ref|XP_010234010.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    4e-17   Brachypodium distachyon [annual false brome]
ref|XP_010234009.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    5e-17   Brachypodium distachyon [annual false brome]
ref|XP_010104463.1|  Peptidyl-prolyl cis-trans isomerase              83.6    5e-17   Morus notabilis
ref|NP_001232291.1|  putative peptidylprolyl isomerase D              84.0    5e-17   
ref|XP_010104462.1|  Peptidyl-prolyl cis-trans isomerase              82.8    6e-17   
gb|AIZ68177.1|  peptidyl-prolyl cis-trans isomerase CYP40-like pr...  85.1    7e-17   Ornithogalum longebracteatum [sea-onion]
ref|XP_010028504.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.1    7e-17   Eucalyptus grandis [rose gum]
gb|KJB17878.1|  hypothetical protein B456_003G021400                  85.1    7e-17   Gossypium raimondii
ref|XP_006798990.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  84.3    8e-17   Neolamprologus brichardi [lyretail cichlid]
ref|XP_003436324.1|  AGAP002952-PB                                    82.8    8e-17   Anopheles gambiae str. PEST
ref|XP_001774773.1|  predicted protein                                84.7    9e-17   
gb|EMF14722.1|  peptidyl-prolyl cis-trans isomerase 1                 84.7    1e-16   Sphaerulina musiva SO2202
ref|XP_010584392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  84.3    1e-16   Haliaeetus leucocephalus
ref|XP_001487732.1|  hypothetical protein PGUG_01109                  85.1    1e-16   Meyerozyma guilliermondii ATCC 6260
ref|XP_008681079.1|  PREDICTED: uncharacterized protein LOC100192...  87.0    1e-16   
ref|XP_008681078.1|  PREDICTED: uncharacterized protein LOC100192...  87.0    1e-16   Zea mays [maize]
gb|ACH45652.1|  putative peptidylprolyl isomerase D                   84.7    1e-16   Taeniopygia guttata
ref|XP_005486377.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  84.7    1e-16   Zonotrichia albicollis
ref|XP_010584391.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  84.7    1e-16   Haliaeetus leucocephalus
emb|CDQ63777.1|  unnamed protein product                              84.7    1e-16   Oncorhynchus mykiss
ref|XP_010468852.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  86.3    1e-16   Camelina sativa [gold-of-pleasure]
gb|KFB52696.1|  AGAP002952-PC-like protein                            86.3    1e-16   Anopheles sinensis
ref|XP_009138664.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    1e-16   Brassica rapa
emb|CDY53714.1|  BnaAnng12550D                                        86.3    1e-16   Brassica napus [oilseed rape]
gb|ACH70718.1|  peptidylprolyl isomerase D (cyclophilin D)            84.7    1e-16   Salmo salar
ref|XP_005517649.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  84.3    1e-16   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005148983.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  84.3    1e-16   Melopsittacus undulatus
gb|ACO07673.1|  40 kDa peptidyl-prolyl cis-trans isomerase            84.3    1e-16   Oncorhynchus mykiss
gb|ACO08154.1|  40 kDa peptidyl-prolyl cis-trans isomerase            84.3    1e-16   Oncorhynchus mykiss
ref|XP_010512756.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    1e-16   Camelina sativa [gold-of-pleasure]
gb|KHG16182.1|  Peptidyl-prolyl cis-trans isomerase CYP40 -like p...  84.0    2e-16   Gossypium arboreum [tree cotton]
gb|ACH45651.1|  putative peptidylprolyl isomerase D                   84.3    2e-16   Taeniopygia guttata
ref|XP_004195205.1|  Piso0_005752                                     84.3    2e-16   
ref|XP_003970715.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.0    2e-16   
ref|XP_010999957.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  84.3    2e-16   Populus euphratica
ref|XP_001761081.1|  predicted protein                                84.0    2e-16   
ref|XP_311948.5|  AGAP002952-PA                                       86.3    2e-16   Anopheles gambiae str. PEST
ref|XP_003715059.1|  peptidyl-prolyl cis-trans isomerase              84.0    2e-16   Magnaporthe oryzae 70-15
ref|XP_008454916.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.8    2e-16   
gb|EMD94092.1|  hypothetical protein COCHEDRAFT_1201904               81.6    2e-16   Bipolaris maydis C5
ref|XP_003436323.1|  AGAP002952-PC                                    85.9    3e-16   Anopheles gambiae str. PEST
ref|XP_005076198.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  83.6    3e-16   Mesocricetus auratus [Syrian golden hamster]
ref|XP_006121931.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  83.2    3e-16   Pelodiscus sinensis [Chinese softshell turtle]
gb|EMG49183.1|  Peptidyl-prolyl cis-trans isomerase D                 83.2    3e-16   Candida maltosa Xu316
ref|XP_008454915.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  83.2    3e-16   Cucumis melo [Oriental melon]
ref|XP_005919457.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  83.2    3e-16   Haplochromis burtoni
ref|NP_001004279.1|  peptidyl-prolyl cis-trans isomerase D            83.2    3e-16   Rattus norvegicus [brown rat]
ref|XP_004553696.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  83.2    3e-16   Maylandia zebra
ref|XP_665956.1|  hypothetical protein                                81.3    3e-16   Cryptosporidium hominis TU502
emb|CEF66075.1|  Peptidyl-prolyl cis-trans isomerase D                81.3    3e-16   Strongyloides ratti
ref|XP_003443392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  83.2    3e-16   Oreochromis niloticus
ref|XP_007393240.1|  hypothetical protein PHACADRAFT_251820           82.8    4e-16   Phanerochaete carnosa HHB-10118-sp
ref|XP_003970636.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  83.2    4e-16   Takifugu rubripes [tiger puffer]
gb|EGW00520.1|  40 kDa peptidyl-prolyl cis-trans isomerase            82.0    4e-16   Cricetulus griseus [Chinese hamsters]
ref|XP_001388285.1|  hypothetical protein                             80.9    4e-16   Cryptosporidium parvum Iowa II
ref|XP_003504914.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.0    4e-16   Cricetulus griseus [Chinese hamsters]
ref|XP_007047186.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  82.0    4e-16   
ref|XP_009350556.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.8    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_007047183.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  82.4    4e-16   
ref|XP_007692567.1|  hypothetical protein COCMIDRAFT_30232            80.9    5e-16   Bipolaris oryzae ATCC 44560
ref|XP_007047182.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  82.8    5e-16   
ref|XP_002310739.2|  hypothetical protein POPTR_0007s11390g           82.0    5e-16   
ref|XP_007047178.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  82.8    5e-16   
gb|EWM22369.1|  Cyclophilin-like peptidyl-prolyl cis-trans isomer...  84.3    5e-16   Nannochloropsis gaditana
ref|XP_007611328.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.8    5e-16   
ref|XP_005299363.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.8    5e-16   Chrysemys picta bellii
ref|XP_007624483.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  82.8    5e-16   Cricetulus griseus [Chinese hamsters]
gb|ERE90429.1|  peptidyl-prolyl cis-trans isomerase D-like protein    82.8    5e-16   Cricetulus griseus [Chinese hamsters]
emb|CDS03415.1|  Putative Peptidyl-prolyl cis-trans isomerasecyp5     80.9    5e-16   Lichtheimia ramosa
gb|KJB48523.1|  hypothetical protein B456_008G073900                  82.8    5e-16   
ref|XP_007701371.1|  hypothetical protein COCSADRAFT_92320            80.9    5e-16   
ref|XP_007047185.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  82.0    5e-16   
ref|XP_007609920.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  82.8    6e-16   
gb|EFA76366.1|  cyclophilin-type peptidylprolyl cis-trans isomerase   80.5    6e-16   
ref|XP_003524582.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.4    6e-16   
gb|ACI66097.1|  40 kDa peptidyl-prolyl cis-trans isomerase            82.4    7e-16   
ref|XP_009781931.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.4    7e-16   
ref|XP_006579808.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.4    7e-16   
emb|CDQ62287.1|  unnamed protein product                              82.4    7e-16   
gb|ACO07506.1|  40 kDa peptidyl-prolyl cis-trans isomerase            82.4    7e-16   
ref|XP_006740015.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  79.7    7e-16   
ref|XP_004165805.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  82.4    7e-16   
ref|XP_004366913.1|  Cyclophilin                                      84.0    7e-16   
ref|XP_004136993.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.4    7e-16   
ref|XP_004324857.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    7e-16   
ref|XP_003337737.1|  peptidyl-prolyl isomerase D (cyclophilin D)      79.7    7e-16   
ref|XP_011092880.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    7e-16   
gb|AAP44536.1|  cyclophilin-like protein                              84.0    7e-16   
ref|XP_006412177.1|  hypothetical protein EUTSA_v10027585mg           80.9    7e-16   
ref|XP_001941476.1|  peptidyl-prolyl cis-trans isomerase              80.1    8e-16   
ref|XP_003650848.1|  hypothetical protein THITE_2094562               82.4    8e-16   
ref|XP_010381484.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.0    9e-16   
ref|XP_011464347.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    9e-16   
ref|XP_003036654.1|  hypothetical protein SCHCODRAFT_80344            82.0    9e-16   
gb|KHJ83952.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...  80.5    9e-16   
ref|XP_005854554.1|  myosin light chain kinase                        84.0    9e-16   
ref|XP_009593827.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.0    9e-16   
ref|XP_002521846.1|  peptidyl-prolyl cis-trans isomerase d, ppid,...  82.0    1e-15   
dbj|BAJ98045.1|  predicted protein                                    82.8    1e-15   
ref|XP_006384447.1|  SQUINT family protein                            82.0    1e-15   
ref|XP_001903954.1|  hypothetical protein                             82.0    1e-15   
ref|XP_007071343.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.0    1e-15   
ref|XP_004926608.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    1e-15   
gb|KIW08816.1|  hypothetical protein PV09_00747                       82.0    1e-15   
ref|XP_004509164.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
ref|XP_009759456.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
ref|XP_006346442.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
ref|XP_003097196.1|  hypothetical protein CRE_18104                   79.7    1e-15   
emb|CEP10276.1|  hypothetical protein                                 81.6    1e-15   
ref|XP_007005972.1|  hypothetical protein TREMEDRAFT_23729            79.0    1e-15   
gb|KIZ04415.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...  80.1    1e-15   
ref|XP_007117530.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
emb|CAA69622.1|  cyclophylin                                          79.7    1e-15   
ref|XP_007446681.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
ref|XP_001386995.1|  Peptidyl-prolyl cis-trans isomerase CPR6 (PP...  81.6    1e-15   
ref|XP_007117529.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
ref|XP_004196297.1|  Piso0_005752                                     81.6    1e-15   
ref|XP_010898283.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
ref|XP_004266204.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
ref|XP_007184203.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
ref|XP_004288060.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
ref|XP_011007671.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    1e-15   
ref|XP_011007670.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.9    1e-15   
ref|XP_006213657.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
ref|XP_001862300.1|  peptidyl-prolyl cis-trans isomerase g            80.9    1e-15   
ref|XP_010953800.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
ref|XP_004606206.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
gb|EMP24944.1|  Peptidyl-prolyl cis-trans isomerase D                 81.6    1e-15   
ref|XP_005112766.1|  PREDICTED: NK-tumor recognition protein-like...  84.0    1e-15   
ref|XP_004230798.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
ref|XP_005112767.1|  PREDICTED: NK-tumor recognition protein-like...  84.0    1e-15   
ref|XP_002054499.1|  GJ22774                                          83.6    1e-15   
ref|XP_011001198.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.6    1e-15   
ref|XP_001633810.1|  predicted protein                                81.6    1e-15   
ref|XP_007714724.1|  hypothetical protein COCCADRAFT_102503           79.3    2e-15   
ref|XP_007373249.1|  rotamase D                                       81.6    2e-15   
ref|XP_011092737.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_011092738.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_532704.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...  81.6    2e-15   
ref|XP_010413155.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.8    2e-15   
ref|XP_010413154.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.8    2e-15   
ref|XP_007998311.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.9    2e-15   
ref|XP_011099202.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.9    2e-15   
gb|KIJ51046.1|  hypothetical protein M422DRAFT_245021                 80.1    2e-15   
ref|XP_004232050.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_008785095.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase   79.3    2e-15   
ref|XP_003550075.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_010530877.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_010691019.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_006338217.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_010548031.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_002313736.1|  peptidyl-prolyl cis-trans isomerase family p...  79.3    2e-15   
ref|XP_004367802.1|  peptidylprolyl cis-trans isomerase, cyclophi...  82.8    2e-15   
ref|XP_003112830.1|  CRE-CYN-1 protein                                79.7    2e-15   
ref|XP_006657500.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.8    2e-15   
ref|XP_006657499.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.8    2e-15   
gb|EHH30637.1|  hypothetical protein EGK_20384                        81.3    2e-15   
ref|XP_011007669.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_011099199.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_003295671.1|  hypothetical protein PTT_02276                   79.0    2e-15   
ref|XP_010985159.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_008236639.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.9    2e-15   
gb|KIW28425.1|  hypothetical protein PV07_08092                       81.3    2e-15   
ref|XP_002313093.1|  SQUINT family protein                            81.3    2e-15   
ref|XP_001955669.1|  GF18880                                          83.2    2e-15   
gb|KFA77235.1|  hypothetical protein S40288_01249                     81.3    2e-15   
ref|XP_005593787.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_003490682.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_010090292.1|  Peptidyl-prolyl cis-trans isomerase              79.0    2e-15   
gb|KEY72096.1|  hypothetical protein S7711_00112                      80.9    2e-15   
ref|XP_002599120.1|  hypothetical protein BRAFLDRAFT_281480           80.1    2e-15   
ref|XP_008324858.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.9    2e-15   
sp|P0C1I7.1|CYP5_RHIO9  RecName: Full=Peptidyl-prolyl cis-trans i...  79.0    2e-15   
ref|XP_426283.3|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...  80.9    2e-15   
gb|KIW43118.1|  peptidyl-prolyl cis-trans isomerase D                 80.9    2e-15   
ref|XP_010685556.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  79.3    2e-15   
ref|XP_009589624.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.9    2e-15   
gb|KJB71084.1|  hypothetical protein B456_011G104900                  80.9    2e-15   
ref|XP_006867984.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.9    2e-15   
ref|XP_002632172.1|  Hypothetical protein CBG07031                    79.0    2e-15   
ref|XP_008775239.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  81.3    2e-15   
ref|XP_001094929.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.9    3e-15   
ref|XP_004289844.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  79.0    3e-15   
gb|KHG00695.1|  Peptidyl-prolyl cis-trans isomerase CYP40             80.9    3e-15   
ref|XP_008775240.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.9    3e-15   
ref|XP_007845898.1|  peptidyl-prolyl cis-trans isomerase              80.9    3e-15   
gb|AAQ87931.1|  Bet v 7-like protein                                  78.6    3e-15   
ref|XP_006409501.1|  hypothetical protein EUTSA_v10022753mg           80.5    3e-15   
gb|EMD36826.1|  hypothetical protein CERSUDRAFT_114733                80.9    3e-15   
ref|XP_006892841.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.9    3e-15   
ref|XP_011427426.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.8    3e-15   
ref|XP_001322019.1|  cytosolic cyclophilin                            78.6    3e-15   
gb|KHG00696.1|  Peptidyl-prolyl cis-trans isomerase CYP40             81.3    3e-15   
ref|XP_002000002.1|  GI22772                                          82.8    3e-15   
ref|XP_002306460.1|  hypothetical protein POPTR_0005s14210g           80.5    3e-15   
gb|KFA61408.1|  hypothetical protein S40285_03565                     80.9    3e-15   
ref|XP_004394281.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    3e-15   
ref|XP_006000743.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.9    3e-15   
ref|XP_003221776.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    3e-15   
ref|XP_008683780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    3e-15   
gb|KHG25547.1|  Peptidyl-prolyl cis-trans isomerase CYP40 -like p...  80.5    3e-15   
gb|EFB29938.1|  hypothetical protein PANDA_010618                     80.1    3e-15   
ref|XP_003664466.1|  hypothetical protein MYCTH_2307319               80.5    3e-15   
ref|XP_007530443.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    3e-15   
ref|XP_008799420.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase   78.6    3e-15   
emb|CDX71247.1|  BnaC07g05260D                                        80.5    3e-15   
emb|CEI93837.1|  Putative Peptidyl-prolyl cis-trans isomerase cyp11   80.1    3e-15   
ref|XP_011260123.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  82.0    4e-15   
ref|XP_005800637.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    4e-15   
ref|XP_007998309.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.1    4e-15   
ref|XP_004017329.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    4e-15   
dbj|BAJ87064.1|  predicted protein                                    82.0    4e-15   
ref|XP_004777378.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    4e-15   
gb|EKG12358.1|  Tetratricopeptide TPR-1                               80.5    4e-15   
emb|CDH48646.1|  cyclophilin                                          78.6    4e-15   
gb|EHH54044.1|  hypothetical protein EGM_14781                        80.5    4e-15   
ref|XP_007998308.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    4e-15   
gb|EHH26276.1|  hypothetical protein EGK_16197                        80.5    4e-15   
gb|KDP27580.1|  hypothetical protein JCGZ_19585                       78.6    4e-15   
ref|NP_001252763.1|  peptidylprolyl isomerase D                       80.5    4e-15   
ref|XP_001802932.1|  hypothetical protein SNOG_12712                  78.6    4e-15   
emb|CEP18822.1|  hypothetical protein                                 78.6    4e-15   
ref|XP_001690215.1|  peptidyl-prolyl cis-trans isomerase, cycloph...  80.5    4e-15   
ref|XP_002745353.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    4e-15   
ref|XP_003899367.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    4e-15   
ref|XP_003324829.1|  hypothetical protein PGTG_06366                  81.3    4e-15   
ref|XP_001500384.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    4e-15   
ref|XP_007925730.1|  hypothetical protein MYCFIDRAFT_36025            80.5    4e-15   
dbj|BAQ21277.1|  cyclophilin                                          78.6    4e-15   
ref|XP_008584597.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    4e-15   
ref|XP_005909484.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    4e-15   
ref|XP_003984955.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    4e-15   
ref|XP_002921709.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    4e-15   
ref|NP_001271664.1|  uncharacterized protein LOC101867179             80.5    4e-15   
ref|NP_776578.1|  peptidyl-prolyl cis-trans isomerase D               80.5    4e-15   
ref|XP_005666719.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    4e-15   
ref|XP_005985804.1|  PREDICTED: LOW QUALITY PROTEIN: peptidylprol...  80.5    4e-15   
ref|XP_011120782.1|  hypothetical protein AOL_s00075g169              80.5    4e-15   
gb|KHN05982.1|  E3 SUMO-protein ligase RanBP2                         82.4    4e-15   
ref|XP_010726006.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  79.0    4e-15   
ref|NP_001231315.1|  peptidyl-prolyl cis-trans isomerase D            80.5    4e-15   
ref|XP_007229920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    4e-15   
ref|XP_003418541.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.1    4e-15   
ref|XP_003834284.1|  similar to peptidyl-prolyl cis-trans isomerase   78.2    5e-15   
ref|XP_006487422.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  78.2    5e-15   
dbj|BAE29632.1|  unnamed protein product                              80.1    5e-15   
ref|XP_008419300.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  80.5    5e-15   
ref|XP_003139210.1|  cyclophilin Ovcyp-2                              78.2    5e-15   
ref|NP_080628.1|  peptidyl-prolyl cis-trans isomerase D               80.1    5e-15   
ref|XP_011110619.1|  hypothetical protein H072_4724                   80.1    5e-15   
ref|XP_010268679.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase   78.2    5e-15   
ref|XP_003393779.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.1    5e-15   
ref|NP_001276071.1|  uncharacterized protein LOC102623101             78.2    5e-15   
ref|XP_006829301.1|  hypothetical protein AMTR_s00001p00273100        80.1    5e-15   
pdb|4JJM|A  Chain A, Structure Of A Cyclophilin From Citrus Sinen...  78.2    5e-15   
ref|XP_011306836.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.5    5e-15   
ref|XP_009377655.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase   78.2    5e-15   
ref|XP_007042358.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  80.1    5e-15   
ref|XP_006406344.1|  hypothetical protein EUTSA_v10022161mg           78.2    5e-15   
ref|XP_003578523.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  78.6    5e-15   
emb|CDS13662.1|  hypothetical protein LRAMOSA05836                    80.1    5e-15   
ref|XP_010107982.1|  Peptidyl-prolyl cis-trans isomerase CYP40        80.1    5e-15   
ref|XP_001994815.1|  GH17446                                          82.0    5e-15   
ref|XP_307775.3|  AGAP003265-PA                                       80.1    5e-15   
gb|EMD33306.1|  hypothetical protein CERSUDRAFT_117929                79.7    6e-15   
ref|XP_007436535.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.1    6e-15   
ref|XP_006694995.1|  putative cis-trans protein                       80.1    6e-15   
gb|EPY40565.1|  peptidyl-prolyl cis-trans isomerase A (cyclophili...  78.2    6e-15   
ref|XP_003607272.1|  Peptidyl-prolyl cis-trans isomerase              77.8    6e-15   
gb|AFK43730.1|  unknown                                               77.8    6e-15   
ref|XP_007551094.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.1    6e-15   
emb|CCI50088.1|  unnamed protein product                              79.0    6e-15   
ref|XP_002963528.1|  hypothetical protein SELMODRAFT_165790           77.8    6e-15   
emb|CBJ93268.1|  cyclophilin                                          77.8    6e-15   
gb|EKC19829.1|  NK-tumor recognition protein                          80.9    6e-15   
ref|XP_006673697.1|  peptidyl-prolyl cis-trans isomerase              79.7    6e-15   
ref|XP_001328636.1|  cytosolic cyclophilin                            77.8    6e-15   
gb|KIY53846.1|  peptidyl-prolyl cis-trans isomerase                   80.1    6e-15   
ref|XP_010066256.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase   77.8    6e-15   
ref|XP_004708796.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  79.7    6e-15   
ref|XP_007131600.1|  hypothetical protein PHAVU_011G026900g           77.8    7e-15   
ref|XP_008796575.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.1    7e-15   
ref|XP_008584596.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  80.1    7e-15   
emb|CDO97146.1|  unnamed protein product                              79.7    7e-15   
emb|CCX06772.1|  Similar to 41 kDa peptidyl-prolyl cis-trans isom...  79.7    7e-15   
gb|AEV66153.1|  cyclophilin                                           77.8    7e-15   
ref|XP_004883006.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  79.7    7e-15   
gb|ABV22152.1|  cyclophilin                                           77.8    7e-15   
ref|XP_005401022.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  79.7    7e-15   
gb|KIH50843.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...  75.5    7e-15   



>ref|XP_011084184.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
 ref|XP_011084254.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
 ref|XP_011084337.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
Length=784

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  220  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            K++KKKVLVFLDV IDGDPFERM+FELFTDVAPKTAENFRALCTGEKG S KTG  LHYK
Sbjct  3    KINKKKVLVFLDVSIDGDPFERMIFELFTDVAPKTAENFRALCTGEKGVSLKTGKPLHYK  62

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  63   GTFFHRI  69



>ref|XP_009618666.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nicotiana tomentosiformis]
Length=799

 Score =   124 bits (312),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            MSKKK LVFLDV IDGDP ERMVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVERMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  403  TFFHHI  420
            TFFH I
Sbjct  61   TFFHRI  66



>ref|XP_009618667.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nicotiana tomentosiformis]
Length=797

 Score =   124 bits (311),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            MSKKK LVFLDV IDGDP ERMVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVERMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  403  TFFHHI  420
            TFFH I
Sbjct  61   TFFHRI  66



>gb|EYU29231.1| hypothetical protein MIMGU_mgv1a002140mg [Erythranthe guttata]
Length=709

 Score =   123 bits (309),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  220  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            K++K+K+LVFLDV +DGDPFERM+FELFTDVAPKTAENFRALCTGEKG S KTG  LHYK
Sbjct  3    KVNKRKLLVFLDVSVDGDPFERMIFELFTDVAPKTAENFRALCTGEKGVSVKTGKPLHYK  62

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  63   GTFFHRI  69



>ref|XP_006364269.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Solanum tuberosum]
Length=807

 Score =   122 bits (305),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            MSKKK  VFLDV IDGDP ER+ FELFTDVAPKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKPQVFLDVSIDGDPVERLAFELFTDVAPKTAENFRALCTGEKGVSSKTGRPLHYKG  60

Query  403  TFFHHI  420
            TFFHHI
Sbjct  61   TFFHHI  66



>gb|EYU29230.1| hypothetical protein MIMGU_mgv1a002072mg [Erythranthe guttata]
Length=719

 Score =   121 bits (304),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 55/67 (82%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  220  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            KMSK+K LVF DV +DGDP ERMVFELFTDVAP+TAENFRALCTGEKG S KTG  LHYK
Sbjct  4    KMSKRKPLVFFDVSVDGDPLERMVFELFTDVAPRTAENFRALCTGEKGASLKTGRPLHYK  63

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  64   GTFFHRI  70



>ref|XP_009783532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nicotiana sylvestris]
Length=799

 Score =   121 bits (304),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            MSKKK LVFLDV IDGDP E MVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVETMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  403  TFFHHI  420
            TFFH I
Sbjct  61   TFFHRI  66



>ref|XP_009783537.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nicotiana sylvestris]
Length=797

 Score =   121 bits (304),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            MSKKK LVFLDV IDGDP E MVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVETMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  403  TFFHHI  420
            TFFH I
Sbjct  61   TFFHRI  66



>ref|XP_004245196.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Solanum lycopersicum]
Length=807

 Score =   120 bits (301),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            MSKKK  VFLDV IDGDP ERM FELFTDVAPKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKPQVFLDVSIDGDPVERMAFELFTDVAPKTAENFRALCTGEKGVSSKTGRPLHYKG  60

Query  403  TFFHHI  420
            TFFH I
Sbjct  61   TFFHRI  66



>gb|EPS68763.1| hypothetical protein M569_06004, partial [Genlisea aurea]
Length=756

 Score =   118 bits (295),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  220  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            K+ KK+V VF DV +DGDP+ERM+FELF DVAPKTAENFRALCTGEKGTS  TG  LHYK
Sbjct  3    KIKKKRVSVFFDVSVDGDPYERMIFELFADVAPKTAENFRALCTGEKGTSVTTGKPLHYK  62

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  63   GTFFHRI  69



>emb|CDP04788.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   117 bits (294),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            MSK+K LVFLDV IDGDPFERM+FELFTDVAPKTAENFRALCTGE+G S +    LHYKG
Sbjct  1    MSKQKPLVFLDVSIDGDPFERMIFELFTDVAPKTAENFRALCTGEEGESSRAKRPLHYKG  60

Query  403  TFFHHI  420
            TFFH I
Sbjct  61   TFFHRI  66



>gb|KHN08115.1| Peptidyl-prolyl cis-trans isomerase D [Glycine soja]
Length=805

 Score =   117 bits (294),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHQI  67



>gb|KHN07093.1| Peptidyl-prolyl cis-trans isomerase D [Glycine soja]
Length=824

 Score =   117 bits (294),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHQI  67



>ref|XP_006581365.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Glycine max]
Length=837

 Score =   117 bits (294),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHQI  67



>ref|XP_010648638.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Vitis vinifera]
Length=795

 Score =   117 bits (294),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LV+LDV IDGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_002285000.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Vitis vinifera]
 ref|XP_010648637.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Vitis vinifera]
Length=796

 Score =   117 bits (294),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LV+LDV IDGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_003523694.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Glycine max]
 ref|XP_006578153.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Glycine max]
Length=843

 Score =   117 bits (294),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHQI  67



>ref|XP_003526420.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Glycine max]
 ref|XP_006581364.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Glycine max]
Length=850

 Score =   117 bits (294),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHQI  67



>ref|XP_011081940.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP95-like [Sesamum indicum]
Length=754

 Score =   117 bits (293),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  220  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            K   KK LVFLDV IDGDP ERM+FELFTDVAP+TAENFRALCTGEKG S KTG  LHYK
Sbjct  3    KTKGKKQLVFLDVSIDGDPVERMIFELFTDVAPRTAENFRALCTGEKGVSAKTGKPLHYK  62

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  63   GTFFHRI  69



>emb|CBI21007.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   114 bits (286),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LV+LDV IDGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>gb|AES58972.2| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=772

 Score =   117 bits (292),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  +VF+DV +DGDP+E+MVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MAKKKNSMVFMDVSVDGDPYEKMVFELFYDVAPKTAENFRALCTGEKGVSPNTGKSLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHQI  67



>ref|XP_006483322.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Citrus sinensis]
Length=792

 Score =   117 bits (292),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK +LVF+DV IDGDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYK
Sbjct  1    MAKKKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH +
Sbjct  61   GSFFHRV  67



>ref|XP_006450486.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63726.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
Length=792

 Score =   117 bits (292),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK +LVF+DV IDGDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYK
Sbjct  1    MAKKKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH +
Sbjct  61   GSFFHRV  67



>ref|XP_006483320.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483321.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO61676.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
 gb|KDO61677.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
 gb|KDO61678.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
Length=801

 Score =   117 bits (292),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK +LVF+DV IDGDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYK
Sbjct  1    MAKKKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH +
Sbjct  61   GSFFHRV  67



>ref|XP_006450487.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 ref|XP_006450488.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63727.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63728.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
Length=801

 Score =   117 bits (292),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK +LVF+DV IDGDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYK
Sbjct  1    MAKKKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH +
Sbjct  61   GSFFHRV  67



>ref|XP_008445168.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Cucumis 
melo]
 ref|XP_008445170.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Cucumis 
melo]
Length=779

 Score =   116 bits (291),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 55/67 (82%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVFLDV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNPLVFLDVSIDGDPRERMVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_004138866.1| PREDICTED: uncharacterized protein LOC101210345 [Cucumis sativus]
Length=774

 Score =   116 bits (291),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK +LVFLDV IDGDP ER+VFELF DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNLLVFLDVSIDGDPRERLVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>gb|KGN62922.1| hypothetical protein Csa_2G380020 [Cucumis sativus]
Length=784

 Score =   116 bits (291),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK +LVFLDV IDGDP ER+VFELF DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNLLVFLDVSIDGDPRERLVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>emb|CAN80313.1| hypothetical protein VITISV_020758 [Vitis vinifera]
Length=728

 Score =   116 bits (290),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LV+LDV IDGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>gb|KDP33623.1| hypothetical protein JCGZ_07194 [Jatropha curcas]
Length=789

 Score =   116 bits (290),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDPFERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MAKKKNPLVFIDVSIDGDPFERMVFELFYDIAPKTAENFRALCTGEKGIGPKTGRPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHCI  67



>ref|XP_008394052.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X2 [Malus 
domestica]
Length=835

 Score =   116 bits (290),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV +DGDP+ERMVFELF+DV PKTAENFRALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPYERMVFELFSDVVPKTAENFRALCTGEQGISPKSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_008394051.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G isoform X1 [Malus 
domestica]
Length=856

 Score =   116 bits (290),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV +DGDP+ERMVFELF+DV PKTAENFRALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPYERMVFELFSDVVPKTAENFRALCTGEQGISPKSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_004501305.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Cicer arietinum]
Length=838

 Score =   115 bits (288),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/67 (79%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  LVF+DV IDGDP E+MVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  4    MSKKKNPLVFMDVSIDGDPVEKMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  63

Query  400  GTFFHHI  420
            G+FFH +
Sbjct  64   GSFFHQV  70



>gb|KHG19968.1| Peptidyl-prolyl cis-trans isomerase cyp5 [Gossypium arboreum]
Length=702

 Score =   115 bits (287),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MAKKKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH +
Sbjct  61   GSFFHRV  67



>ref|XP_007161232.1| hypothetical protein PHAVU_001G053000g [Phaseolus vulgaris]
 gb|ESW33226.1| hypothetical protein PHAVU_001G053000g [Phaseolus vulgaris]
Length=895

 Score =   115 bits (288),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGE+G  P TG +LHYK
Sbjct  1    MAKKKNCLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGERGVGPSTGKSLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010670670.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670671.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670672.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=768

 Score =   115 bits (287),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/67 (79%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KK+  LVFLDV IDGDP+ERMVFELF+DV PKTAENFRALCTGEKG  PK G  LHYK
Sbjct  1    MAKKRNPLVFLDVSIDGDPYERMVFELFSDVVPKTAENFRALCTGEKGVGPKLGKPLHYK  60

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  61   GTFFHRI  67



>ref|XP_008347718.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp5-like [Malus 
domestica]
Length=87

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK   VF+DV +DGDP+ERMVFELF+DVAPKTAENFRALCTGE+G  PK+   LHYKG+F
Sbjct  4    KKNPFVFMDVSVDGDPYERMVFELFSDVAPKTAENFRALCTGEQGIGPKSRKPLHYKGSF  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_007161231.1| hypothetical protein PHAVU_001G052900g [Phaseolus vulgaris]
 gb|ESW33225.1| hypothetical protein PHAVU_001G052900g [Phaseolus vulgaris]
Length=915

 Score =   115 bits (288),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGE G SP TG +LHYK
Sbjct  1    MAKKKNSLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGESGVSPNTGKSLHYK  60

Query  400  GTFFHHI  420
            G+FFH +
Sbjct  61   GSFFHRV  67



>ref|XP_010670673.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=765

 Score =   115 bits (287),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/67 (79%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KK+  LVFLDV IDGDP+ERMVFELF+DV PKTAENFRALCTGEKG  PK G  LHYK
Sbjct  1    MAKKRNPLVFLDVSIDGDPYERMVFELFSDVVPKTAENFRALCTGEKGVGPKLGKPLHYK  60

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  61   GTFFHRI  67



>ref|XP_004164532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp5-like, partial 
[Cucumis sativus]
Length=296

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK +LVFLDV IDGDP ER+VFELF DVAPKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNLLVFLDVSIDGDPRERLVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_007161230.1| hypothetical protein PHAVU_001G052800g [Phaseolus vulgaris]
 gb|ESW33224.1| hypothetical protein PHAVU_001G052800g [Phaseolus vulgaris]
Length=933

 Score =   115 bits (287),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGE+G  P TG +LHYK
Sbjct  1    MAKKKNSLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGERGVGPNTGKSLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_007225294.1| hypothetical protein PRUPE_ppa001326mg [Prunus persica]
 gb|EMJ26493.1| hypothetical protein PRUPE_ppa001326mg [Prunus persica]
Length=854

 Score =   114 bits (286),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV +DGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPVERMVFELFSDVAPKTAENFRALCTGEKGIGPKSGRPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_002324283.2| hypothetical protein POPTR_0018s01460g [Populus trichocarpa]
 gb|EEF02848.2| hypothetical protein POPTR_0018s01460g [Populus trichocarpa]
Length=819

 Score =   114 bits (286),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  LVF+DVCIDGDP ERMVFELF+D+APKTAENFRALCTGEKG  PK+   LHYKG+F
Sbjct  8    KKNPLVFMDVCIDGDPKERMVFELFSDIAPKTAENFRALCTGEKGIGPKSERPLHYKGSF  67

Query  409  FHHI  420
            FH I
Sbjct  68   FHRI  71



>ref|XP_011026475.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Populus euphratica]
Length=794

 Score =   114 bits (285),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  LVF+D+CIDGDP ERMVFELF+D+APKTAENFRALCTGE G  PK+G  LHYKG+F
Sbjct  8    KKNPLVFMDLCIDGDPKERMVFELFSDIAPKTAENFRALCTGETGIGPKSGRPLHYKGSF  67

Query  409  FHHI  420
            FH I
Sbjct  68   FHRI  71



>ref|XP_011026473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
 ref|XP_011026474.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
Length=795

 Score =   114 bits (285),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  LVF+D+CIDGDP ERMVFELF+D+APKTAENFRALCTGE G  PK+G  LHYKG+F
Sbjct  8    KKNPLVFMDLCIDGDPKERMVFELFSDIAPKTAENFRALCTGETGIGPKSGRPLHYKGSF  67

Query  409  FHHI  420
            FH I
Sbjct  68   FHRI  71



>ref|XP_011019778.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X4 [Populus euphratica]
Length=805

 Score =   114 bits (285),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  220  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  64   GSFFHRI  70



>ref|XP_011019776.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Populus euphratica]
Length=815

 Score =   114 bits (285),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  220  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  64   GSFFHRI  70



>ref|XP_011019775.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
Length=816

 Score =   114 bits (285),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  220  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  64   GSFFHRI  70



>ref|XP_007013817.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 ref|XP_007013819.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 gb|EOY31436.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 gb|EOY31438.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
Length=843

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV +DGDP ERM+FELF D+APKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MAKKKNPLVFMDVSVDGDPVERMIFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH +
Sbjct  61   GSFFHRV  67



>gb|KJB07784.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=722

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MAKKKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH +
Sbjct  61   GSFFHRV  67



>ref|XP_011019781.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X6 [Populus euphratica]
Length=810

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  220  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  64   GSFFHRI  70



>ref|XP_011019777.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Populus euphratica]
Length=811

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  220  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  64   GSFFHRI  70



>ref|XP_007013820.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 4 [Theobroma 
cacao]
 gb|EOY31439.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 4 [Theobroma 
cacao]
Length=858

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV +DGDP ERM+FELF D+APKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  16   MAKKKNPLVFMDVSVDGDPVERMIFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYK  75

Query  400  GTFFHHI  420
            G+FFH +
Sbjct  76   GSFFHRV  82



>gb|KJB07776.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07777.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07787.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07788.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=801

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MAKKKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH +
Sbjct  61   GSFFHRV  67



>gb|KJB07775.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07778.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07785.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=799

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MAKKKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH +
Sbjct  61   GSFFHRV  67



>ref|XP_004498656.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Cicer arietinum]
 ref|XP_004498657.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Cicer arietinum]
Length=773

 Score =   114 bits (284),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 53/67 (79%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  +VFLDV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG S  TG +LHYK
Sbjct  1    MAKKKNPMVFLDVSIDGDPAERMVFELFYDVAPKTAENFRALCTGEKGVSSNTGKSLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHQI  67



>ref|XP_008219899.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
 ref|XP_008219900.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
Length=843

 Score =   114 bits (284),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV +DGDP ERMVFELF+DVAP+TAENFRALCTGEKG  PK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPVERMVFELFSDVAPRTAENFRALCTGEKGIGPKSGRPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>gb|KJB07770.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
 gb|KJB07771.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
 gb|KJB07772.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
 gb|KJB07773.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
Length=787

 Score =   112 bits (281),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP ERMVFELF D+APKT ENFRALCTGEKG  P+TG  LHYK
Sbjct  1    MAKKKNPLVFMDVSIDGDPVERMVFELFPDIAPKTVENFRALCTGEKGIGPRTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH +
Sbjct  61   GSFFHRV  67



>ref|XP_009334770.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Pyrus x bretschneideri]
Length=846

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV +DGDP+ERMVFELF+DV PKTAENF ALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKTAENFHALCTGEQGISPKSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_009334769.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Pyrus x bretschneideri]
Length=854

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV +DGDP+ERMVFELF+DV PKTAENF ALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKTAENFHALCTGEQGISPKSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_009345297.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Pyrus 
x bretschneideri]
Length=1043

 Score =   112 bits (280),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV +DGDP+ERMVFELF+DV PKTAENF ALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKTAENFHALCTGEQGISPKSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_004291478.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011459211.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=761

 Score =   111 bits (278),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+D+CIDGDP E+MVFELF D APKTA+NFRALCTGEKG  PK+G  LHYK
Sbjct  1    MAKKKNPLVFMDLCIDGDPAEKMVFELFYDRAPKTADNFRALCTGEKGIGPKSGRPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010048238.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X4 [Eucalyptus grandis]
Length=794

 Score =   111 bits (278),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  403  TFFHHI  420
            +FFH I
Sbjct  62   SFFHRI  67



>ref|XP_010048237.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Eucalyptus grandis]
 gb|KCW80434.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
 gb|KCW80435.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=796

 Score =   111 bits (278),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  403  TFFHHI  420
            +FFH I
Sbjct  62   SFFHRI  67



>ref|XP_010048236.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Eucalyptus grandis]
Length=797

 Score =   111 bits (278),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  403  TFFHHI  420
            +FFH I
Sbjct  62   SFFHRI  67



>ref|XP_010048233.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010048234.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010048235.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 gb|KCW80436.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=799

 Score =   111 bits (278),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  403  TFFHHI  420
            +FFH I
Sbjct  62   SFFHRI  67



>gb|KCW80440.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
 gb|KCW80441.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=695

 Score =   110 bits (276),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  403  TFFHHI  420
            +FFH I
Sbjct  62   SFFHRI  67



>ref|XP_008378304.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8-like isoform 
X2 [Malus domestica]
Length=826

 Score =   111 bits (277),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV +DGDP+ERMVFELF+DVAPKTAENFRALCTGE+G  PK+   LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVAPKTAENFRALCTGEQGIGPKSRKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_008378303.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
Length=517

 Score =   109 bits (272),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV +DGDP+ERMVFELF+DVAPKTAENFRALCTGE+G  PK+   LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVAPKTAENFRALCTGEQGIGPKSRKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>gb|KCW80439.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=614

 Score =   110 bits (274),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  403  TFFHHI  420
            +FFH I
Sbjct  62   SFFHRI  67



>gb|AES73684.2| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=895

 Score =   110 bits (275),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVF+DV IDGDP +RMVFELF DVAPKTAENFRALCTGE+G S  TG  LHYK
Sbjct  4    MTKKKNPLVFMDVSIDGDPVKRMVFELFHDVAPKTAENFRALCTGERGISSNTGKLLHYK  63

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  64   GSFFHQI  70



>ref|XP_002515550.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
 gb|EEF46999.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
Length=729

 Score =   109 bits (273),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = +1

Query  220  KMSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHY  396
            +M+K+K  +VF+DV IDGDPFERMVFELF + APKT ENFRALCTGEKG  PKTG  LHY
Sbjct  4    EMAKRKNPMVFMDVSIDGDPFERMVFELFPEFAPKTVENFRALCTGEKGIGPKTGRPLHY  63

Query  397  KGTFFHHI  420
            KG+FFH I
Sbjct  64   KGSFFHCI  71



>emb|CDX75243.1| BnaA01g04590D [Brassica napus]
Length=765

 Score =   109 bits (272),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   V++DVCIDGDP E MVFELF DVAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVYMDVCIDGDPAETMVFELFPDVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>emb|CDX68845.1| BnaC01g06080D [Brassica napus]
Length=765

 Score =   108 bits (271),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   V++DVCIDGDP E MVFELF DVAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVYMDVCIDGDPAETMVFELFPDVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_009126010.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Brassica rapa]
 ref|XP_009126018.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Brassica rapa]
Length=760

 Score =   108 bits (270),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   V++DVCIDGDP E MVFELF DVAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVYMDVCIDGDPAETMVFELFPDVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>gb|KJB07786.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=807

 Score =   107 bits (268),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 52/73 (71%), Positives = 57/73 (78%), Gaps = 7/73 (10%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFE------LFTDVAPKTAENFRALCTGEKGTSPKTG  381
            M+KKK  LVF+DV IDGDP ERMVFE      LF D+APKTAENFRALCTGEKG  PKTG
Sbjct  1    MAKKKNPLVFMDVSIDGDPAERMVFEFSLILQLFPDIAPKTAENFRALCTGEKGIGPKTG  60

Query  382  ATLHYKGTFFHHI  420
              LHYKG+FFH +
Sbjct  61   KPLHYKGSFFHRV  73



>ref|NP_001190888.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE86056.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=820

 Score =   105 bits (262),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|NP_194968.2| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 ref|NP_001190889.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 sp|Q8RWY7.2|CYP95_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP95; Short=AtCYP95; 
Short=PPIase CYP95; AltName: Full=Cyclophilin-like 
protein CypRS92 [Arabidopsis thaliana]
 gb|AEE86054.1| peptidylprolyl isomerase [Arabidopsis thaliana]
 gb|AEE86057.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=837

 Score =   105 bits (262),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010037119.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Eucalyptus 
grandis]
Length=158

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            M KK +LVF+DV IDGDP ERM+FELF +VAPKTAENFRAL TGEKG   KTG  LH KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMIFELFPEVAPKTAENFRALYTGEKGIGQKTGRPLHLKG  61

Query  403  TFFHHI  420
            +FFH I
Sbjct  62   SFFHRI  67



>ref|XP_002867244.1| hypothetical protein ARALYDRAFT_491484 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43503.1| hypothetical protein ARALYDRAFT_491484 [Arabidopsis lyrata subsp. 
lyrata]
Length=845

 Score =   105 bits (262),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>emb|CAA22569.1| putative protein [Arabidopsis thaliana]
 emb|CAB79959.1| putative protein [Arabidopsis thaliana]
Length=857

 Score =   105 bits (262),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010249988.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nelumbo nucifera]
Length=806

 Score =   105 bits (262),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+K+K  LVFLDV IDGDP E+M+FELF DV P+TAENFRALCTGEKG    TG  LHYK
Sbjct  1    MTKRKNPLVFLDVSIDGDPAEKMIFELFHDVVPRTAENFRALCTGEKGIGSTTGKHLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010249986.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010249987.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nelumbo nucifera]
Length=807

 Score =   105 bits (261),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+K+K  LVFLDV IDGDP E+M+FELF DV P+TAENFRALCTGEKG    TG  LHYK
Sbjct  1    MTKRKNPLVFLDVSIDGDPAEKMIFELFHDVVPRTAENFRALCTGEKGIGSTTGKHLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_006382072.1| hypothetical protein POPTR_0006s26710g [Populus trichocarpa]
 gb|ERP59869.1| hypothetical protein POPTR_0006s26710g [Populus trichocarpa]
Length=842

 Score =   105 bits (261),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 51/84 (61%), Positives = 56/84 (67%), Gaps = 17/84 (20%)
 Frame = +1

Query  220  KMSKKKVLVFLDVCIDGDPFERMVFE-----------------LFTDVAPKTAENFRALC  348
            KM+KK  LVF+DVCIDGDP ERMVFE                 LF D+APKT ENFRALC
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFEVSSCFKFQPCRMDDEIPLFLDIAPKTVENFRALC  63

Query  349  TGEKGTSPKTGATLHYKGTFFHHI  420
            TGEKG  PK+   LHYKG+FFH I
Sbjct  64   TGEKGIGPKSQRPLHYKGSFFHRI  87



>ref|XP_007050461.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 2 [Theobroma cacao]
 gb|EOX94618.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 2 [Theobroma cacao]
Length=557

 Score =   103 bits (258),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  LVFLDV +DGDP ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDPVERIIIELFADVVPKTAENFRALCTGEKGVGKSTGKPLHYK  60

Query  400  GTFFHHI  420
            G+F H I
Sbjct  61   GSFLHRI  67



>ref|XP_010437912.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=806

 Score =   104 bits (260),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010447391.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=824

 Score =   104 bits (260),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>gb|KHG30308.1| Peptidyl-prolyl cis-trans isomerase cyp5 [Gossypium arboreum]
Length=196

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  LVF+DV IDGDP ERM   LF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERM---LFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  60

Query  409  FHHI  420
            FH +
Sbjct  61   FHRV  64



>ref|XP_010447392.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=822

 Score =   104 bits (260),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010437913.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=805

 Score =   104 bits (260),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_007050460.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOX94617.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 1 [Theobroma cacao]
Length=676

 Score =   103 bits (258),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  LVFLDV +DGDP ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDPVERIIIELFADVVPKTAENFRALCTGEKGVGKSTGKPLHYK  60

Query  400  GTFFHHI  420
            G+F H I
Sbjct  61   GSFLHRI  67



>ref|XP_010432721.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=829

 Score =   103 bits (257),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010432719.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=846

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010432723.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X4 [Camelina sativa]
Length=808

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010432722.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Camelina sativa]
Length=825

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_006412476.1| hypothetical protein EUTSA_v10024440mg [Eutrema salsugineum]
 gb|ESQ53929.1| hypothetical protein EUTSA_v10024440mg [Eutrema salsugineum]
Length=810

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   V++DVCIDGDP E MVFELF +VAPKT+ENFRALCTGEKG   ++G  LHYK
Sbjct  1    MAKKKNPQVYMDVCIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGLRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010028211.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Eucalyptus grandis]
Length=155

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            M+KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRAL T EKG   KTG  LH KG
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALYTEEKGIGQKTGRPLHLKG  61

Query  403  TFFHHI  420
            +FFH I
Sbjct  62   SFFHRI  67



>ref|XP_010646137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Vitis vinifera]
 emb|CBI25055.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =   102 bits (254),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MTKKKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_002280876.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Vitis vinifera]
Length=702

 Score =   102 bits (254),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MTKKKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>gb|AAM13845.1| unknown protein [Arabidopsis thaliana]
 gb|AAS75312.1| multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase 
[Arabidopsis thaliana]
Length=837

 Score =   102 bits (254),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++   LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSRKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>emb|CAN75764.1| hypothetical protein VITISV_034442 [Vitis vinifera]
Length=786

 Score =   102 bits (253),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MTKKKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_002520955.1| cyclophilin, putative [Ricinus communis]
 gb|EEF41372.1| cyclophilin, putative [Ricinus communis]
Length=688

 Score =   101 bits (252),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  LV+ DV IDGDP ER+V ELF DVAPKTAENFRALCTGE G    TG  LHYK
Sbjct  1    MSKKKNPLVYFDVSIDGDPVERIVIELFADVAPKTAENFRALCTGEMGIGKTTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_008802286.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Phoenix dactylifera]
Length=682

 Score =   101 bits (252),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVFLD+ +DGD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYK
Sbjct  1    MAKKKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYK  60

Query  400  GTFFHHI  420
            G+ FH I
Sbjct  61   GSIFHRI  67



>ref|XP_008802283.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802284.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Phoenix dactylifera]
Length=685

 Score =   101 bits (252),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVFLD+ +DGD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYK
Sbjct  1    MAKKKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYK  60

Query  400  GTFFHHI  420
            G+ FH I
Sbjct  61   GSIFHRI  67



>ref|XP_002306802.2| hypothetical protein POPTR_0005s23730g [Populus trichocarpa]
 gb|EEE93798.2| hypothetical protein POPTR_0005s23730g [Populus trichocarpa]
Length=673

 Score =   101 bits (252),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  LVFLDV IDGDP ER+  ELF DV P+TAENFRALCTGEKGT   TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSIDGDPAERIFIELFADVVPRTAENFRALCTGEKGTGKTTGKPLHYK  60

Query  400  GTFFHHI  420
            G+ FH I
Sbjct  61   GSSFHRI  67



>ref|XP_006443960.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 ref|XP_006479627.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Citrus sinensis]
 ref|XP_006479628.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Citrus sinensis]
 gb|ESR57200.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 gb|KDO68607.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=650

 Score =   101 bits (252),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_008802287.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X4 [Phoenix dactylifera]
Length=681

 Score =   101 bits (252),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVFLD+ +DGD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYK
Sbjct  1    MAKKKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYK  60

Query  400  GTFFHHI  420
            G+ FH I
Sbjct  61   GSIFHRI  67



>ref|XP_008802285.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Phoenix dactylifera]
Length=684

 Score =   101 bits (252),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVFLD+ +DGD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYK
Sbjct  1    MAKKKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYK  60

Query  400  GTFFHHI  420
            G+ FH I
Sbjct  61   GSIFHRI  67



>gb|KDO68605.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=622

 Score =   101 bits (251),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>gb|KDO68608.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=658

 Score =   101 bits (251),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_006443959.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 ref|XP_006479629.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Citrus sinensis]
 gb|ESR57199.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 gb|KDO68606.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=643

 Score =   101 bits (251),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_010110347.1| Peptidyl-prolyl cis-trans isomerase 1 [Morus notabilis]
 gb|EXC26034.1| Peptidyl-prolyl cis-trans isomerase 1 [Morus notabilis]
Length=860

 Score =   101 bits (252),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 10/76 (13%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFEL---------FTDVAPKTAENFRALCTGEKGTSP  372
            M+K+K  +VF+DV IDGDP E+MVFEL         F D+APKTAENFRALCTGEKG  P
Sbjct  1    MAKRKNSMVFMDVSIDGDPAEKMVFELIDYSFTQQLFFDIAPKTAENFRALCTGEKGIGP  60

Query  373  KTGATLHYKGTFFHHI  420
            ++G  LHYKG+FFH I
Sbjct  61   QSGRPLHYKGSFFHRI  76



>ref|XP_004498655.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Cicer arietinum]
Length=812

 Score =   101 bits (251),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 53/89 (60%), Positives = 57/89 (64%), Gaps = 23/89 (26%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCT----------------  351
            M+KKK  +VFLDV IDGDP ERMVFELF DVAPKTAENFRALCT                
Sbjct  1    MAKKKNPMVFLDVSIDGDPAERMVFELFYDVAPKTAENFRALCTGNITFDLHGTFLFLLK  60

Query  352  ------GEKGTSPKTGATLHYKGTFFHHI  420
                  GEKG S  TG +LHYKG+FFH I
Sbjct  61   SVILHSGEKGVSSNTGKSLHYKGSFFHQI  89



>gb|KDP21391.1| hypothetical protein JCGZ_21862 [Jatropha curcas]
Length=716

 Score =   100 bits (249),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSK+K  LVF DV IDGDP ER+ FELF +  PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKRKNPLVFFDVSIDGDPVERIAFELFANFVPKTAENFRALCTGEKGIGKTTGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_006838913.1| hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda]
 gb|ERN01482.1| hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda]
Length=795

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  LVFLDV I GDP  +MVFELF+DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MAKKKNSLVFLDVSIGGDPAGKMVFELFSDVVPKTAENFRALCTGEKGIGQVTGKPLHYK  60

Query  400  GTFFHHI  420
            G+ FH I
Sbjct  61   GSIFHRI  67



>ref|XP_006283087.1| hypothetical protein CARUB_v10004106mg [Capsella rubella]
 gb|EOA15985.1| hypothetical protein CARUB_v10004106mg [Capsella rubella]
Length=879

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  250  LDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            +DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+FFH I
Sbjct  1    MDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSFFHRI  57



>ref|XP_010038050.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Eucalyptus grandis]
 gb|KCW49849.1| hypothetical protein EUGRSUZ_K03321 [Eucalyptus grandis]
Length=664

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+K+K  LVFLDV IDGDP ER+V ELF D  P+TAENFR+LCTGEKG    TG  LHYK
Sbjct  1    MTKRKNPLVFLDVSIDGDPVERIVIELFADTVPRTAENFRSLCTGEKGVGKTTGKPLHYK  60

Query  400  GTFFHHI  420
            G++FH I
Sbjct  61   GSYFHRI  67



>ref|XP_010935780.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Elaeis 
guineensis]
Length=703

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 47/68 (69%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +1

Query  220  KMSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHY  396
            KM+KKK  LVFLD+ IDG+  ER+V ELF+DV PKTAENFRALCTGEKG    TG +LHY
Sbjct  6    KMAKKKNPLVFLDISIDGNRAERIVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHY  65

Query  397  KGTFFHHI  420
            KG+ FH I
Sbjct  66   KGSIFHRI  73



>ref|XP_010038051.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Eucalyptus grandis]
Length=661

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+K+K  LVFLDV IDGDP ER+V ELF D  P+TAENFR+LCTGEKG    TG  LHYK
Sbjct  1    MTKRKNPLVFLDVSIDGDPVERIVIELFADTVPRTAENFRSLCTGEKGVGKTTGKPLHYK  60

Query  400  GTFFHHI  420
            G++FH I
Sbjct  61   GSYFHRI  67



>ref|XP_011032623.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Populus 
euphratica]
 ref|XP_011032624.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Populus 
euphratica]
Length=680

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  LVFLDV IDGDP ER+  ELF DV P+TAENFRALCTGEKG    TG  LHYKG+ 
Sbjct  4    KKNPLVFLDVSIDGDPAERIFIELFADVVPRTAENFRALCTGEKGIGKTTGKPLHYKGSS  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_002302085.2| hypothetical protein POPTR_0002s04800g [Populus trichocarpa]
 gb|EEE81358.2| hypothetical protein POPTR_0002s04800g [Populus trichocarpa]
Length=688

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/66 (70%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            + KK  LVFLDV IDGDP ER+  ELF DV PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    IKKKNPLVFLDVSIDGDPAERIFIELFADVVPKTAENFRALCTGEKGIGKTTGKPLHYKG  61

Query  403  TFFHHI  420
              FH I
Sbjct  62   CSFHRI  67



>gb|AJA29688.1| peptidyl-prolyl cis-trans isomerase [Betula luminifera]
Length=695

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK   VFLD+ IDGDP ER+V ELF DV PKTAENFRALCTGEKG    TG  LHY+G++
Sbjct  4    KKNPFVFLDLSIDGDPVERIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYRGSY  63

Query  409  FHHI  420
             H I
Sbjct  64   LHRI  67



>ref|XP_010527616.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Tarenaya hassleriana]
Length=634

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010546569.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010546570.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Tarenaya hassleriana]
Length=845

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VF+DV IDGDP E MVFELF +VAP TA+NFRALCTGEKG   ++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPNTADNFRALCTGEKGVGLRSGKPLHYK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHKI  67



>ref|XP_010527615.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Tarenaya hassleriana]
Length=636

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010527620.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X5 [Tarenaya hassleriana]
Length=631

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010527617.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Tarenaya hassleriana]
Length=633

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010527621.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X6 [Tarenaya hassleriana]
Length=629

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010527619.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X4 [Tarenaya hassleriana]
Length=631

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>ref|XP_010527622.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X7 [Tarenaya hassleriana]
Length=541

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>gb|KJB25951.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=602

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  61   GTFFHRI  67



>ref|XP_010527623.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X8 [Tarenaya hassleriana]
Length=538

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>gb|KJB25952.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=626

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  61   GTFFHRI  67



>ref|XP_010527624.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X9 [Tarenaya hassleriana]
Length=536

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  400  GTFFHHI  420
            G+FFH I
Sbjct  61   GSFFHRI  67



>gb|KJB25950.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=599

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  61   GTFFHRI  67



>gb|KJB25949.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=661

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  61   GTFFHRI  67



>gb|KJB25953.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=634

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  61   GTFFHRI  67



>emb|CDP03680.1| unnamed protein product [Coffea canephora]
Length=664

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  LVF DV IDG P ER+  ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFFDVSIDGSPAERITIELFADVVPKTAENFRALCTGEKGIGSSTGKPLHYK  60

Query  400  GTFFHHI  420
            G+ FH I
Sbjct  61   GSSFHRI  67



>ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
Length=818

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 43/63 (68%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  232  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  411
            K   VFLDV I   P ERMVFELF D+ PKTAENFRALCTGEKG  P TG  LHY+G+ F
Sbjct  5    KNPTVFLDVAIGRGPAERMVFELFADIVPKTAENFRALCTGEKGVGPSTGKPLHYRGSIF  64

Query  412  HHI  420
            H I
Sbjct  65   HRI  67



>ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
 ref|XP_010925251.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
 ref|XP_010925252.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
Length=842

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 43/63 (68%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  232  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  411
            K   VFLDV I G P ERMVFELF D+ PKTAENFRALCTGEKG    TG  LHY+G+ F
Sbjct  5    KNPTVFLDVAIGGGPAERMVFELFADIVPKTAENFRALCTGEKGVGSTTGKPLHYRGSIF  64

Query  412  HHI  420
            H I
Sbjct  65   HRI  67



>ref|XP_010274266.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Nelumbo nucifera]
Length=695

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            + K   LVFLD+ IDG+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    VKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKG  61

Query  403  TFFHHI  420
            + FH I
Sbjct  62   SIFHRI  67



>ref|XP_010274264.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010274265.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Nelumbo nucifera]
Length=696

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            + K   LVFLD+ IDG+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    VKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKG  61

Query  403  TFFHHI  420
            + FH I
Sbjct  62   SIFHRI  67



>ref|XP_010274267.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X3 [Nelumbo nucifera]
Length=693

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            + K   LVFLD+ IDG+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    VKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKG  61

Query  403  TFFHHI  420
            + FH I
Sbjct  62   SIFHRI  67



>gb|KHG26228.1| Peptidyl-prolyl cis-trans isomerase D [Gossypium arboreum]
Length=177

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKKV-LVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  400  GTFFHHI  420
            GTF H I
Sbjct  61   GTFLHRI  67



>ref|XP_007199724.1| hypothetical protein PRUPE_ppa002435mg [Prunus persica]
 gb|EMJ00923.1| hypothetical protein PRUPE_ppa002435mg [Prunus persica]
Length=673

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK   VFLDV  DGDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_010274268.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X4 [Nelumbo nucifera]
Length=691

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            + K   LVFLD+ IDG+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    VKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKG  61

Query  403  TFFHHI  420
            + FH I
Sbjct  62   SIFHRI  67



>ref|XP_008235346.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G isoform X2 [Prunus 
mume]
Length=669

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK   VFLDV  DGDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_008235345.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
Length=670

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK   VFLDV  DGDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_008235347.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Prunus 
mume]
Length=665

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK   VFLDV  DGDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_009798520.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798521.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798522.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
Length=660

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  LVFLDV IDG+P ER+V ELF D+ P+TAENFR+LCTGEKG    TG  LHYKG  
Sbjct  4    KKNPLVFLDVSIDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYKGCL  63

Query  409  FHHI  420
            FH +
Sbjct  64   FHRV  67



>ref|XP_004493727.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Cicer arietinum]
Length=665

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            +K   VFLDV +DGDP ER+V ELF+ + PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPCVFLDVSVDGDPVERIVIELFSSIVPKTAENFRALCTGEKGIGESTGKPLHYKGTC  63

Query  409  FHHI  420
            FH +
Sbjct  64   FHRV  67



>ref|XP_008792090.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008792091.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
Length=845

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/63 (68%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +1

Query  232  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  411
            K   VFLDV I G P  RMVFELF D+ PKTAENFRALCTGEKG  P T   LHYKG+ F
Sbjct  5    KNPTVFLDVAIGGGPSRRMVFELFADIVPKTAENFRALCTGEKGIGPTTRKPLHYKGSIF  64

Query  412  HHI  420
            H I
Sbjct  65   HRI  67



>ref|XP_003603433.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=943

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 56/96 (58%), Gaps = 30/96 (31%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTG---------------  354
            M+KKK  LVF+DV IDGDP +RMVFELF DVAPKTAENFRALCTG               
Sbjct  4    MTKKKNPLVFMDVSIDGDPVKRMVFELFHDVAPKTAENFRALCTGILNFNLFADYSFLLS  63

Query  355  --------------EKGTSPKTGATLHYKGTFFHHI  420
                          E+G S  TG  LHYKG+FFH I
Sbjct  64   KVAFSSIPVFYYPRERGISSNTGKLLHYKGSFFHQI  99



>gb|KEH23833.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=651

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/63 (68%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  232  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  411
            K   VF DV +DGDP ER+V ELF+ V PKTAENFRALCTGEKG    TG  LHYKGT F
Sbjct  5    KNPCVFFDVSVDGDPVERIVIELFSSVVPKTAENFRALCTGEKGIGEATGKPLHYKGTSF  64

Query  412  HHI  420
            H I
Sbjct  65   HRI  67



>ref|XP_004146961.1| PREDICTED: uncharacterized protein LOC101219904 [Cucumis sativus]
 gb|KGN44769.1| hypothetical protein Csa_7G378580 [Cucumis sativus]
Length=668

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  LVFLDV I G+P +R++ ELF +V PKTA+NFRALCTGEKG    T   LHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  61   GTFFHRI  67



>ref|XP_008451290.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 [Cucumis melo]
Length=669

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  LVFLDV I G+P +R++ ELF +V PKTA+NFRALCTGEKG    T   LHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  61   GTFFHRI  67



>ref|XP_004162194.1| PREDICTED: uncharacterized LOC101219904 [Cucumis sativus]
Length=655

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  LVFLDV I G+P +R++ ELF +V PKTA+NFRALCTGEKG    T   LHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  400  GTFFHHI  420
            GTFFH I
Sbjct  61   GTFFHRI  67



>ref|XP_008355416.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like [Malus 
domestica]
 ref|XP_008355417.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like [Malus 
domestica]
Length=595

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV ID DP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPCVFLDVSIDRDPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKLLHYK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSTFHRV  67



>ref|XP_009601160.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Nicotiana tomentosiformis]
Length=661

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  LVFLDV +DG+P ER+V ELF D+ P+TAENFR+LCTGEKG    TG  LHYKG  
Sbjct  4    KKNPLVFLDVSMDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYKGCL  63

Query  409  FHHI  420
            FH +
Sbjct  64   FHRV  67



>ref|XP_009601158.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana tomentosiformis]
Length=662

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  LVFLDV +DG+P ER+V ELF D+ P+TAENFR+LCTGEKG    TG  LHYKG  
Sbjct  4    KKNPLVFLDVSMDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYKGCL  63

Query  409  FHHI  420
            FH +
Sbjct  64   FHRV  67



>ref|XP_009370747.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Pyrus x 
bretschneideri]
Length=535

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV ID DP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPRVFLDVSIDRDPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSTFHRV  67



>ref|XP_009419289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419290.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=819

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            M+K+  +VFLDV IDG+   R++FELF D+ PKTAENFRALCTGE G  P T   LHYKG
Sbjct  1    MAKRNPIVFLDVAIDGNAAGRLMFELFADIVPKTAENFRALCTGEMGFGPMTKKPLHYKG  60

Query  403  TFFHHI  420
            + FH I
Sbjct  61   SIFHRI  66



>ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Elaeis guineensis]
Length=836

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  232  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  411
            K+  VFLDV I G P  RMVFELF D+ PKTAENFRALCTGEKG    TG  LHY+G+ F
Sbjct  5    KRPTVFLDVAIGGRPSGRMVFELFADIVPKTAENFRALCTGEKGIGHTTGKPLHYRGSIF  64

Query  412  HHI  420
            H I
Sbjct  65   HRI  67



>ref|XP_006349731.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like [Solanum 
tuberosum]
Length=658

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  LVFLDV IDGD  E++V ELF D  P+TAENFR+LCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSIDGDTAEKIVIELFADTVPRTAENFRSLCTGEKGVGVSTGKPLHYK  60

Query  400  GTFFHHI  420
            G  FH +
Sbjct  61   GCLFHRV  67



>ref|XP_006604473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X5 [Glycine max]
Length=635

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            +K  LVF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_006604472.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X4 [Glycine max]
Length=640

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            +K  LVF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_006604471.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Glycine max]
 gb|KHN02546.1| Peptidyl-prolyl cis-trans isomerase [Glycine soja]
Length=659

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            +K  LVF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_004247203.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Solanum lycopersicum]
Length=660

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  LVFLDV +DGD  E++V ELF D  P+TAENFR+LCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDAAEKIVIELFADTVPRTAENFRSLCTGEKGVGVSTGKPLHYK  60

Query  400  GTFFHHI  420
            G  FH +
Sbjct  61   GCLFHRV  67



>ref|XP_010028213.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X5 [Eucalyptus grandis]
Length=129

 Score = 87.4 bits (215),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 53/84 (63%), Gaps = 18/84 (21%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFE------------------LFTDVAPKTAENFRALC  348
            M+KK +LVF+DV IDGDP ERMVFE                  LF +VAPKTAENFRAL 
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFEILHNPYLLISFLVNPIQQLFPEVAPKTAENFRALY  61

Query  349  TGEKGTSPKTGATLHYKGTFFHHI  420
            T EKG   KTG  LH KG+FFH I
Sbjct  62   TEEKGIGQKTGRPLHLKGSFFHRI  85



>ref|XP_006604469.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Glycine max]
 ref|XP_006604470.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Glycine max]
Length=664

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            +K  LVF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|XP_009381127.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=832

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KK   +VFLDV IDG    RMVFELF D+ PKTAENFRALCTGE G  P T   LHYK
Sbjct  1    MAKKNNPIVFLDVAIDGKAAGRMVFELFADIVPKTAENFRALCTGEMGIGPTTKKPLHYK  60

Query  400  GTFFHHI  420
            G+ FH I
Sbjct  61   GSVFHRI  67



>ref|XP_010028212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X4 [Eucalyptus grandis]
Length=135

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 53/84 (63%), Gaps = 18/84 (21%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFE------------------LFTDVAPKTAENFRALC  348
            M+KK +LVF+DV IDGDP ERMVFE                  LF +VAPKTAENFRAL 
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFEILHNPYLLISFLVNPIQQLFPEVAPKTAENFRALY  61

Query  349  TGEKGTSPKTGATLHYKGTFFHHI  420
            T EKG   KTG  LH KG+FFH I
Sbjct  62   TEEKGIGQKTGRPLHLKGSFFHRI  85



>ref|XP_008366534.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X2 [Malus domestica]
Length=533

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV ID  P E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPRVFLDVSIDRAPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSTFHRV  67



>ref|XP_008366532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
 ref|XP_008366533.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
Length=534

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV ID  P E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPRVFLDVSIDRAPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSTFHRV  67



>ref|XP_007162476.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 ref|XP_007162477.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 gb|ESW34470.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 gb|ESW34471.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
Length=663

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            +K V VF DV ID DP ER+V +LF  + PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNVRVFFDVSIDADPVERIVIQLFDSIVPKTAENFRALCTGEKGIGESTGKPLHYKGTS  63

Query  409  FHHI  420
            FH I
Sbjct  64   FHRI  67



>ref|NP_850740.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE80476.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
Length=387

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  4    KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSS  63

Query  409  FHHI  420
            FH +
Sbjct  64   FHRV  67



>ref|XP_009399354.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=694

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  226  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  405
            +KK   VFLD+ +D +P ERM  ELF DV PKTAENFRALCTGEKG    T   LHYKG+
Sbjct  3    TKKNPTVFLDISVDRNPAERMEIELFADVVPKTAENFRALCTGEKGIGDSTRLPLHYKGS  62

Query  406  FFHHI  420
            FFH I
Sbjct  63   FFHRI  67



>ref|XP_009399355.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=691

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  226  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  405
            +KK   VFLD+ +D +P ERM  ELF DV PKTAENFRALCTGEKG    T   LHYKG+
Sbjct  3    TKKNPTVFLDISVDRNPAERMEIELFADVVPKTAENFRALCTGEKGIGDSTRLPLHYKGS  62

Query  406  FFHHI  420
            FFH I
Sbjct  63   FFHRI  67



>ref|XP_011458604.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP63 [Fragaria vesca subsp. vesca]
Length=652

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKK-KVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKK    VFLDV I+  P ER+V ELF DVAPKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKANPCVFLDVSINEAPTERIVIELFADVAPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  400  GTFFHHI  420
            G+ FH I
Sbjct  61   GSQFHRI  67



>ref|XP_456922.1| DEHA2A13640p [Debaryomyces hansenii CBS767]
 sp|Q6BXZ7.1|PPID_DEBHA RecName: Full=Peptidyl-prolyl cis-trans isomerase D; Short=PPIase 
D; AltName: Full=Rotamase D [Debaryomyces hansenii CBS767]
 emb|CAG84900.1| DEHA2A13640p [Debaryomyces hansenii CBS767]
Length=370

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            VF D+  DG P  R+VFEL+ DV PKTAENFRALCTGEKG S  +G  LHYKG+ FH I
Sbjct  10   VFFDISADGKPKGRVVFELYNDVVPKTAENFRALCTGEKGASESSGKQLHYKGSIFHRI  68



>ref|XP_010028210.1| PREDICTED: uncharacterized protein LOC104418535 isoform X2 [Eucalyptus 
grandis]
Length=167

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 53/84 (63%), Gaps = 18/84 (21%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFE------------------LFTDVAPKTAENFRALC  348
            M+KK +LVF+DV IDGDP ERMVFE                  LF +VAPKTAENFRAL 
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFEILHNPYLLISFLVNPIQQLFPEVAPKTAENFRALY  61

Query  349  TGEKGTSPKTGATLHYKGTFFHHI  420
            T EKG   KTG  LH KG+FFH I
Sbjct  62   TEEKGIGQKTGRPLHLKGSFFHRI  85



>ref|XP_011026088.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Populus 
euphratica]
Length=694

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  LVFLDV IDGDP   +  ELF DV PKTAENFRALCTGEKG    TG  L YK
Sbjct  1    MSKKKNPLVFLDVSIDGDPAASIFIELFADVVPKTAENFRALCTGEKGIGKTTGKPLRYK  60

Query  400  GTFFHHI  420
            G  FH I
Sbjct  61   GCSFHRI  67



>ref|XP_010028209.1| PREDICTED: uncharacterized protein LOC104418535 isoform X1 [Eucalyptus 
grandis]
Length=173

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 53/84 (63%), Gaps = 18/84 (21%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFE------------------LFTDVAPKTAENFRALC  348
            M+KK +LVF+DV IDGDP ERMVFE                  LF +VAPKTAENFRAL 
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFEILHNPYLLISFLVNPIQQLFPEVAPKTAENFRALY  61

Query  349  TGEKGTSPKTGATLHYKGTFFHHI  420
            T EKG   KTG  LH KG+FFH I
Sbjct  62   TEEKGIGQKTGRPLHLKGSFFHRI  85



>dbj|BAH57223.1| AT3G63400 [Arabidopsis thaliana]
Length=570

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+K
Sbjct  1    MTKKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSSFHRV  67



>gb|EYU46533.1| hypothetical protein MIMGU_mgv1a002319mg [Erythranthe guttata]
Length=688

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +1

Query  232  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  411
            K  LVFL+V I+GD  ER+V ELF D  PKTAENFRALCTGEKG    TG  LHYKG  F
Sbjct  5    KNPLVFLEVSIEGDTAERIVIELFADTVPKTAENFRALCTGEKGVGTSTGKPLHYKGCTF  64

Query  412  HHI  420
            H I
Sbjct  65   HRI  67



>ref|NP_191899.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 ref|NP_001190169.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 sp|Q9LY75.1|CYP63_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP63; Short=AtCYP63; 
Short=PPIase CYP63; AltName: Full=Cyclophilin-63; 
AltName: Full=Cyclophilin-like protein CypRS64 [Arabidopsis 
thaliana]
 emb|CAB87793.1| cyclophylin-like protein [Arabidopsis thaliana]
 gb|AAN41315.1| putative cyclophylin protein [Arabidopsis thaliana]
 gb|AEE80475.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE80477.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
Length=570

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+K
Sbjct  1    MTKKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSSFHRV  67



>gb|KHN10697.1| Peptidyl-prolyl cis-trans isomerase [Glycine soja]
Length=727

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 49/74 (66%), Gaps = 5/74 (7%)
 Frame = +1

Query  214  ICKMSK-----KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKT  378
            +C +SK     K   VF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    T
Sbjct  53   MCLLSKVMGLEKNPRVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGEST  112

Query  379  GATLHYKGTFFHHI  420
            G  LHYKGT  H I
Sbjct  113  GKPLHYKGTSLHRI  126



>ref|XP_011079927.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Sesamum 
indicum]
Length=696

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +1

Query  226  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  405
            S K   VFLDV ID D  +R+V ELF DV PKTAENFRALCTGEKG    TG  LHYKG+
Sbjct  3    STKNPSVFLDVSIDSDTTQRIVIELFADVVPKTAENFRALCTGEKGVGSLTGKPLHYKGS  62

Query  406  FFHHI  420
             FH I
Sbjct  63   TFHRI  67



>ref|XP_010679140.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=658

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV I GDP +R+V ELF DV PKTAENFR LCTG KG    TG  LH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  400  GTFFHHI  420
            GT FH I
Sbjct  61   GTNFHRI  67



>ref|XP_010679138.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=659

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV I GDP +R+V ELF DV PKTAENFR LCTG KG    TG  LH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  400  GTFFHHI  420
            GT FH I
Sbjct  61   GTNFHRI  67



>ref|XP_010679137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=661

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV I GDP +R+V ELF DV PKTAENFR LCTG KG    TG  LH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  400  GTFFHHI  420
            GT FH I
Sbjct  61   GTNFHRI  67



>emb|CDX93909.1| BnaC04g20680D [Brassica napus]
Length=612

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK   VFLDV I GDP ER+V ELF  V PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  80   KKNPTVFLDVSIGGDPLERIVIELFAHVVPKTAENFRALCTGEAGLGKTTGKPLHFKGSS  139

Query  409  FHHI  420
            FH +
Sbjct  140  FHRV  143



>gb|AAS75310.1| multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase 
[Arabidopsis thaliana]
Length=566

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+K
Sbjct  1    MTKKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSSFHRV  67



>emb|CDK25020.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=363

 Score = 87.8 bits (216),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            MS+ +  VF DV I G+P  R+VFELF DV PKTAENFRALCTGEKG   ++G  LHYKG
Sbjct  1    MSEVRPRVFFDVSIGGEPTRRIVFELFADVVPKTAENFRALCTGEKGVG-QSGKPLHYKG  59

Query  403  TFFHHI  420
            + FH +
Sbjct  60   SIFHRV  65



>ref|XP_009388658.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388659.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388660.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=814

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  220  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            K  KK  +VFLDV +DG+   RMVFELF D+ PKTAENFRALCTGE G    T   LHYK
Sbjct  3    KKVKKNPIVFLDVSVDGNAARRMVFELFADIVPKTAENFRALCTGEIGFGLMTRKPLHYK  62

Query  400  GTFFHHI  420
            G+ FH I
Sbjct  63   GSIFHRI  69



>ref|XP_006647053.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Oryza brachyantha]
Length=845

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  +VF+DV I  +P ERM+FELF DVAP+TAENFRALCTGE G    T   L+YK
Sbjct  1    MAKKKNPIVFMDVAIGDEPDERMIFELFADVAPRTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSLFHRV  67



>ref|XP_006647052.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Oryza brachyantha]
Length=847

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  +VF+DV I  +P ERM+FELF DVAP+TAENFRALCTGE G    T   L+YK
Sbjct  1    MAKKKNPIVFMDVAIGDEPDERMIFELFADVAPRTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSLFHRV  67



>ref|XP_010268554.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Nelumbo 
nucifera]
Length=361

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  247  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            FLDV I G+   R+V EL+ DV PKTAENFRALCTGEKG  PKTGA LHYKG  FH I
Sbjct  7    FLDVSIGGELEGRIVVELYKDVVPKTAENFRALCTGEKGIGPKTGAPLHYKGVRFHRI  64



>ref|XP_003521263.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like [Glycine 
max]
Length=668

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            +K   VF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPRVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGESTGKPLHYKGTS  63

Query  409  FHHI  420
             H I
Sbjct  64   LHRI  67



>ref|XP_006290850.1| hypothetical protein CARUB_v10016960mg [Capsella rubella]
 gb|EOA23748.1| hypothetical protein CARUB_v10016960mg [Capsella rubella]
Length=551

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VFLDV I GDP ER+V ELF DV PKTAENFRALCTGE G    T   LH+K
Sbjct  1    MTKKKNPHVFLDVSIGGDPVERIVIELFADVVPKTAENFRALCTGEAGVGKTTTKPLHFK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSSFHRV  67



>gb|EEC72707.1| hypothetical protein OsI_06299 [Oryza sativa Indica Group]
Length=787

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  +VF+DV I  +P ERMVFELF DVAP+TAENFRALCTGE G    +   L+YK
Sbjct  1    MAKKKNPIVFMDVSIGDEPDERMVFELFADVAPRTAENFRALCTGEMGIGQTSKKPLYYK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSLFHRV  67



>ref|XP_006402278.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 ref|XP_006402279.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 gb|ESQ43731.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 gb|ESQ43732.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
Length=384

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKK    VFLDV + GDP ER+V ELF DV PKTAENFRALCTGE G    TG  L +K
Sbjct  1    MSKKNNPNVFLDVSLGGDPVERIVIELFADVVPKTAENFRALCTGEAGIGKTTGKPLQFK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSSFHRV  67



>gb|EEE56526.1| hypothetical protein OsJ_05815 [Oryza sativa Japonica Group]
Length=670

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK  +VF+DV I  +P ERMVFELF DVAP+TAENFRALCTGE G    +   L+YK
Sbjct  1    MAKKKNPIVFMDVSIGDEPDERMVFELFADVAPRTAENFRALCTGEMGIGQTSKKPLYYK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSLFHRV  67



>ref|XP_002876720.1| hypothetical protein ARALYDRAFT_324764 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52979.1| hypothetical protein ARALYDRAFT_324764 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    T   LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKTTRKPLHFK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSSFHRV  67



>gb|EDM00869.1| rCG62684, isoform CRA_b [Rattus norvegicus]
Length=116

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  226  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  405
            + K   VF DV I G+   R+V ELF D+ PKTAENFRALCTGEKGT P TG  LH+KG 
Sbjct  12   NSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGC  71

Query  406  FFHHI  420
             FH I
Sbjct  72   PFHRI  76



>gb|EPS61145.1| hypothetical protein M569_13654 [Genlisea aurea]
Length=565

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  232  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  411
            K   VFLD+ +DG+  ER+V ELF D  PKTAENFRALCTGEKG    TG  LHYKG  F
Sbjct  5    KNPFVFLDISVDGNAAERIVIELFADAVPKTAENFRALCTGEKGVGVSTGKPLHYKGITF  64

Query  412  HHI  420
            H I
Sbjct  65   HRI  67



>ref|XP_001651471.1| AAEL005799-PA, partial [Aedes aegypti]
 gb|EAT42690.1| AAEL005799-PA, partial [Aedes aegypti]
Length=218

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +1

Query  232  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  411
             K+  F D+ + G P  R+VFELF D+APKT ENFR+LCTGEKGT  KTG  LHYKG  F
Sbjct  14   NKIRCFFDITLGGLPAGRIVFELFPDIAPKTCENFRSLCTGEKGTGQKTGKPLHYKGIIF  73

Query  412  HHI  420
            H +
Sbjct  74   HRV  76



>gb|EYU44370.1| hypothetical protein MIMGU_mgv1a0089282mg, partial [Erythranthe 
guttata]
Length=268

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  247  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            +LD+ IDG+   R+V EL++DV P+TAENFRALCTGEKG SP++G  LHYKG+ F+ I
Sbjct  7    YLDISIDGEMEGRIVVELYSDVVPRTAENFRALCTGEKGISPRSGVPLHYKGSHFNSI  64



>ref|XP_010234012.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X4 [Brachypodium distachyon]
Length=829

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  +VFLDV I   P ERM+FELF DVAP TAENFRALCTGE G    T   L+YK
Sbjct  1    MSKKKNPIVFLDVSIGDGPDERMIFELFADVAPLTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSIFHRV  67



>ref|XP_010234011.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Brachypodium distachyon]
Length=830

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  +VFLDV I   P ERM+FELF DVAP TAENFRALCTGE G    T   L+YK
Sbjct  1    MSKKKNPIVFLDVSIGDGPDERMIFELFADVAPLTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSIFHRV  67



>ref|XP_010234010.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Brachypodium distachyon]
Length=831

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  +VFLDV I   P ERM+FELF DVAP TAENFRALCTGE G    T   L+YK
Sbjct  1    MSKKKNPIVFLDVSIGDGPDERMIFELFADVAPLTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSIFHRV  67



>ref|XP_010234009.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Brachypodium distachyon]
Length=834

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            MSKKK  +VFLDV I   P ERM+FELF DVAP TAENFRALCTGE G    T   L+YK
Sbjct  1    MSKKKNPIVFLDVSIGDGPDERMIFELFADVAPLTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSIFHRV  67



>ref|XP_010104463.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
 gb|EXC00996.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
Length=172

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 48/66 (73%), Gaps = 3/66 (5%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            MSK KV  F D+ I G P  R+V EL+ DV P+TAENFRALCTGEKGT  ++G  LHYKG
Sbjct  1    MSKSKV--FFDIAIGGSPAGRIVMELYADVTPRTAENFRALCTGEKGTG-RSGKPLHYKG  57

Query  403  TFFHHI  420
            + FH I
Sbjct  58   STFHRI  63



>ref|NP_001232291.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
 gb|ACH46307.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
Length=206

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRI  76



>ref|XP_010104462.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
 gb|EXC00995.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
Length=145

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 48/66 (73%), Gaps = 3/66 (5%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            MSK KV  F D+ I G P  R+V EL+ D+ P+TAENFRALCTGEKGT  ++G  LHYKG
Sbjct  1    MSKSKV--FFDIAIGGSPAGRIVMELYADMTPRTAENFRALCTGEKGTG-RSGKPLHYKG  57

Query  403  TFFHHI  420
            + FH I
Sbjct  58   STFHRI  63



>gb|AIZ68177.1| peptidyl-prolyl cis-trans isomerase CYP40-like protein [Ornithogalum 
saundersiae]
Length=367

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  247  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            +LD+ I G+   R+V EL+ DV PKTAENFRALCTGEKGT P TGA LHYKG  FH I
Sbjct  13   YLDISIGGELDGRIVVELYADVVPKTAENFRALCTGEKGTGPTTGAPLHYKGVRFHRI  70



>ref|XP_010028504.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Eucalyptus 
grandis]
 gb|KCW55241.1| hypothetical protein EUGRSUZ_I01174 [Eucalyptus grandis]
 gb|KCW55242.1| hypothetical protein EUGRSUZ_I01174 [Eucalyptus grandis]
Length=361

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  247  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            F+D+ I G+   R+V EL+TDVAPKTAENFRALCTGEKG  P TGA LHYKG  FH +
Sbjct  7    FMDISIGGELEGRIVGELYTDVAPKTAENFRALCTGEKGIGPHTGAPLHYKGVRFHRV  64



>gb|KJB17878.1| hypothetical protein B456_003G021400 [Gossypium raimondii]
 gb|KJB17879.1| hypothetical protein B456_003G021400 [Gossypium raimondii]
Length=361

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  247  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            ++D+ I G+P  R+V EL+ D+ PKTAENFRALCTGEKG  P TGA+LHYK   FH I
Sbjct  7    YMDISIGGEPEGRVVIELYKDIVPKTAENFRALCTGEKGIGPNTGASLHYKDVRFHRI  64



>ref|XP_006798990.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Neolamprologus 
brichardi]
Length=266

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            VFLDV IDG+   R+V ELF D+ PKTAENFRALCTGEKGT   TG  LH+KG  FH I
Sbjct  18   VFLDVDIDGERAGRIVLELFADITPKTAENFRALCTGEKGTGKSTGKPLHFKGCPFHRI  76



>ref|XP_003436324.1| AGAP002952-PB [Anopheles gambiae str. PEST]
 gb|EGK96689.1| AGAP002952-PB [Anopheles gambiae str. PEST]
Length=158

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  226  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  405
             ++K+  F DV + G P  R+VFELF  VAPKT ENFRALCTGEKG   KTG  LHYKG 
Sbjct  18   QQEKIRCFFDVSLGGLPAGRIVFELFPAVAPKTCENFRALCTGEKGIGQKTGKPLHYKGI  77

Query  406  FFHHI  420
             FH +
Sbjct  78   IFHRV  82



>ref|XP_001774773.1| predicted protein [Physcomitrella patens]
 gb|EDQ60444.1| predicted protein [Physcomitrella patens]
Length=358

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +1

Query  214  ICKMSKKKVLVFLDVCIDGDPFE-RMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATL  390
            +  M  K   VF D+ I GD  E R+V ELF DV P+TAENFRALCTGEKG  P TG  +
Sbjct  4    VAGMGSKNPKVFFDISI-GDELEGRIVMELFADVVPRTAENFRALCTGEKGIGPVTGRPM  62

Query  391  HYKGTFFHHI  420
            HYKGT FH +
Sbjct  63   HYKGTIFHRV  72



>gb|EMF14722.1| peptidyl-prolyl cis-trans isomerase 1 [Sphaerulina musiva SO2202]
Length=372

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            VF D+ I G P  ++VFEL+ D+ PKTAENFRALCTGEKG S K+ A LHYKG+ FH +
Sbjct  7    VFFDISIGGKPAGKVVFELYNDIVPKTAENFRALCTGEKGKSAKSQAPLHYKGSGFHRV  65



>ref|XP_010584392.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X2 [Haliaeetus 
leucocephalus]
Length=341

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRI  76



>ref|XP_001487732.1| hypothetical protein PGUG_01109 [Meyerozyma guilliermondii ATCC 
6260]
 gb|EDK37011.1| hypothetical protein PGUG_01109 [Meyerozyma guilliermondii ATCC 
6260]
Length=403

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            VF D+  DG    R+VFELF DV PKTAENFRALCTGEKG S K+G  LHYKG+ FH +
Sbjct  43   VFFDISCDGVKKGRVVFELFNDVVPKTAENFRALCTGEKGVSEKSGKPLHYKGSIFHRV  101



>ref|XP_008681079.1| PREDICTED: uncharacterized protein LOC100192934 isoform X2 [Zea 
mays]
 gb|AFW70622.1| hypothetical protein ZEAMMB73_258859 [Zea mays]
Length=829

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  +VFLDV +  +P ERM+FELF DVAP T ENFRALCTGE G   KT   L YKGT 
Sbjct  4    KKNPIVFLDVSVGDEPDERMIFELFADVAPLTTENFRALCTGELGIGQKTKKPLCYKGTL  63

Query  409  FHHI  420
            FH +
Sbjct  64   FHRV  67



>ref|XP_008681078.1| PREDICTED: uncharacterized protein LOC100192934 isoform X1 [Zea 
mays]
 gb|AFW70621.1| hypothetical protein ZEAMMB73_258859 [Zea mays]
Length=832

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK  +VFLDV +  +P ERM+FELF DVAP T ENFRALCTGE G   KT   L YKGT 
Sbjct  4    KKNPIVFLDVSVGDEPDERMIFELFADVAPLTTENFRALCTGELGIGQKTKKPLCYKGTL  63

Query  409  FHHI  420
            FH +
Sbjct  64   FHRV  67



>gb|ACH45652.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
 gb|ACH45653.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
Length=370

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRI  76



>ref|XP_005486377.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Zonotrichia 
albicollis]
Length=370

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRI  76



>ref|XP_010584391.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X1 [Haliaeetus 
leucocephalus]
Length=370

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRI  76



>emb|CDQ63777.1| unnamed protein product [Oncorhynchus mykiss]
Length=371

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  226  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  405
            +K+   VFLDV I G+   R+VFELF DV PKTAENFRALCTGEKGT   TG  LH+KG 
Sbjct  12   NKENPRVFLDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGKTTGKPLHFKGC  71

Query  406  FFHHI  420
             FH I
Sbjct  72   PFHRI  76



>ref|XP_010468852.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP63-like [Camelina sativa]
Length=591

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+KKK   VFLDV I  DP ER+V ELF DV PKTAENFRALCTGE G    T   LH+K
Sbjct  1    MTKKKNPFVFLDVSIGEDPVERIVIELFADVVPKTAENFRALCTGEAGVGKTTAKPLHFK  60

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  61   GSSFHRV  67



>gb|KFB52696.1| AGAP002952-PC-like protein [Anopheles sinensis]
Length=565

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +1

Query  226  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  405
            S++K+  F DV + G P  R+VFELF  VAPKT ENFRALCTGEKG   KTG  L+YKG 
Sbjct  14   SQEKIRCFFDVSLGGLPAGRIVFELFPSVAPKTCENFRALCTGEKGIGQKTGKPLYYKGI  73

Query  406  FFHHI  420
             FH +
Sbjct  74   IFHRV  78



>ref|XP_009138664.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Brassica 
rapa]
Length=556

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK   VFLDV I GDP ER+V ELF  + PKTAENFRALCTGE G    T   LH+KG+ 
Sbjct  6    KKNPTVFLDVSIGGDPLERIVIELFAHLVPKTAENFRALCTGEAGLGKTTSKPLHFKGSS  65

Query  409  FHHI  420
            FH +
Sbjct  66   FHRV  69



>emb|CDY53714.1| BnaAnng12550D [Brassica napus]
Length=556

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            KK   VFLDV I GDP ER+V ELF  + PKTAENFRALCTGE G    T   LH+KG+ 
Sbjct  6    KKNPTVFLDVSIGGDPLERIVIELFAHLVPKTAENFRALCTGEAGLGKTTSKPLHFKGSS  65

Query  409  FHHI  420
            FH +
Sbjct  66   FHRV  69



>gb|ACH70718.1| peptidylprolyl isomerase D (cyclophilin D) [Salmo salar]
Length=371

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  226  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  405
            +K+   VFLDV I G+   R+VFELF DV PKTAENFRALCTGEKGT   TG  LH+KG 
Sbjct  12   NKENPRVFLDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGKTTGKPLHFKGC  71

Query  406  FFHHI  420
             FH I
Sbjct  72   PFHRI  76



>ref|XP_005517649.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Pseudopodoces 
humilis]
Length=370

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRI  76



>ref|XP_005148983.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Melopsittacus 
undulatus]
Length=370

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  247  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I
Sbjct  19   FFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRI  76



>gb|ACO07673.1| 40 kDa peptidyl-prolyl cis-trans isomerase [Oncorhynchus mykiss]
Length=371

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  226  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  405
            +K+   VFLDV I G+   R+VFELF DV PKTAENFRALCTGEKGT   TG  LH+KG 
Sbjct  12   NKENPRVFLDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGKTTGKPLHFKGC  71

Query  406  FFHHI  420
             FH I
Sbjct  72   PFHRI  76



>gb|ACO08154.1| 40 kDa peptidyl-prolyl cis-trans isomerase [Oncorhynchus mykiss]
Length=371

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  226  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  405
            +K+   VFLDV I G+   R+VFELF DV PKTAENFRALCTGEKGT   TG  LH+KG 
Sbjct  12   NKENPRVFLDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGKTTGKPLHFKGC  71

Query  406  FFHHI  420
             FH I
Sbjct  72   PFHRI  76



>ref|XP_010512756.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Camelina 
sativa]
Length=658

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +1

Query  223  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  399
            M+K K  LVFLDV I  DP +R+V ELF DV PKTAENFRALCTGE G    T   LH+K
Sbjct  75   MTKNKNPLVFLDVSIGEDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKTTAKPLHFK  134

Query  400  GTFFHHI  420
            G+ FH +
Sbjct  135  GSSFHRV  141



>gb|KHG16182.1| Peptidyl-prolyl cis-trans isomerase CYP40 -like protein [Gossypium 
arboreum]
Length=361

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  247  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            ++D+ I G+   R+V EL+ D+ PKTAENFRALCTGEKG  P TGA+LHYKG  FH I
Sbjct  7    YMDISIGGELEGRIVIELYKDIVPKTAENFRALCTGEKGIGPNTGASLHYKGVRFHRI  64



>gb|ACH45651.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
Length=374

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRI  76



>ref|XP_004195205.1| Piso0_005752 [Millerozyma farinosa CBS 7064]
 emb|CCE87209.1| Piso0_005752 [Millerozyma farinosa CBS 7064]
Length=370

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            K+   VF DV  +G+   R+VF L++++ PKTAENFRALCTGEKGTS K+G  LHYKG+ 
Sbjct  5    KQGSKVFFDVSSNGEQKGRIVFNLYSNIVPKTAENFRALCTGEKGTSEKSGKPLHYKGSI  64

Query  409  FHHI  420
            FH +
Sbjct  65   FHRV  68



>ref|XP_003970715.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like, partial 
[Takifugu rubripes]
Length=174

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            VFLDV I G+   R+V ELF DVAPKTAENFRALCTGEKGT   TG  LH+KG  FH I
Sbjct  18   VFLDVDIGGERAGRLVLELFADVAPKTAENFRALCTGEKGTGKSTGKPLHFKGCPFHRI  76



>ref|XP_010999957.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 isoform 
X1 [Populus euphratica]
Length=370

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +1

Query  232  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  411
            ++   FLD+ I G+   R+V EL+ DV PKTAENFRALCTGEKG  P TGA LHYKG  F
Sbjct  2    RRSRCFLDISIGGELEGRIVIELYNDVVPKTAENFRALCTGEKGVGPNTGAPLHYKGCCF  61

Query  412  HHI  420
            H +
Sbjct  62   HRV  64



>ref|XP_001761081.1| predicted protein [Physcomitrella patens]
 gb|EDQ74148.1| predicted protein [Physcomitrella patens]
Length=371

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  223  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  402
            M  +   VF D+ I GD   R+VFELF DV PKTAENFRALCTGEKG    +G  LHYKG
Sbjct  8    MESRNPKVFFDISIGGDMEGRIVFELFADVVPKTAENFRALCTGEKGIGKISGRPLHYKG  67

Query  403  TFFHHI  420
              FH +
Sbjct  68   AVFHRV  73



>ref|XP_311948.5| AGAP002952-PA [Anopheles gambiae str. PEST]
 gb|EAA08127.6| AGAP002952-PA [Anopheles gambiae str. PEST]
Length=1000

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +1

Query  229  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  408
            ++K+  F DV + G P  R+VFELF  VAPKT ENFRALCTGEKG   KTG  LHYKG  
Sbjct  19   QEKIRCFFDVSLGGLPAGRIVFELFPAVAPKTCENFRALCTGEKGIGQKTGKPLHYKGII  78

Query  409  FHHI  420
            FH +
Sbjct  79   FHRV  82



>ref|XP_003715059.1| peptidyl-prolyl cis-trans isomerase [Magnaporthe oryzae 70-15]
 gb|EHA55252.1| peptidyl-prolyl cis-trans isomerase [Magnaporthe oryzae 70-15]
 gb|ELQ44226.1| 41 kDa peptidyl-prolyl cis-trans isomerase [Magnaporthe oryzae 
Y34]
 gb|ELQ70207.1| 41 kDa peptidyl-prolyl cis-trans isomerase [Magnaporthe oryzae 
P131]
Length=376

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            VF D+ ID  P  R+VFELF+DV PKTAENFRALCTGEKG   K+G  LHYKG+ FH +
Sbjct  14   VFFDISIDDKPAGRIVFELFSDVVPKTAENFRALCTGEKGIG-KSGKPLHYKGSSFHRV  71



>ref|XP_008454916.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like isoform 
X2 [Cucumis melo]
Length=269

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  235  KVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFH  414
            ++  FLD+ I GD   R+V ELF DV PKTAENFRALCTGEKG  P TG  LH+KG+ FH
Sbjct  3    RIRCFLDISIGGDLEGRIVVELFEDVVPKTAENFRALCTGEKGIGPHTGVPLHFKGSCFH  62

Query  415  HI  420
             +
Sbjct  63   RV  64



>gb|EMD94092.1| hypothetical protein COCHEDRAFT_1201904 [Bipolaris maydis C5]
 gb|ENI07606.1| hypothetical protein COCC4DRAFT_30972 [Bipolaris maydis ATCC 
48331]
Length=171

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +1

Query  244  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  420
            VF DV I GDP  R+V EL+ D  PKTAENFRALCTGEKGT  K+G  LHY+G+ FH +
Sbjct  6    VFFDVSIGGDPAGRIVMELYADKVPKTAENFRALCTGEKGTG-KSGKPLHYEGSVFHRV  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557844602525