BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF010E09

Length=498
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       131   8e-33   Nicotiana tomentosiformis
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       128   1e-31   Nicotiana sylvestris
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    123   6e-30   Nicotiana tomentosiformis
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    123   8e-30   Nicotiana tomentosiformis
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   5e-29   Solanum tuberosum [potatoes]
ref|XP_009353369.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       113   2e-28   
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            119   2e-28   Solanum lycopersicum
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            114   1e-26   Solanum lycopersicum
gb|KDO54650.1|  hypothetical protein CISIN_1g0100251mg                  112   3e-26   Citrus sinensis [apfelsine]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    112   5e-26   Pyrus x bretschneideri [bai li]
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    112   6e-26   Pyrus x bretschneideri [bai li]
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             112   7e-26   Citrus clementina [clementine]
ref|XP_006375529.1|  hypothetical protein POPTR_0014s15140g             110   2e-25   
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010278703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    110   3e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008379931.1|  PREDICTED: protein TRANSPARENT TESTA 12            109   4e-25   
emb|CDY39494.1|  BnaA01g24940D                                          110   4e-25   Brassica napus [oilseed rape]
emb|CDY19294.1|  BnaC01g31860D                                          110   4e-25   Brassica napus [oilseed rape]
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    110   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   8e-25   
emb|CDP11782.1|  unnamed protein product                                109   9e-25   Coffea canephora [robusta coffee]
emb|CDP11780.1|  unnamed protein product                                108   1e-24   Coffea canephora [robusta coffee]
ref|XP_003605914.1|  Transparent testa 12 protein                       108   2e-24   Medicago truncatula
emb|CDY19295.1|  BnaC01g31850D                                          106   2e-24   Brassica napus [oilseed rape]
emb|CDP17486.1|  unnamed protein product                                108   2e-24   Coffea canephora [robusta coffee]
ref|XP_008342001.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       106   3e-24   
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                    107   5e-24   Arabis alpina [alpine rockcress]
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            107   5e-24   Glycine max [soybeans]
emb|CDY38631.1|  BnaA05g19560D                                          107   7e-24   Brassica napus [oilseed rape]
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            107   7e-24   Vitis vinifera
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   7e-24   Brassica rapa
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       106   8e-24   Cucumis sativus [cucumbers]
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       106   1e-23   
emb|CBI28937.3|  unnamed protein product                                106   1e-23   Vitis vinifera
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   2e-23   Brassica rapa
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   2e-23   Cucumis melo [Oriental melon]
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg             105   3e-23   
ref|XP_007045634.1|  MATE efflux family protein isoform 2               103   4e-23   
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    104   4e-23   Cicer arietinum [garbanzo]
gb|KEH39009.1|  MATE efflux family protein                              103   8e-23   Medicago truncatula
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   9e-23   Prunus mume [ume]
emb|CBI28939.3|  unnamed protein product                                102   1e-22   Vitis vinifera
ref|XP_007045633.1|  MATE efflux family protein isoform 1               103   2e-22   
ref|XP_002883313.1|  mate efflux family protein                         103   2e-22   
ref|XP_003596992.1|  Transparent testa 12 protein                       102   2e-22   Medicago truncatula
ref|XP_010930078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    102   2e-22   Elaeis guineensis
emb|CDY69153.1|  BnaAnng29470D                                          101   2e-22   Brassica napus [oilseed rape]
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    102   3e-22   Elaeis guineensis
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   4e-22   Cicer arietinum [garbanzo]
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12            102   4e-22   
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12            102   4e-22   Tarenaya hassleriana [spider flower]
emb|CAN69305.1|  hypothetical protein VITISV_021605                     100   5e-22   Vitis vinifera
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   6e-22   Prunus mume [ume]
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   6e-22   Elaeis guineensis
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    101   6e-22   Vitis vinifera
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   8e-22   Brassica rapa
emb|CDY33129.1|  BnaCnng07000D                                          101   9e-22   Brassica napus [oilseed rape]
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12            101   9e-22   
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   1e-21   Cicer arietinum [garbanzo]
ref|XP_006406243.1|  hypothetical protein EUTSA_v10020526mg             100   1e-21   
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   1e-21   Elaeis guineensis
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   2e-21   Elaeis guineensis
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            100   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12          99.8    3e-21   Vitis vinifera
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg           99.8    3e-21   Eutrema salsugineum [saltwater cress]
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                          99.8    3e-21   Glycine soja [wild soybean]
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     99.8    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     99.8    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12          99.4    5e-21   Phoenix dactylifera
gb|KDO75455.1|  hypothetical protein CISIN_1g010798mg                 98.2    6e-21   Citrus sinensis [apfelsine]
gb|KDO75454.1|  hypothetical protein CISIN_1g010798mg                 98.2    6e-21   Citrus sinensis [apfelsine]
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                  98.2    1e-20   Arabis alpina [alpine rockcress]
gb|KGN43526.1|  hypothetical protein Csa_7G043680                     98.2    1e-20   Cucumis sativus [cucumbers]
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.8    1e-20   Brassica rapa
emb|CDY65669.1|  BnaCnng48120D                                        97.4    2e-20   Brassica napus [oilseed rape]
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                 97.4    2e-20   Citrus sinensis [apfelsine]
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg           97.4    2e-20   Capsella rubella
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.4    2e-20   Glycine max [soybeans]
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                          97.4    2e-20   Glycine soja [wild soybean]
gb|ACF85423.1|  unknown                                               97.4    2e-20   Zea mays [maize]
ref|NP_001148084.1|  transparent testa 12 protein                     97.4    2e-20   Zea mays [maize]
gb|ACZ55931.1|  MATE transporter 2                                    97.1    2e-20   Zea mays [maize]
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg           97.1    3e-20   Citrus clementina [clementine]
emb|CDY24250.1|  BnaC03g42230D                                        95.1    3e-20   Brassica napus [oilseed rape]
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.1    3e-20   Citrus sinensis [apfelsine]
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                  97.1    3e-20   Arabis alpina [alpine rockcress]
ref|XP_009362007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  96.3    3e-20   
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     96.7    4e-20   Cucumis melo [Oriental melon]
ref|XP_009345548.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  95.5    6e-20   Pyrus x bretschneideri [bai li]
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  95.9    8e-20   Pyrus x bretschneideri [bai li]
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.9    8e-20   Elaeis guineensis
emb|CDX92916.1|  BnaA03g36380D                                        95.5    9e-20   
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  95.9    9e-20   Pyrus x bretschneideri [bai li]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.5    1e-19   Prunus mume [ume]
emb|CDY39493.1|  BnaA01g24950D                                        95.5    1e-19   Brassica napus [oilseed rape]
gb|KJB57729.1|  hypothetical protein B456_009G178100                  93.6    1e-19   Gossypium raimondii
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg           95.5    1e-19   Prunus persica
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.1    1e-19   Eucalyptus grandis [rose gum]
dbj|BAJ34540.1|  unnamed protein product                              95.1    1e-19   Eutrema halophilum
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.1    1e-19   Fragaria vesca subsp. vesca
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g           95.1    1e-19   
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.1    1e-19   Cucumis melo [Oriental melon]
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg           94.7    1e-19   
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g           95.1    1e-19   
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12          94.7    2e-19   Vitis vinifera
ref|XP_004173828.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.8    2e-19   
gb|ACZ55932.1|  MATE transporter 2                                    94.7    2e-19   Zea mays [maize]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.7    2e-19   Vitis vinifera
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.4    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.4    3e-19   Brassica rapa
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.4    3e-19   Setaria italica
gb|KJB57730.1|  hypothetical protein B456_009G178100                  94.4    3e-19   Gossypium raimondii
gb|KJB57728.1|  hypothetical protein B456_009G178100                  94.4    3e-19   Gossypium raimondii
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g           94.0    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.0    4e-19   Populus euphratica
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g           94.0    4e-19   Phaseolus vulgaris [French bean]
gb|AGT17221.1|  transparent testa 12 protein                          94.0    4e-19   Saccharum hybrid cultivar R570
ref|NP_001149176.1|  transparent testa 12 protein                     93.6    5e-19   Zea mays [maize]
tpg|DAA50098.1|  TPA: putative MATE efflux family protein             92.8    5e-19   
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein            93.6    6e-19   Gossypium arboreum [tree cotton]
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg           93.2    6e-19   Citrus clementina [clementine]
ref|NP_188806.1|  MATE efflux family protein                          93.2    7e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20595.1|  integral membrane protein, putative                   92.8    7e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.8    9e-19   Cucumis sativus [cucumbers]
gb|KGN64598.1|  hypothetical protein Csa_1G071120                     92.8    9e-19   Cucumis sativus [cucumbers]
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.4    1e-18   
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.4    1e-18   Cucumis melo [Oriental melon]
gb|EMS63521.1|  Protein TRANSPARENT TESTA 12                          87.0    1e-18   Triticum urartu
gb|KJB69294.1|  hypothetical protein B456_011G014800                  92.0    2e-18   Gossypium raimondii
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g           92.0    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.0    2e-18   Populus euphratica
ref|XP_002518495.1|  multidrug resistance pump, putative              92.0    2e-18   Ricinus communis
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  92.0    2e-18   Populus euphratica
tpg|DAA50100.1|  TPA: putative MATE efflux family protein             92.0    2e-18   
gb|KJB69293.1|  hypothetical protein B456_011G014800                  92.0    2e-18   Gossypium raimondii
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.7    2e-18   Malus domestica [apple tree]
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...  92.0    2e-18   Zea mays [maize]
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.7    2e-18   
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.3    3e-18   
gb|KGN43522.1|  Mate efflux family protein                            91.3    3e-18   Cucumis sativus [cucumbers]
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.3    4e-18   
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     90.9    4e-18   Pyrus x bretschneideri [bai li]
ref|NP_001050524.1|  Os03g0572900                                     90.9    4e-18   
gb|ABF97220.1|  MATE efflux family protein, expressed                 90.9    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  90.9    4e-18   Cicer arietinum [garbanzo]
gb|EEC75610.1|  hypothetical protein OsI_12322                        90.9    4e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                     90.9    4e-18   
ref|XP_011048008.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  90.5    5e-18   Populus euphratica
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg              90.5    6e-18   Erythranthe guttata [common monkey flower]
ref|XP_008371179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     88.6    7e-18   
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     90.1    7e-18   
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  90.1    7e-18   Populus euphratica
emb|CDM85992.1|  unnamed protein product                              90.1    7e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g           90.1    8e-18   Phaseolus vulgaris [French bean]
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  90.1    8e-18   Populus euphratica
gb|KGN43524.1|  hypothetical protein Csa_7G043660                     89.7    9e-18   Cucumis sativus [cucumbers]
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.7    1e-17   Sesamum indicum [beniseed]
ref|XP_006348109.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  89.0    1e-17   Solanum tuberosum [potatoes]
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein            89.4    1e-17   Gossypium arboreum [tree cotton]
ref|XP_006467446.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  89.4    1e-17   Citrus sinensis [apfelsine]
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.4    2e-17   Brachypodium distachyon [annual false brome]
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  89.0    2e-17   Nicotiana tomentosiformis
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.0    2e-17   Prunus mume [ume]
gb|KJB30571.1|  hypothetical protein B456_005G149900                  89.0    2e-17   Gossypium raimondii
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  89.0    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_008364096.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  88.6    2e-17   
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                 88.6    2e-17   Citrus sinensis [apfelsine]
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  88.6    2e-17   Citrus sinensis [apfelsine]
ref|XP_006389634.1|  hypothetical protein POPTR_0021s00830g           88.6    2e-17   
ref|XP_008364095.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  88.6    2e-17   
ref|XP_006389638.1|  MATE efflux family protein                       88.6    3e-17   
gb|AAS01962.1|  putative MATE efflux family protein                   88.6    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  88.6    3e-17   
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  88.6    3e-17   
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  88.6    3e-17   
ref|XP_011048000.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  88.2    3e-17   Populus euphratica
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  88.2    3e-17   Solanum tuberosum [potatoes]
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  88.2    3e-17   Solanum tuberosum [potatoes]
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  88.2    3e-17   
emb|CDM86677.1|  unnamed protein product                              88.2    4e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     88.2    4e-17   Fragaria vesca subsp. vesca
gb|ABF97209.1|  MATE efflux family protein, expressed                 88.2    4e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                          88.2    4e-17   Triticum urartu
dbj|BAF47751.1|  multi antimicrobial extrusion family protein         88.2    4e-17   Nicotiana tabacum [American tobacco]
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     88.2    4e-17   Nicotiana sylvestris
gb|AHI48506.1|  multidrug and toxic extrusion transporter             88.2    4e-17   Vaccinium corymbosum [American blueberry]
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                          87.8    4e-17   
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g           87.8    5e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  87.8    5e-17   Populus euphratica
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2  87.8    5e-17   
ref|XP_007026054.1|  MATE efflux family protein isoform 1             87.8    5e-17   
gb|EEC75606.1|  hypothetical protein OsI_12318                        87.8    6e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  87.8    6e-17   Nicotiana sylvestris
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12          87.4    6e-17   Nelumbo nucifera [Indian lotus]
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.4    6e-17   Populus euphratica
ref|XP_006858200.1|  hypothetical protein AMTR_s00062p00173640        82.4    6e-17   
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.4    7e-17   Solanum lycopersicum
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.4    7e-17   Sesamum indicum [beniseed]
gb|KDP20755.1|  hypothetical protein JCGZ_21226                       85.5    1e-16   Jatropha curcas
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.7    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.7    1e-16   Nicotiana tomentosiformis
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg           86.7    1e-16   
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  86.7    1e-16   
ref|XP_007026056.1|  MATE efflux family protein                       86.3    2e-16   
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  86.3    2e-16   Brachypodium distachyon [annual false brome]
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.3    2e-16   Setaria italica
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg              85.9    2e-16   Erythranthe guttata [common monkey flower]
gb|KDP20759.1|  hypothetical protein JCGZ_21230                       84.0    2e-16   Jatropha curcas
gb|KCW76957.1|  hypothetical protein EUGRSUZ_D01316                   85.5    2e-16   Eucalyptus grandis [rose gum]
gb|EMT26283.1|  Protein TRANSPARENT TESTA 12                          80.5    2e-16   
gb|KDP20758.1|  hypothetical protein JCGZ_21229                       85.9    3e-16   Jatropha curcas
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.5    3e-16   
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg              85.5    3e-16   Erythranthe guttata [common monkey flower]
emb|CDM86692.1|  unnamed protein product                              85.5    3e-16   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.5    4e-16   Eucalyptus grandis [rose gum]
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.1    5e-16   Prunus mume [ume]
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.7    6e-16   Solanum tuberosum [potatoes]
gb|EMT13256.1|  hypothetical protein F775_42803                       79.7    6e-16   
ref|XP_008371177.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     82.8    7e-16   
emb|CBI23252.3|  unnamed protein product                              82.4    7e-16   Vitis vinifera
ref|XP_008371097.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     82.4    8e-16   
emb|CDM86687.1|  unnamed protein product                              84.3    9e-16   Triticum aestivum [Canadian hard winter wheat]
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg              84.0    1e-15   Erythranthe guttata [common monkey flower]
tpg|DAA50097.1|  TPA: putative MATE efflux family protein             80.5    1e-15   
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.0    1e-15   Solanum lycopersicum
ref|XP_007026057.1|  MATE efflux family protein                       83.6    2e-15   
gb|EPS67796.1|  hypothetical protein M569_06975                       83.2    2e-15   Genlisea aurea
gb|EPS61219.1|  hypothetical protein M569_13580                       79.7    2e-15   Genlisea aurea
emb|CDM86696.1|  unnamed protein product                              83.2    2e-15   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     83.2    2e-15   Populus euphratica
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     82.8    3e-15   Nicotiana sylvestris
ref|XP_010533819.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  80.9    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_010533821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  80.5    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  82.4    4e-15   Pyrus x bretschneideri [bai li]
ref|XP_010533820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  80.5    4e-15   Tarenaya hassleriana [spider flower]
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  82.4    4e-15   Pyrus x bretschneideri [bai li]
ref|XP_010533818.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  80.5    4e-15   Tarenaya hassleriana [spider flower]
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     82.4    4e-15   
gb|KDO78210.1|  hypothetical protein CISIN_1g043801mg                 79.3    5e-15   Citrus sinensis [apfelsine]
ref|XP_010533817.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  80.5    6e-15   
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     82.0    6e-15   Populus euphratica
ref|XP_002518493.1|  multidrug resistance pump, putative              81.6    7e-15   Ricinus communis
ref|XP_009618512.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  81.3    7e-15   Nicotiana tomentosiformis
ref|XP_009618511.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  81.3    7e-15   Nicotiana tomentosiformis
gb|ACG29464.1|  hypothetical protein                                  77.4    7e-15   Zea mays [maize]
gb|KDP20756.1|  hypothetical protein JCGZ_21227                       82.4    8e-15   Jatropha curcas
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     81.3    9e-15   Solanum lycopersicum
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g           81.3    9e-15   Populus trichocarpa [western balsam poplar]
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     81.3    1e-14   Populus euphratica
gb|ABK24492.1|  unknown                                               80.9    1e-14   Picea sitchensis
gb|ABR18290.1|  unknown                                               76.3    1e-14   Picea sitchensis
gb|KDP20757.1|  hypothetical protein JCGZ_21228                       79.0    1e-14   Jatropha curcas
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     80.1    2e-14   Solanum tuberosum [potatoes]
ref|XP_009614258.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  79.3    3e-14   
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  79.0    7e-14   Nicotiana tomentosiformis
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     78.6    9e-14   Tarenaya hassleriana [spider flower]
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     78.2    1e-13   Zea mays [maize]
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                          77.8    1e-13   Glycine soja [wild soybean]
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     77.8    1e-13   Glycine max [soybeans]
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     77.8    1e-13   Nicotiana sylvestris
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     77.4    2e-13   Zea mays [maize]
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg           77.8    2e-13   Eutrema salsugineum [saltwater cress]
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100        77.4    2e-13   Sorghum bicolor [broomcorn]
ref|NP_001147791.1|  transparent testa 12 protein                     76.6    4e-13   Zea mays [maize]
tpg|DAA62913.1|  TPA: putative MATE efflux family protein             76.6    4e-13   
gb|EMT19998.1|  hypothetical protein F775_52364                       77.0    4e-13   
ref|XP_011100216.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  75.5    8e-13   
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.5    8e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADE77677.1|  unknown                                               75.5    1e-12   Picea sitchensis
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  75.5    1e-12   Sesamum indicum [beniseed]
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg              75.5    1e-12   Erythranthe guttata [common monkey flower]
emb|CDP04391.1|  unnamed protein product                              75.1    1e-12   Coffea canephora [robusta coffee]
gb|AAM98160.1|  unknown protein                                       75.1    1e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDY07256.1|  BnaC04g19150D                                        71.2    1e-12   
ref|XP_002892653.1|  mate efflux family protein                       75.1    1e-12   
gb|EEE59382.1|  hypothetical protein OsJ_11498                        71.6    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_172632.1|  MATE efflux family protein                          75.1    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455546.1|  PREDICTED: MATE efflux family protein LAL5-like  72.0    1e-12   
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12          75.1    1e-12   
gb|AAR00637.1|  hypothetical protein                                  70.5    2e-12   
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     74.3    2e-12   
emb|CDY64820.1|  BnaA08g31640D                                        73.9    3e-12   
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.9    3e-12   
emb|CDY64933.1|  BnaCnng45550D                                        73.6    4e-12   
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg           73.6    4e-12   
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                  73.9    4e-12   
ref|XP_009123789.1|  PREDICTED: uncharacterized protein LOC103848693  69.7    4e-12   
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.2    4e-12   
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.6    4e-12   
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  73.6    4e-12   
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.6    4e-12   
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.2    6e-12   
gb|AAK82541.1|  At1g61890/F8K4_9                                      72.8    6e-12   
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                     73.2    6e-12   
ref|XP_002886501.1|  mate efflux family protein                       72.8    7e-12   
gb|KEH36840.1|  MATE efflux family protein                            72.8    7e-12   
ref|NP_564787.1|  MATE efflux family protein                          72.8    7e-12   
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.8    7e-12   
gb|EAY90715.1|  hypothetical protein OsI_12314                        71.2    9e-12   
emb|CDY25329.1|  BnaC01g29980D                                        72.4    9e-12   
emb|CDY47166.1|  BnaA01g22920D                                        72.4    1e-11   
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.4    1e-11   
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12          72.0    1e-11   
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.0    2e-11   
emb|CDX94061.1|  BnaC07g36950D                                        71.6    2e-11   
tpg|DAA40987.1|  TPA: putative MATE efflux family protein             71.6    2e-11   
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                  71.2    2e-11   
emb|CDY34637.1|  BnaC08g41960D                                        71.2    2e-11   
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  71.2    3e-11   
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  70.9    3e-11   
gb|EEC75604.1|  hypothetical protein OsI_12313                        70.1    6e-11   
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12          70.1    6e-11   
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.1    6e-11   
emb|CDX76391.1|  BnaA08g10090D                                        70.1    6e-11   
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg           70.1    7e-11   
emb|CDY69030.1|  BnaCnng61480D                                        65.9    8e-11   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                          69.7    8e-11   
emb|CDX94063.1|  BnaC07g36970D                                        69.7    8e-11   
emb|CDY34833.1|  BnaA09g47590D                                        69.3    1e-10   
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.9    1e-10   
ref|XP_006391951.1|  hypothetical protein EUTSA_v10023417mg           68.9    1e-10   
emb|CDX98712.1|  BnaA03g44970D                                        68.9    2e-10   
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg           68.2    2e-10   
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    3e-10   
emb|CDY12916.1|  BnaA09g13580D                                        68.2    3e-10   
emb|CDY19507.1|  BnaC09g13960D                                        68.2    3e-10   
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    3e-10   
ref|NP_001050520.1|  Os03g0570800                                     68.2    3e-10   
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg           67.8    3e-10   
emb|CDX98711.1|  BnaA03g44960D                                        67.8    4e-10   
emb|CDY27434.1|  BnaC03g64740D                                        67.8    4e-10   
ref|XP_002867814.1|  mate efflux family protein                       67.4    6e-10   
emb|CDY33130.1|  BnaCnng07010D                                        65.9    6e-10   
emb|CDX98713.1|  BnaA03g44980D                                        66.6    8e-10   
ref|XP_002518492.1|  multidrug resistance pump, putative              66.6    8e-10   
emb|CDY27431.1|  BnaC03g64710D                                        66.6    9e-10   
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  66.2    1e-09   
ref|XP_010439401.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     66.2    1e-09   
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     66.2    1e-09   
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  66.2    1e-09   
emb|CDX76392.1|  BnaA08g10080D                                        65.1    2e-09   
ref|XP_002867813.1|  mate efflux family protein                       65.1    3e-09   
emb|CAA17158.1|  putative protein                                     64.7    4e-09   
emb|CDX79109.1|  BnaA01g11760D                                        64.3    5e-09   
ref|XP_002867812.1|  hypothetical protein ARALYDRAFT_354580           61.2    5e-09   
tpg|DAA40993.1|  TPA: putative MATE efflux family protein             63.9    6e-09   
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg           63.9    6e-09   
dbj|BAH19969.1|  AT4G21910                                            63.9    7e-09   
ref|NP_974587.1|  MATE efflux family protein                          63.9    7e-09   
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg           63.9    7e-09   
ref|NP_001190793.1|  MATE efflux family protein                       63.9    8e-09   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1    63.5    8e-09   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.5    9e-09   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein             63.5    9e-09   
ref|XP_008667480.1|  PREDICTED: putative MATE efflux family prote...  63.5    9e-09   
gb|EEC75607.1|  hypothetical protein OsI_12319                        60.1    1e-08   
gb|AAS01961.1|  putative MatE domain containing protein, 3'-partial   61.2    2e-08   
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.8    2e-08   
dbj|BAJ88945.1|  predicted protein                                    58.5    3e-08   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg           61.6    4e-08   
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140        61.6    4e-08   
gb|AGT17223.1|  MATE efflux family protein                            61.6    4e-08   
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.2    5e-08   
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg           60.1    1e-07   
gb|EAY90719.1|  hypothetical protein OsI_12317                        59.7    1e-07   
ref|NP_567640.1|  MATE efflux family protein                          59.7    2e-07   
gb|AAM62936.1|  unknown                                               59.3    2e-07   
gb|EMT03955.1|  Protein TRANSPARENT TESTA 12                          58.9    3e-07   
ref|XP_006292391.1|  hypothetical protein CARUB_v10018603mg           58.5    4e-07   
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720        58.5    4e-07   
ref|NP_191462.1|  protein TRANSPARENT TESTA 12                        57.8    7e-07   
dbj|BAJ90668.1|  predicted protein                                    57.8    7e-07   
ref|XP_006402730.1|  hypothetical protein EUTSA_v10005907mg           57.8    8e-07   
gb|AHH83753.1|  multidrug and toxic extrusion transporter             57.4    9e-07   
ref|XP_002876486.1|  hypothetical protein ARALYDRAFT_907401           57.4    9e-07   
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg           57.4    9e-07   
ref|XP_010512133.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.4    9e-07   
ref|NP_001142368.1|  uncharacterized protein LOC100274540             57.4    9e-07   
emb|CAN60226.1|  hypothetical protein VITISV_039920                   57.0    1e-06   
gb|KFK35144.1|  hypothetical protein AALP_AA5G243900                  57.0    1e-06   
emb|CDX67772.1|  BnaA07g18120D                                        56.6    2e-06   
ref|XP_010504878.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     56.6    2e-06   
ref|XP_010504879.1|  PREDICTED: protein TRANSPARENT TESTA 12          56.2    2e-06   
gb|ACJ36215.1|  transparent testa 12                                  55.5    4e-06   
ref|XP_009104180.1|  PREDICTED: protein TRANSPARENT TESTA 12          55.1    5e-06   
gb|ACJ36211.1|  transparent testa 12 isoform 2                        55.1    5e-06   
ref|XP_004491273.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.1    6e-06   
ref|XP_010275892.1|  PREDICTED: protein TRANSPARENT TESTA 12          53.9    1e-05   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120        53.5    2e-05   
ref|XP_003617317.1|  Protein TRANSPARENT TESTA                        53.5    2e-05   
gb|ACX37118.1|  MATE transporter                                      53.5    2e-05   
ref|XP_010524117.1|  PREDICTED: protein TRANSPARENT TESTA 12          53.5    2e-05   
ref|XP_006836338.1|  hypothetical protein AMTR_s00092p00085880        52.8    3e-05   
gb|AET00276.2|  MATE efflux family protein                            52.8    3e-05   
ref|XP_003545155.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    5e-05   
gb|ACJ36209.1|  transparent testa 12 isoform 1                        52.0    5e-05   
ref|XP_010106306.1|  Protein TRANSPARENT TESTA 12                     52.0    6e-05   
ref|XP_004983423.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  51.6    7e-05   
ref|XP_004983424.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  50.8    1e-04   
gb|AGT17222.1|  MATE efflux family protein                            50.8    1e-04   
gb|KDO60642.1|  hypothetical protein CISIN_1g011371mg                 50.1    2e-04   
ref|XP_006426305.1|  hypothetical protein CICLE_v10025480mg           50.1    2e-04   
ref|NP_001049214.2|  Os03g0188000                                     47.8    2e-04   
gb|KDO60639.1|  hypothetical protein CISIN_1g011371mg                 50.1    2e-04   
ref|XP_006426307.1|  hypothetical protein CICLE_v10025480mg           50.1    2e-04   
ref|XP_004299689.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.1    2e-04   
gb|KDO60638.1|  hypothetical protein CISIN_1g011371mg                 50.1    2e-04   
gb|KJB64207.1|  hypothetical protein B456_010G037100                  50.1    2e-04   
ref|XP_010688832.1|  PREDICTED: protein TRANSPARENT TESTA 12          50.1    3e-04   
ref|XP_001774729.1|  predicted protein                                50.1    3e-04   
gb|KDO60641.1|  hypothetical protein CISIN_1g011371mg                 49.7    3e-04   
ref|XP_006426304.1|  hypothetical protein CICLE_v10025480mg           49.7    3e-04   
emb|CDP16070.1|  unnamed protein product                              49.7    3e-04   
gb|KDO60640.1|  hypothetical protein CISIN_1g011371mg                 49.7    3e-04   
ref|XP_010026078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.9    5e-04   
gb|AIW42903.1|  transparent testa 12                                  48.9    5e-04   
ref|XP_007141454.1|  hypothetical protein PHAVU_008G197000g           48.9    5e-04   
ref|XP_004308030.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.9    5e-04   
ref|XP_002516716.1|  multidrug resistance pump, putative              48.9    5e-04   
ref|XP_006466280.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.9    6e-04   
ref|XP_007048894.1|  TT12-2 MATE transporter                          48.9    6e-04   
gb|KDP35980.1|  hypothetical protein JCGZ_08375                       48.9    6e-04   
ref|XP_009588590.1|  PREDICTED: protein TRANSPARENT TESTA 12          48.5    7e-04   
ref|XP_004250128.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.5    8e-04   
ref|XP_009398326.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.5    9e-04   
ref|XP_007048895.1|  TT12-2 MATE transporter                          48.5    9e-04   



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  378
            MDSS    Y P  E++G  + SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNTYQPFLENNGTSNLSPQLSETHNFESSNELETVLLDTEIPFWSKLRLATWIEM  60

Query  379  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAAS
Sbjct  61   KLLFYLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAAS  100



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  378
            MDSS    Y P  +++G  S SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNIYQPFLDNNGNSSLSPQFSETHNFESSNELETVLLDTEIPLWNKLRLATWIEM  60

Query  379  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            KLL +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAAS
Sbjct  61   KLLFHLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAAS  100



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 76/100 (76%), Gaps = 4/100 (4%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  378
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  379  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  61   KLLFFLAAPAVMVYMINYLMSMSTQIFSGHLGNLELAAAS  100



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 76/100 (76%), Gaps = 4/100 (4%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  378
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  379  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  61   KLLFFLAAPAVMVYMINYLMSMSTQIFSGHLGNLELAAAS  100



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 3/99 (3%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  381
            M S     Y P  +++    SP   E+   E+SNELE++L+DT IP W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEIPLWSKLRLATWIEMK  60

Query  382  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             L +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAAS
Sbjct  61   FLFFLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAAS  99



>ref|XP_009353369.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=133

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +1

Query  232  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  411
             Y PLP +    S   HEE +AS ELE +L DTG P  QRLK A WIE KLL  LAAPA+
Sbjct  15   TYPPLPSTKSFTSKHAHEE-QASGELEQVLCDTGKPFSQRLKPALWIESKLLVVLAAPAI  73

Query  412  VVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +VYMINY+MSMSTQ+F GHLGNLELAA+S
Sbjct  74   IVYMINYVMSMSTQMFCGHLGNLELAASS  102



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 3/99 (3%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  381
            M S     Y P  +++    SP   E+   E+SNELE++L+DT I  W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEITLWSKLRLATWIEMK  60

Query  382  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LL +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAAS
Sbjct  61   LLFFLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAAS  99



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 71/90 (79%), Gaps = 5/90 (6%)
 Frame = +1

Query  244  LPESDGVVSSPPHEESEASN-----ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  408
            +  S+  V+ P  E+S AS+     ELES+L+D  +PRW RL+ ATWIE+KLL  LAAPA
Sbjct  1    MASSENDVNQPFIEKSRASDSESSIELESVLLDHSLPRWNRLRQATWIEMKLLFSLAAPA  60

Query  409  VVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            V+VYMINYLMSMSTQIFSGH+GNLELAAAS
Sbjct  61   VMVYMINYLMSMSTQIFSGHIGNLELAAAS  90



>gb|KDO54650.1| hypothetical protein CISIN_1g0100251mg, partial [Citrus sinensis]
Length=351

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 66/85 (78%), Gaps = 1/85 (1%)
 Frame = +1

Query  247  PESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  423
            P    V+S  P E    SN ELE++L DT +  WQRL+ ATWIE KLL +LAAPAV+VYM
Sbjct  24   PAPPAVLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRATWIESKLLFHLAAPAVIVYM  83

Query  424  INYLMSMSTQIFSGHLGNLELAAAS  498
            INYLMSMSTQIFSGHLGNLELAAAS
Sbjct  84   INYLMSMSTQIFSGHLGNLELAAAS  108



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 73/105 (70%), Gaps = 6/105 (6%)
 Frame = +1

Query  184  PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  363
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  364  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             WIE KLL  LAAPA++VYMINY+MSMSTQIF GHLGNLELAA+S
Sbjct  58   LWIESKLLVVLAAPAIIVYMINYVMSMSTQIFCGHLGNLELAASS  102



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 73/105 (70%), Gaps = 6/105 (6%)
 Frame = +1

Query  184  PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  363
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  364  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             WIE KLL  LAAPA++VYMINY+MSMSTQIF GHLGNLELAA+S
Sbjct  58   LWIESKLLVVLAAPAIIVYMINYVMSMSTQIFCGHLGNLELAASS  102



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 66/85 (78%), Gaps = 1/85 (1%)
 Frame = +1

Query  247  PESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYM  423
            P    V+S  P E    SN ELE++L DT +  WQRL+ ATWIE KLL +LAAPAV+VYM
Sbjct  24   PAPPAVLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRATWIESKLLFHLAAPAVIVYM  83

Query  424  INYLMSMSTQIFSGHLGNLELAAAS  498
            INYLMSMSTQIFSGHLGNLELAAAS
Sbjct  84   INYLMSMSTQIFSGHLGNLELAAAS  108



>ref|XP_006375529.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
 gb|ERP53326.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
Length=326

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 67/86 (78%), Gaps = 3/86 (3%)
 Frame = +1

Query  241  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  420
            P P S  +    P + + +S ELES+L DT +P ++RL+ ATWIE KLLC LAAPAVVVY
Sbjct  19   PSPFSSTI---KPKQSNHSSIELESVLSDTEMPYFKRLRRATWIESKLLCRLAAPAVVVY  75

Query  421  MINYLMSMSTQIFSGHLGNLELAAAS  498
            MINYLMSMSTQIFSG LGNLELAAAS
Sbjct  76   MINYLMSMSTQIFSGQLGNLELAAAS  101



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 73/97 (75%), Gaps = 5/97 (5%)
 Frame = +1

Query  211  MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDSS N  AY PL +S    SSP   ES ++ ELE++L D   P +QRL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQSQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESKLL  56

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  93



>ref|XP_010278703.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nelumbo 
nucifera]
Length=484

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEA----SNELESILMDTGIPRWQRLKLATWIEL  378
            M++S      P+  S    +S   ++S A    S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  379  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAAS
Sbjct  61   KLLFYLAAPAVIVYMINYVMSMSTQIFSGHLGNLELAAAS  100



>ref|XP_008379931.1| PREDICTED: protein TRANSPARENT TESTA 12 [Malus domestica]
Length=446

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +1

Query  232  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  411
            +Y PLP +    S   HEE  AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  15   SYRPLPSTKSFTSKHAHEE-HASGELEQVLCDTYKPFSQRLKPALWIESKLLVVLAAPAI  73

Query  412  VVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +VYMINY+MSMSTQ+F GHLGNLELAA+S
Sbjct  74   IVYMINYVMSMSTQMFCGHLGNLELAASS  102



>emb|CDY39494.1| BnaA01g24940D [Brassica napus]
Length=514

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 69/96 (72%), Gaps = 3/96 (3%)
 Frame = +1

Query  217  SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  98



>emb|CDY19294.1| BnaC01g31860D [Brassica napus]
Length=514

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 69/96 (72%), Gaps = 3/96 (3%)
 Frame = +1

Query  217  SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  98



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEA----SNELESILMDTGIPRWQRLKLATWIEL  378
            M++S      P+  S    +S   ++S A    S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  379  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAAS
Sbjct  61   KLLFYLAAPAVIVYMINYVMSMSTQIFSGHLGNLELAAAS  100



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 73/99 (74%), Gaps = 5/99 (5%)
 Frame = +1

Query  205  SVMDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  381
            S MDSS N  AY PL +     SSP   ES ++ ELE++L D   P +QRL+ AT IE K
Sbjct  10   SAMDSSRNDGAYQPLLQPQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESK  65

Query  382  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  66   LLFNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  104



>emb|CDP11782.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 67/96 (70%), Gaps = 9/96 (9%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSNDAGQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  52   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  87



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 67/96 (70%), Gaps = 9/96 (9%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSVDASQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  52   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  87



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 3/82 (4%)
 Frame = +1

Query  262  VVSSPPHE---ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  432
            ++SS  H    + E+  ELE IL DT +P  +R+KLATW+E KLL YLAAP+V+VY+INY
Sbjct  25   LLSSFTHSFGSKHESDGELERILSDTSVPFVKRIKLATWVEFKLLFYLAAPSVIVYLINY  84

Query  433  LMSMSTQIFSGHLGNLELAAAS  498
            +MSMSTQIFSGHLGNLELAAAS
Sbjct  85   VMSMSTQIFSGHLGNLELAAAS  106



>emb|CDY19295.1| BnaC01g31850D [Brassica napus]
Length=304

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 70/99 (71%), Gaps = 4/99 (4%)
 Frame = +1

Query  211  MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  381
            MDSS N   Y+ L  P+SDG V   P  ES  + ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQNDGLYEQLLHPQSDGTVPLSPSTESR-NGELERVLSDVETPLFHRLRKATMIESK  59

Query  382  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LL  LAAPAV+VYMINY+MSMSTQIF GHLGNLELAAAS
Sbjct  60   LLFKLAAPAVIVYMINYMMSMSTQIFPGHLGNLELAAAS  98



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 72/99 (73%), Gaps = 3/99 (3%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDG---VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  381
            M SS  ++Y  LP+++    +  +      EAS+ELE IL +T +P  +R+  ATWIE+K
Sbjct  1    MGSSGDSSYKTLPQNEKKPVLTHTQSQVRKEASDELERILSNTEVPFIKRVVPATWIEIK  60

Query  382  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LL +LAAPAVVVYMINYLMSM TQIFSGHLGNLE AAAS
Sbjct  61   LLVHLAAPAVVVYMINYLMSMLTQIFSGHLGNLEYAAAS  99



>ref|XP_008342001.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=325

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +1

Query  232  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  411
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  412  VVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +VY+INY+MSMSTQIFSGHLGNLELAA+S
Sbjct  72   IVYVINYVMSMSTQIFSGHLGNLELAASS  100



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 71/100 (71%), Gaps = 4/100 (4%)
 Frame = +1

Query  211  MDSS-NGAAYDPLPESDGVVSSPPH--EESEASN-ELESILMDTGIPRWQRLKLATWIEL  378
            MDSS N   Y PL    G  + PPH    +E++N ELE +L D   P + RL+ AT IE 
Sbjct  1    MDSSQNDGVYQPLLHPHGDATLPPHLPPSTESTNGELERVLSDVETPLFLRLRKATMIES  60

Query  379  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            KLL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  61   KLLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  100



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            +PL  ++G  S+  HE S +  +LE IL D  +P   R+  ATWIELKLL +LAAPAV+V
Sbjct  7    EPLLTAEGTRSNSKHESS-SHGQLERILSDDTLPFLNRVGPATWIELKLLFFLAAPAVIV  65

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            Y+INYLMSMSTQIFSGHLGNLELAAAS
Sbjct  66   YLINYLMSMSTQIFSGHLGNLELAAAS  92



>emb|CDY38631.1| BnaA05g19560D [Brassica napus]
Length=512

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 70/99 (71%), Gaps = 4/99 (4%)
 Frame = +1

Query  211  MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  381
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  382  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  60   LLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  98



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 68/96 (71%), Gaps = 2/96 (2%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  1    MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  58

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAAS
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAAS  94



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 70/99 (71%), Gaps = 4/99 (4%)
 Frame = +1

Query  211  MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  381
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  382  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  60   LLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  98



>ref|XP_004144495.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004159201.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43525.1| hypothetical protein Csa_7G043670 [Cucumis sativus]
Length=510

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = +1

Query  268  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  441
            + PP    + E S+ELESIL DT +P  QR   ATWIE+KLL YLAAPAV VY+INYLMS
Sbjct  19   TQPPVLSNKHEYSDELESILSDTHLPLLQRYTKATWIEMKLLFYLAAPAVFVYVINYLMS  78

Query  442  MSTQIFSGHLGNLELAAAS  498
            MSTQIFSGHLGNLELAA+S
Sbjct  79   MSTQIFSGHLGNLELAASS  97



>ref|XP_008362257.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=506

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +1

Query  232  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  411
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  412  VVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +VY+INY+MSMSTQIFSGHLGNLELAA+S
Sbjct  72   IVYVINYVMSMSTQIFSGHLGNLELAASS  100



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 68/96 (71%), Gaps = 2/96 (2%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  37   MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  94

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAAS
Sbjct  95   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAAS  130



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = +1

Query  217  SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            S N   Y PL  P+SDG V   P  ES ++ ELE +L +   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSNVETPLFHRLRKATMIESKLLF  62

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAAS
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGTLELAAAS  98



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = +1

Query  268  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  441
            + PP    + E+S+ELE+IL DT +P  QR   ATWIE+KL+ YLAAPA+ VYM+NYLMS
Sbjct  19   TEPPLLSNKHESSDELEAILSDTHLPLLQRYTKATWIEMKLMFYLAAPAIFVYMVNYLMS  78

Query  442  MSTQIFSGHLGNLELAAAS  498
            MSTQIFSGHLGNLELAA+S
Sbjct  79   MSTQIFSGHLGNLELAASS  97



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  459
            H +  +SNELE +L DT  P  +RLK A WIE KLL YLAAPAV+VYMINY+MSMSTQIF
Sbjct  35   HHDLHSSNELERVLSDTNRPFLERLKPALWIESKLLFYLAAPAVIVYMINYVMSMSTQIF  94

Query  460  SGHLGNLELAAAS  498
            +GHLGNLELAAAS
Sbjct  95   AGHLGNLELAAAS  107



>ref|XP_007045634.1| MATE efflux family protein isoform 2 [Theobroma cacao]
 gb|EOY01466.1| MATE efflux family protein isoform 2 [Theobroma cacao]
Length=424

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 68/97 (70%), Gaps = 5/97 (5%)
 Frame = +1

Query  208  VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQSQ-----TSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  56   FHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  92



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  211  MDSSNGAAYDPLPES-DGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MD    A  D  P+    + +     + E+  ELE IL DT +P  +R+ LATW+ELKLL
Sbjct  1    MDEPFLALNDSTPQQPSSIFTHSFGSKHESDGELERILSDTNVPFVKRIPLATWVELKLL  60

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             YLAAPAV+VY+INY+MSMSTQIFSGHLG LELA AS
Sbjct  61   FYLAAPAVIVYLINYVMSMSTQIFSGHLGTLELAGAS  97



>gb|KEH39009.1| MATE efflux family protein [Medicago truncatula]
Length=461

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +1

Query  268  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  447
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMS
Sbjct  20   TSQKHHESD--GELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMS  77

Query  448  TQIFSGHLGNLELAAAS  498
            TQIFSGHLGNLELAAAS
Sbjct  78   TQIFSGHLGNLELAAAS  94



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  459
            H +  +SNELE +L +T  P  +RLKLA WIE KLL YLA+PAV+VYMINY+M+MSTQIF
Sbjct  35   HHDLHSSNELERVLSETDRPFLERLKLALWIESKLLFYLASPAVIVYMINYVMAMSTQIF  94

Query  460  SGHLGNLELAAAS  498
            +GHLGNLELAAAS
Sbjct  95   AGHLGNLELAAAS  107



>emb|CBI28939.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 70/103 (68%), Gaps = 2/103 (2%)
 Frame = +1

Query  190  HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  369
            H    + M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT 
Sbjct  4    HKYLFNPMESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATS  61

Query  370  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             E KLL  LA PAV VYMINYLMSMSTQIF+GHLGNLELAAAS
Sbjct  62   TESKLLFRLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAAS  104



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 68/97 (70%), Gaps = 5/97 (5%)
 Frame = +1

Query  208  VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQSQ-----TSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  56   FHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  92



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 69/97 (71%), Gaps = 5/97 (5%)
 Frame = +1

Query  211  MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDSS N   Y PL        SPP  ES ++ ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGVYQPLLHPQ---PSPPTTES-SNGELETVLSDVETPLFLRLRKATTIESKLL  56

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  93



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +1

Query  268  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  447
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMS
Sbjct  20   TSQKHHESD--GELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMS  77

Query  448  TQIFSGHLGNLELAAAS  498
            TQIFSGHLGNLELAAAS
Sbjct  78   TQIFSGHLGNLELAAAS  94



>ref|XP_010930078.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Elaeis 
guineensis]
Length=494

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 5/88 (6%)
 Frame = +1

Query  241  PLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  414
            PLP S  + +    PH    +   LESIL +T +P  +RL+LAT IE+KLL +LAAPAV+
Sbjct  24   PLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRLATVIEMKLLIHLAAPAVI  80

Query  415  VYMINYLMSMSTQIFSGHLGNLELAAAS  498
            VYM+NYLMSMSTQIFSGHLGNLELAAAS
Sbjct  81   VYMVNYLMSMSTQIFSGHLGNLELAAAS  108



>emb|CDY69153.1| BnaAnng29470D [Brassica napus]
Length=317

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 69/97 (71%), Gaps = 6/97 (6%)
 Frame = +1

Query  211  MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  92



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 5/88 (6%)
 Frame = +1

Query  241  PLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  414
            PLP S  + +    PH    +   LESIL +T +P  +RL+LAT IE+KLL +LAAPAV+
Sbjct  24   PLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRLATVIEMKLLIHLAAPAVI  80

Query  415  VYMINYLMSMSTQIFSGHLGNLELAAAS  498
            VYM+NYLMSMSTQIFSGHLGNLELAAAS
Sbjct  81   VYMVNYLMSMSTQIFSGHLGNLELAAAS  108



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +1

Query  274  PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQ  453
            P     E+  ELE +L DT +P + R+  ATWIEL+LL +LAAPAV VY+INY+MSMSTQ
Sbjct  16   PGKGAHESDGELERLLSDTTVPYFTRVCSATWIELRLLFFLAAPAVFVYLINYVMSMSTQ  75

Query  454  IFSGHLGNLELAAAS  498
            IFSGHLGNLELAAAS
Sbjct  76   IFSGHLGNLELAAAS  90



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 69/104 (66%), Gaps = 10/104 (10%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPP--------HEESEASNELESILMDTGIPRWQRLKLAT  366
            M SS      P+ +SD   S PP           SE S +LESIL +T +   +RL+LAT
Sbjct  1    MKSSPEVVQKPILQSDD--SDPPLSSSLQSDDTRSETSAQLESILSNTQLRLSERLRLAT  58

Query  367  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            W ELKLL YLA PAV+VYMI Y+MSM+TQIF GHLGNLELAAAS
Sbjct  59   WTELKLLFYLAGPAVLVYMIGYVMSMATQIFVGHLGNLELAAAS  102



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 64/96 (67%), Gaps = 8/96 (8%)
 Frame = +1

Query  214  DSSNGAAYDPLPESDGVVSSPPHEESE-ASNELESILMDTGIPRWQRLKLATWIELKLLC  390
             S N A Y PL +       P    +E    ELE +L D   P  +R+  ATWIE KLL 
Sbjct  3    SSRNDAVYQPLLQ-------PVAAAAEYGGGELERVLTDAETPAMRRVGRATWIESKLLF  55

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  56   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  91



>emb|CAN69305.1| hypothetical protein VITISV_021605 [Vitis vinifera]
Length=320

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 68/96 (71%), Gaps = 2/96 (2%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAAS
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAAS  94



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  292  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  471
             +SNELE +L DT  P  +RLK A WIE KLL YLAAPAV+VYMINY+MSMSTQIF+GHL
Sbjct  38   HSSNELERVLSDTDRPFLERLKPALWIESKLLFYLAAPAVIVYMINYVMSMSTQIFAGHL  97

Query  472  GNLELAAAS  498
            GNLELAAAS
Sbjct  98   GNLELAAAS  106



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
             PLP S   ++    +   +S  LE IL DT IP  +RL LAT IE+KLL +LAAPAV+V
Sbjct  22   QPLPTSTPSMAGDVDDPHGSSGRLERILTDTSIPWARRLPLATAIEMKLLIHLAAPAVIV  81

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            YM+NY+MSMSTQIFSGHLGNLELAA+S
Sbjct  82   YMLNYVMSMSTQIFSGHLGNLELAASS  108



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 68/96 (71%), Gaps = 2/96 (2%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATSTESKLLF  58

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAAS
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAAS  94



>ref|XP_009145464.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 69/97 (71%), Gaps = 6/97 (6%)
 Frame = +1

Query  211  MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  92



>emb|CDY33129.1| BnaCnng07000D [Brassica napus]
Length=505

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 69/97 (71%), Gaps = 6/97 (6%)
 Frame = +1

Query  211  MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  92



>ref|XP_010051023.1| PREDICTED: protein TRANSPARENT TESTA 12 [Eucalyptus grandis]
 gb|KCW89409.1| hypothetical protein EUGRSUZ_A01710 [Eucalyptus grandis]
Length=520

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 69/107 (64%), Gaps = 11/107 (10%)
 Frame = +1

Query  211  MDSSNGAA----YDPLPESDGVVSSPPHEES-------EASNELESILMDTGIPRWQRLK  357
            M SS  A     YDPLPES  V   P            E S  LES+L D  +    R++
Sbjct  1    MGSSQAAGGDRKYDPLPESTQVPPPPSPRPHRPRPDHHETSGHLESVLSDPSLTLGARVR  60

Query  358  LATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             A+ IELKLL +LAAPAVVVYMINY+MSMSTQIFSGHLGNLELAAAS
Sbjct  61   AASRIELKLLFHLAAPAVVVYMINYIMSMSTQIFSGHLGNLELAAAS  107



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            +PL  S+ +   P   ES+   ELE +L DT +P  +R+  ATWIEL+LL +LAAPAV V
Sbjct  11   EPLLLSNNI-GKPNLHESD--GELERLLSDTTVPFLRRVGSATWIELRLLFFLAAPAVFV  67

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            Y+INY+MSMSTQIFSGHLGNLELAAAS
Sbjct  68   YLINYVMSMSTQIFSGHLGNLELAAAS  94



>ref|XP_006406243.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47696.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=468

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 71/102 (70%), Gaps = 6/102 (6%)
 Frame = +1

Query  211  MDSS--NGAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  372
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  373  ELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            E KLL  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  61   ESKLLFKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  102



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  420
            PLP S   +     +   +   LESIL D   PR +RL+LAT +E+KLL +LAAP V+VY
Sbjct  23   PLPPSSPSMDGDIDDPHGSRGRLESILTDPSFPRARRLQLATIVEMKLLVHLAAPTVIVY  82

Query  421  MINYLMSMSTQIFSGHLGNLELAAAS  498
            M+NY+MSMSTQIFSGHLGNLELAAAS
Sbjct  83   MLNYVMSMSTQIFSGHLGNLELAAAS  108



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +1

Query  241  PLPESD---GVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  411
            PLP S    G V  P      +S  LESIL DT +P  +RL+LAT +E+KLL +LA PAV
Sbjct  23   PLPPSSPTTGTVDDP----HGSSGRLESILTDTTVPWSRRLRLATIVEMKLLLHLAGPAV  78

Query  412  VVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             VYM+NY+MSMSTQIFSGHLGNLELAAAS
Sbjct  79   TVYMLNYVMSMSTQIFSGHLGNLELAAAS  107



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  286  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  465
            ES AS +LESIL D  IP  +R+ +A+ +E+KLL YLAAPAV+VYM+NY+MSMSTQIFSG
Sbjct  4    ESGASQKLESILSDNSIPWARRIWMASLVEMKLLVYLAAPAVMVYMLNYVMSMSTQIFSG  63

Query  466  HLGNLELAAAS  498
            HLGNLELAAAS
Sbjct  64   HLGNLELAAAS  74



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  286  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  465
            E   S++LE IL D  IP  +R ++ATWIELK L  LAAPAVVVYMINY MSMSTQIFSG
Sbjct  29   EYRWSDQLEKILTDPHIPTLKRYRMATWIELKRLFLLAAPAVVVYMINYSMSMSTQIFSG  88

Query  466  HLGNLELAAAS  498
            HLGNLELAAAS
Sbjct  89   HLGNLELAAAS  99



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 67/91 (74%), Gaps = 8/91 (9%)
 Frame = +1

Query  247  PESDGV-------VSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  405
            P++DGV        SSP   ES ++ ELE++L D   P  QRL+ AT IE KLL  LAAP
Sbjct  4    PQNDGVDQPLLQPQSSPSTTES-SNGELETVLSDVETPLVQRLRKATMIESKLLFNLAAP  62

Query  406  AVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            AV+VYMINYLMSMST+IFSGHLGNLELAAAS
Sbjct  63   AVIVYMINYLMSMSTRIFSGHLGNLELAAAS  93



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 68/96 (71%), Gaps = 2/96 (2%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAAS
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAAS  94



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 71/102 (70%), Gaps = 6/102 (6%)
 Frame = +1

Query  211  MDSSN--GAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  372
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  373  ELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            E KLL  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  61   ESKLLFKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  102



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            +P PE      S   +   +  ELE IL +T +P  +RL  ATW+ELKLL +LAAPAV+V
Sbjct  19   EPSPEPPSCTQSFSSKHG-SDGELERILSNTSVPFAKRLGPATWVELKLLFHLAAPAVIV  77

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            Y+INY+MSMSTQIFSGHLGNLELAAAS
Sbjct  78   YLINYVMSMSTQIFSGHLGNLELAAAS  104



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
             PLP S     +   E   AS +LE +L D  IP  +R+ LA+ IE+KLL +LAAPAV+V
Sbjct  22   QPLPPSTPPAMADEGEAHGASGQLEIVLNDASIPWARRMWLASLIEMKLLVFLAAPAVMV  81

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            YMINY+MSMSTQIFSGHLGNLELAAAS
Sbjct  82   YMINYVMSMSTQIFSGHLGNLELAAAS  108



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  271  SPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMST  450
            SP   ES ++ ELE++L D   P +QRL+ AT IE KLL  LAAPAV+VYMINYLMSMST
Sbjct  19   SPKTTES-SNGELETVLSDVETPLFQRLRKATMIESKLLFNLAAPAVIVYMINYLMSMST  77

Query  451  QIFSGHLGNLELAAAS  498
            QIFSGHLGNLELAAAS
Sbjct  78   QIFSGHLGNLELAAAS  93



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 67/89 (75%), Gaps = 5/89 (6%)
 Frame = +1

Query  238  DPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  411
             PLP S  + +    PH    +S  LESIL DT +   +RL+LAT IE+KLL +LAAPAV
Sbjct  22   QPLPSSSPMAADMDDPHG---SSGRLESILTDTSLSWARRLQLATIIEMKLLIHLAAPAV  78

Query  412  VVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +VYM+NY+MSMSTQIFSGHLGNLELAAAS
Sbjct  79   IVYMLNYVMSMSTQIFSGHLGNLELAAAS  107



>gb|KDO75455.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=444

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 9/90 (10%)
 Frame = +1

Query  229  AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  408
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  409  VVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            V VY+IN LMS+ST++F GHLGNLELAAAS
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAAS  88



>gb|KDO75454.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=456

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 9/90 (10%)
 Frame = +1

Query  229  AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  408
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  409  VVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            V VY+IN LMS+ST++F GHLGNLELAAAS
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAAS  88



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +1

Query  211  MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDSS N   Y P  +  G  + P  E S    ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDDFYQPFLQPLGDETVPSTESS--IGELERVLSDVETPLFLRLRKATMIESKLL  58

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAVVVYMINY MSMSTQIFSGHLGNLELAAAS
Sbjct  59   FNLAAPAVVVYMINYFMSMSTQIFSGHLGNLELAAAS  95



>gb|KGN43526.1| hypothetical protein Csa_7G043680 [Cucumis sativus]
Length=517

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  292  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  471
            + S+ELE +L DT +   +R  LA+WIE+KL+ YLAAPAV VY+INYLMSMSTQIFSGHL
Sbjct  32   KTSDELEKVLSDTQLSVLRRYSLASWIEMKLMFYLAAPAVFVYVINYLMSMSTQIFSGHL  91

Query  472  GNLELAAAS  498
            GNLELAA+S
Sbjct  92   GNLELAASS  100



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 67/97 (69%), Gaps = 5/97 (5%)
 Frame = +1

Query  211  MDSSNG-AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDS+     Y PL + D +  SP  E +    ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSAQTDGVYQPLLQPDQL--SPLPESNNC--ELERVLADVETPLFLRLRKATMIETKLL  56

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  57   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  93



>emb|CDY65669.1| BnaCnng48120D [Brassica napus]
Length=495

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +1

Query  229  AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  408
              Y PL + D + + P  +  E    LE +L D   P + RL+ AT IE KLL  LAAPA
Sbjct  8    GVYQPLLQPDQLSALPESKNCE----LERVLADVETPLFLRLRKATMIETKLLFKLAAPA  63

Query  409  VVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            VVVYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  64   VVVYMINYLMSMSTQIFSGHLGNLELAAAS  93



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 9/90 (10%)
 Frame = +1

Query  229  AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  408
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  409  VVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            V VY+IN LMS+ST++F GHLGNLELAAAS
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAAS  88



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 67/97 (69%), Gaps = 4/97 (4%)
 Frame = +1

Query  211  MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDSS N     PL     +  SP   ES  + ELE++L D   P  QRL+ AT IE KLL
Sbjct  1    MDSSQNDGVSQPLLHPPQL--SPSTTESN-NGELETVLSDVETPLLQRLRKATMIESKLL  57

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  58   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  94



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  301  NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNL  480
             ELE IL +T +P  +R+  ATW+ELK L +LAAPAV+VY+INY+MSMSTQIFSGHLGNL
Sbjct  40   GELERILSNTSVPFAKRIGPATWVELKFLFHLAAPAVIVYLINYVMSMSTQIFSGHLGNL  99

Query  481  ELAAAS  498
            ELAAAS
Sbjct  100  ELAAAS  105



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  301  NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNL  480
             ELE IL +T +P  +R+  ATW+ELK L +LAAPAV+VY+INY+MSMSTQIFSGHLGNL
Sbjct  40   GELERILSNTSVPFAKRIGPATWVELKFLFHLAAPAVIVYLINYVMSMSTQIFSGHLGNL  99

Query  481  ELAAAS  498
            ELAAAS
Sbjct  100  ELAAAS  105



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAAS
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAAS  96



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAAS
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAAS  96



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAAS
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAAS  96



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 9/90 (10%)
 Frame = +1

Query  229  AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  408
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  409  VVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            V VY+IN LMS+ST++F GHLGNLELAAAS
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAAS  88



>emb|CDY24250.1| BnaC03g42230D [Brassica napus]
Length=317

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 66/97 (68%), Gaps = 6/97 (6%)
 Frame = +1

Query  211  MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDSS N   Y  L +      SP  E S  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGVYQQLLQPQ---LSPLPESS--NGELERVLSDLETPLFPRLRKATMIESKLL  55

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  56   FKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  92



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 9/90 (10%)
 Frame = +1

Query  229  AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  408
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  409  VVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            V VY+IN LMS+ST++F GHLGNLELAAAS
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAAS  88



>gb|KFK39485.1| hypothetical protein AALP_AA3G250300 [Arabis alpina]
Length=510

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 66/99 (67%), Gaps = 5/99 (5%)
 Frame = +1

Query  211  MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  381
            MDSS N   Y PL  P  DG + SP  E    + ELE +L D   P +  L+ AT IE K
Sbjct  1    MDSSQNEGVYQPLIQPHGDGTLPSPLSESR--NGELERVLSDFEAPLFLCLRKATIIESK  58

Query  382  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LL  LAAPAV+VYMIN  MSMSTQIFSGHLGNLELAAAS
Sbjct  59   LLFKLAAPAVIVYMINNFMSMSTQIFSGHLGNLELAAAS  97



>ref|XP_009362007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=444

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 71/111 (64%), Gaps = 14/111 (13%)
 Frame = +1

Query  187  PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  345
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  346  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAAS
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAAS  115



>ref|XP_008455433.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=515

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  292  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  471
            + S+ELE IL DT +   +R   ATWIE+KL+ YLAAPAV VY+INYLMSMSTQ+FSGHL
Sbjct  33   KTSDELEKILSDTQLSVVRRYSQATWIEMKLMFYLAAPAVFVYVINYLMSMSTQVFSGHL  92

Query  472  GNLELAAAS  498
            GNLELAA+S
Sbjct  93   GNLELAASS  101



>ref|XP_009345548.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=455

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 71/111 (64%), Gaps = 14/111 (13%)
 Frame = +1

Query  187  PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  345
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  346  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAAS
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAAS  115



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 71/111 (64%), Gaps = 14/111 (13%)
 Frame = +1

Query  187  PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  345
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  346  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAAS
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAAS  115



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 63/88 (72%), Gaps = 5/88 (6%)
 Frame = +1

Query  241  PLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  414
            PLP S  V      PH    +S  LESIL DT IP  +RL+LAT IE+KLL +LA P+V 
Sbjct  23   PLPPSSPVTGDIDDPHG---SSGRLESILTDTSIPWARRLRLATIIEMKLLLHLAVPSVT  79

Query  415  VYMINYLMSMSTQIFSGHLGNLELAAAS  498
            VYM+NY+MSMST I SGHLGNLELAAAS
Sbjct  80   VYMLNYVMSMSTTIISGHLGNLELAAAS  107



>emb|CDX92916.1| BnaA03g36380D [Brassica napus]
Length=505

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 66/97 (68%), Gaps = 6/97 (6%)
 Frame = +1

Query  211  MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDSS     Y PL +      SP  E S  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQYDVVYQPLLQPQ---LSPLPESS--NGELERVLSDLETPLFLRLRKATMIESKLL  55

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  92



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 71/111 (64%), Gaps = 14/111 (13%)
 Frame = +1

Query  187  PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  345
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  346  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAAS
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAAS  115



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 7/84 (8%)
 Frame = +1

Query  268  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  426
            S P    +EAS         LE +L DT +  ++RL+LATWIELKLL  LAAPAV+VY++
Sbjct  15   SEPDLAAAEASGHGDGFESPLEKVLSDTQLSSFKRLRLATWIELKLLFRLAAPAVLVYIV  74

Query  427  NYLMSMSTQIFSGHLGNLELAAAS  498
            NYLMS+ST++F+GHLGNLELAAAS
Sbjct  75   NYLMSLSTRLFAGHLGNLELAAAS  98



>emb|CDY39493.1| BnaA01g24950D [Brassica napus]
Length=503

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 66/97 (68%), Gaps = 5/97 (5%)
 Frame = +1

Query  211  MDSSNG-AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDS+     Y PL + D +  SP  E +    ELE  L D   P + RL+ AT IE KLL
Sbjct  1    MDSAQTDGVYQPLLQPDQL--SPLPESNNC--ELERGLADVETPLFLRLRKATMIETKLL  56

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  57   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  93



>gb|KJB57729.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=357

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 68/103 (66%), Gaps = 6/103 (6%)
 Frame = +1

Query  190  HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  369
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  370  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAAS
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAAS  105



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 63/84 (75%), Gaps = 7/84 (8%)
 Frame = +1

Query  268  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  426
            S P    +EAS         LE +L DT +  ++RL+LA+WIELKLL  LAAPAV+VY++
Sbjct  15   SEPDSAAAEASGHGDGLESLLEKVLSDTQLSSFKRLRLASWIELKLLFRLAAPAVLVYIV  74

Query  427  NYLMSMSTQIFSGHLGNLELAAAS  498
            NYLMS+ST++F+GHLGNLELAAAS
Sbjct  75   NYLMSLSTRVFAGHLGNLELAAAS  98



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 60/74 (81%), Gaps = 3/74 (4%)
 Frame = +1

Query  277  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  456
            PH+     ++LE++L D  +  + RL+LATWIELKLL YLAAPAV+VYMIN  MS+ST+I
Sbjct  32   PHQ---VDSKLETVLTDMELTYFNRLRLATWIELKLLFYLAAPAVMVYMINNFMSLSTRI  88

Query  457  FSGHLGNLELAAAS  498
            F+GHLGNLELAAA+
Sbjct  89   FAGHLGNLELAAAN  102



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 64/99 (65%), Gaps = 10/99 (10%)
 Frame = +1

Query  211  MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  381
            MDSS N     PL  P +D       H    ++ ELE +L D   P   RL+ AT IE K
Sbjct  1    MDSSQNDGVNQPLLQPHAD-------HGTESSNGELERVLSDVETPLSSRLRKATMIESK  53

Query  382  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LL  LAAPAV+VYMINY MSMSTQIFSGHLGNLELAAAS
Sbjct  54   LLFKLAAPAVIVYMINYFMSMSTQIFSGHLGNLELAAAS  92



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 62/83 (75%), Gaps = 6/83 (7%)
 Frame = +1

Query  268  SSPPHE------ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  429
            S P +E        E S+ LE +L DT +P ++RL+LATWIELKLL  LAAPAV VY++N
Sbjct  13   SEPAYESLASASHGEESSSLEKVLSDTQLPYFKRLRLATWIELKLLFRLAAPAVFVYVVN  72

Query  430  YLMSMSTQIFSGHLGNLELAAAS  498
              MS+ST++F+GHLGNLELAAAS
Sbjct  73   NTMSVSTRVFAGHLGNLELAAAS  95



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  459
            H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQIF  74

Query  460  SGHLGNLELAAAS  498
             GHLGNLELAA S
Sbjct  75   CGHLGNLELAAVS  87



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  283  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  462
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLAAPA++VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELETLLSNTHLPLLHRYTQATWIEMKLLFYLAAPAILVYMMNYLMTMFTQIFS  71

Query  463  GHLGNLELAAAS  498
            GHLGNLELAA+S
Sbjct  72   GHLGNLELAASS  83



>ref|XP_007212447.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
 gb|EMJ13646.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
Length=490

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 62/84 (74%), Gaps = 7/84 (8%)
 Frame = +1

Query  268  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  426
            S P     EASN+       LE +L DT +P ++RL+LATWIEL LL  LAAPAV+VY++
Sbjct  15   SEPDSTALEASNQGDGLESPLEKVLSDTQLPSFKRLRLATWIELNLLFRLAAPAVLVYVV  74

Query  427  NYLMSMSTQIFSGHLGNLELAAAS  498
            N  MS+ST++F+GHLGNLELAAAS
Sbjct  75   NNFMSLSTRVFAGHLGNLELAAAS  98



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  268  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  447
            S   H +   SNELE IL +   P  +RL+LA+W+ELKLL  LAAPAV+VY++N ++SMS
Sbjct  10   SKVSHHDETVSNELEEILTNNQSPYSKRLRLASWVELKLLFQLAAPAVIVYLLNNVISMS  69

Query  448  TQIFSGHLGNLELAAAS  498
            TQIF GHLGNLELAA S
Sbjct  70   TQIFCGHLGNLELAAVS  86



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            M S +   + P+ ES    SS      E+S+ELE +L D  +P  +RL+ ATWIELKLL 
Sbjct  1    MGSQDDQLHTPILESMQR-SSSTGSTFESSSELEKVLSDLQLPWLRRLRTATWIELKLLF  59

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             LAAPAV+VY+IN  MS+ST++F+GHLGNLELAAAS
Sbjct  60   RLAAPAVLVYLINNAMSLSTRVFAGHLGNLELAAAS  95



>ref|XP_004173828.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=307

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  286  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  465
            ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFSG
Sbjct  13   KNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFSG  72

Query  466  HLGNLELAAAS  498
            HLGNLELAA+S
Sbjct  73   HLGNLELAASS  83



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  459
            H E+  S +LESIL D  +P   R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIF
Sbjct  26   HGETAVSGQLESILGDASVPWGTRMASASAVEMRLLVRLAAPAVLVYMINYLMSMSTQIF  85

Query  460  SGHLGNLELAAAS  498
            SGHLG LELAAAS
Sbjct  86   SGHLGTLELAAAS  98



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  390
            MDS +   + P+ ES    SS      E+S+ELE +L D  +P  +RL  ATWIELKLL 
Sbjct  1    MDSQDDQLHTPILESMQC-SSSTGNTFESSSELEKVLSDLQLPWLRRLLKATWIELKLLF  59

Query  391  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             LAAPA++VY+IN  MS+ST++F+GHLGNLELAAA+
Sbjct  60   RLAAPAILVYLINNAMSLSTRVFAGHLGNLELAAAT  95



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 74/117 (63%), Gaps = 18/117 (15%)
 Frame = +1

Query  163  EQAAPRFPPHHLTNSVMDSSNG---AAYDPLP--ESDGVVSSPPHEESEASNELESILMD  327
            E ++P   P H      D  +G    A  PLP   +DG            S +LESIL D
Sbjct  9    ELSSPLIFPAH------DDGHGLPLQASTPLPPVAADGTAHG-------TSGKLESILND  55

Query  328  TGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            T IP  +R+ LA+ IE++LL  LAAPA++VY+IN++MSMSTQIFSGHLGN+ELAAAS
Sbjct  56   TSIPWLRRVGLASLIEMRLLLSLAAPAIIVYLINFVMSMSTQIFSGHLGNVELAAAS  112



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 65/97 (67%), Gaps = 6/97 (6%)
 Frame = +1

Query  211  MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDSS     Y PL +        P  ES  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQYDVVYQPLLQPQ----LSPLPESN-NGELERVLSDLETPLFPRLRKATMIESKLL  55

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  92



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  459
            H     S  LESIL D  +P  +R+  AT +E++LL  LAAPAVVVYMINYLMSMSTQIF
Sbjct  28   HGVEAVSGRLESILSDESLPWGRRMSAATLVEMRLLVRLAAPAVVVYMINYLMSMSTQIF  87

Query  460  SGHLGNLELAAAS  498
            SGHLG LELAAAS
Sbjct  88   SGHLGTLELAAAS  100



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 68/103 (66%), Gaps = 6/103 (6%)
 Frame = +1

Query  190  HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  369
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  370  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAAS
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAAS  105



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 68/103 (66%), Gaps = 6/103 (6%)
 Frame = +1

Query  190  HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  369
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  370  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAAS
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAAS  105



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +1

Query  280  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  459
            H+E+  S+ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQIF  73

Query  460  SGHLGNLELAAAS  498
             GHLGNLELAA S
Sbjct  74   CGHLGNLELAAVS  86



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  268  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  447
            S   H +   SNELE IL +   P  +R++LA+W+ELKLL  LAAPAV+VY++N ++SMS
Sbjct  10   SKVSHHDETVSNELEEILTNNQSPYSKRVRLASWVELKLLFQLAAPAVIVYLLNNVISMS  69

Query  448  TQIFSGHLGNLELAAAS  498
            TQIF GHLGNLELAA S
Sbjct  70   TQIFCGHLGNLELAAVS  86



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
            +S ELE IL D  +P  +R+  ATW+ELKLL  LAAPAV+VY++NY+MSMSTQIF GHLG
Sbjct  37   SSGELEQILTDISLPYSKRVGAATWLELKLLFNLAAPAVIVYLLNYVMSMSTQIFCGHLG  96

Query  475  NLELAAAS  498
            NLELAA+S
Sbjct  97   NLELAASS  104



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  280  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  456
            H   EA S +LESIL DT +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  26   HGHGEAVSGQLESILSDTSLPWGRRMVAASVVEMRLLVRLAAPAVLVYMINYLMSMSTQI  85

Query  457  FSGHLGNLELAAAS  498
            FSGHLG LELAAAS
Sbjct  86   FSGHLGTLELAAAS  99



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 62/87 (71%), Gaps = 4/87 (5%)
 Frame = +1

Query  241  PLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            P P S    +   H   EA S +LESIL D  +P  QR+  A+ +E++LL  LAAPAV+V
Sbjct  19   PAPGSS---AGSGHSHGEAVSGQLESILSDASLPWRQRMLSASMVEMRLLVRLAAPAVLV  75

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            YMINYLMSMSTQIFSGHLG LELAAAS
Sbjct  76   YMINYLMSMSTQIFSGHLGTLELAAAS  102



>tpg|DAA50098.1| TPA: putative MATE efflux family protein [Zea mays]
Length=432

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  280  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  456
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  457  FSGHLGNLELAAAS  498
            FSGHLG LELAAAS
Sbjct  89   FSGHLGTLELAAAS  102



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 68/103 (66%), Gaps = 6/103 (6%)
 Frame = +1

Query  190  HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  369
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSGLEKVLSDTELPFFKRLRLATL  62

Query  370  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAAS
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAAS  105



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 65/95 (68%), Gaps = 6/95 (6%)
 Frame = +1

Query  214  DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  393
            D +N   ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  
Sbjct  7    DINNNNVHEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFR  60

Query  394  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LAAPA++VYM+N L+SMSTQIF GHLGNLELAA S
Sbjct  61   LAAPAILVYMLNNLVSMSTQIFCGHLGNLELAAVS  95



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 64/97 (66%), Gaps = 5/97 (5%)
 Frame = +1

Query  211  MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDSS N   + PL          P      + ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSPNDGVHQPLLHP----QPSPSPPESTNGELETVLSDVETPLFLRLRKATIIESKLL  56

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  93



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 64/97 (66%), Gaps = 5/97 (5%)
 Frame = +1

Query  211  MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
            MDSS N   + PL          P      + ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSPNDGVHQPLLHP----QPSPSPPESTNGELETVLSDVETPLFLRLRKATIIESKLL  56

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAAS  93



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
             + ELE IL DT I    R + ATWIE+KLL YLAAPAV VY+INY MS STQIFSGHLG
Sbjct  34   GNEELERILSDTEISVMDRYRRATWIEIKLLFYLAAPAVFVYIINYTMSTSTQIFSGHLG  93

Query  475  NLELAAAS  498
            NLELAA+S
Sbjct  94   NLELAASS  101



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  283  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  462
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFS  71

Query  463  GHLGNLELAAAS  498
            GHLGNLELAA+S
Sbjct  72   GHLGNLELAASS  83



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 3/74 (4%)
 Frame = +1

Query  277  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  456
            PH    +   LESIL +  +P  +RL+LAT +E+KLL  +AAPAV+VYM+N+LMSMSTQI
Sbjct  7    PHG---SRGRLESILTNPSVPWVRRLQLATIVEMKLLIRIAAPAVMVYMVNFLMSMSTQI  63

Query  457  FSGHLGNLELAAAS  498
            FSGHLGNLELAAAS
Sbjct  64   FSGHLGNLELAAAS  77



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
             + ELE IL DT +   +R   ATWIE+KLL YLAAPAV VY+INY MS STQIFSGHLG
Sbjct  34   GNEELERILSDTEMSAMERYSRATWIEIKLLFYLAAPAVFVYIINYAMSTSTQIFSGHLG  93

Query  475  NLELAAAS  498
            NLELAAAS
Sbjct  94   NLELAAAS  101



>gb|EMS63521.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=110

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  283  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  462
             E  A   LESIL D+  P   R+  A  IEL +L  LAAPAVV+YMINYLMSMSTQIFS
Sbjct  7    HEHGAPGRLESILTDSSAPLAGRVWAAGAIELGMLLRLAAPAVVMYMINYLMSMSTQIFS  66

Query  463  GHLGNLELAAAS  498
            GHLG+LELAAAS
Sbjct  67   GHLGSLELAAAS  78



>gb|KJB69294.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=497

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 66/109 (61%), Gaps = 13/109 (12%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEES-------------EASNELESILMDTGIPRWQR  351
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  352  LKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            L+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+ GHLGNLELAAAS
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIYCGHLGNLELAAAS  109



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = +1

Query  280  HEESE-ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  456
            H++ E  S+ELE IL DT  P  +R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQI
Sbjct  15   HDDHETVSDELEQILTDTEAPYSKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQI  74

Query  457  FSGHLGNLELAAAS  498
            F GHLGNLELAA S
Sbjct  75   FCGHLGNLELAAVS  88



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +1

Query  280  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  459
            H+E+  S+ELE IL DT  P ++R++ A+W+E+KLL  LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVEMKLLFRLAAPAVIVYLLNNVVSMSTQIF  73

Query  460  SGHLGNLELAAAS  498
             GHLGNLELAA S
Sbjct  74   CGHLGNLELAAVS  86



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  459
            H   E ++ LE IL DT +P  +RL+LA+ IELKLL  LAAPAV VYMIN  MS+ST++F
Sbjct  21   HAHCEVNSRLEKILNDTQLPYLKRLRLASVIELKLLFRLAAPAVFVYMINNFMSLSTRVF  80

Query  460  SGHLGNLELAAAS  498
            +GHLGNLELAAA+
Sbjct  81   AGHLGNLELAAAA  93



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  459
            H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+ Y++N ++SMSTQIF
Sbjct  15   HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLLHLAAPAVIDYLLNNVVSMSTQIF  74

Query  460  SGHLGNLELAAAS  498
             GHLGNLELAA S
Sbjct  75   CGHLGNLELAAVS  87



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 62/87 (71%), Gaps = 4/87 (5%)
 Frame = +1

Query  241  PLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            P P S    +   H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+V
Sbjct  19   PAPGSS---AGSGHSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLV  75

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            YMINYLMSMSTQIFSGHLG LELAAAS
Sbjct  76   YMINYLMSMSTQIFSGHLGTLELAAAS  102



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 66/109 (61%), Gaps = 13/109 (12%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEES-------------EASNELESILMDTGIPRWQR  351
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  352  LKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            L+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+ GHLGNLELAAAS
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIYCGHLGNLELAAAS  109



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 67/97 (69%), Gaps = 7/97 (7%)
 Frame = +1

Query  220  SNGAAYDPLPESDGVVSSPPHEESEASNE----LESILMDTGIPRWQRLKLATWIELKLL  387
            S G  + P+  S+     P  E S   +     LE++L DT +P ++RL++ATWIELKLL
Sbjct  2    SQGQLHQPILASE---QEPAAEASSNGDRVDFLLETVLSDTQLPPFKRLRMATWIELKLL  58

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LAAPAV VY+IN  MS+ST+IF+GHLGNLELAAA+
Sbjct  59   FRLAAPAVSVYVINNSMSLSTRIFAGHLGNLELAAAT  95



>ref|XP_008676828.1| PREDICTED: transparent testa 12 protein isoform X1 [Zea mays]
 tpg|DAA50099.1| TPA: putative MATE efflux family protein [Zea mays]
Length=537

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  280  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  456
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  457  FSGHLGNLELAAAS  498
            FSGHLG LELAAAS
Sbjct  89   FSGHLGTLELAAAS  102



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 59/81 (73%), Gaps = 6/81 (7%)
 Frame = +1

Query  274  PPHEES------EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYL  435
            PP   S      E S +LESIL D  +P  +R+  A+ +EL+LL  LAAPAVVVYMINYL
Sbjct  26   PPATTSGGGGGHEVSGQLESILSDGSLPWPRRVLAASAVELRLLARLAAPAVVVYMINYL  85

Query  436  MSMSTQIFSGHLGNLELAAAS  498
            MSMSTQIFSGHLG LELAAAS
Sbjct  86   MSMSTQIFSGHLGTLELAAAS  106



>ref|XP_004159226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 62/87 (71%), Gaps = 6/87 (7%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            Y+IN LMSMST+IFSG LGNL+LAAAS
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAAS  88



>gb|KGN43522.1| Mate efflux family protein [Cucumis sativus]
Length=507

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 62/87 (71%), Gaps = 6/87 (7%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            Y+IN LMSMST+IFSG LGNL+LAAAS
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAAS  88



>ref|XP_004144588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 62/87 (71%), Gaps = 6/87 (7%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            Y+IN LMSMST+IFSG LGNL+LAAAS
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAAS  88



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 7/85 (8%)
 Frame = +1

Query  262  VVSSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  420
            ++ S P   +E S+        LE +L DT +P ++RL++ATWIELKLL  LAAPAV+VY
Sbjct  10   IIDSEPEPAAETSSNGDGVDFLLEKVLSDTQLPPFKRLRMATWIELKLLFRLAAPAVLVY  69

Query  421  MINYLMSMSTQIFSGHLGNLELAAA  495
            +IN  MS+ST++F+GHLGNLELAAA
Sbjct  70   VINNSMSLSTRVFAGHLGNLELAAA  94



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  475  NLELAAAS  498
            NLELAAAS
Sbjct  74   NLELAAAS  81



>gb|ABF97220.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
Length=495

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  475  NLELAAAS  498
            NLELAAAS
Sbjct  74   NLELAAAS  81



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  286  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  465
            + E+  ELE IL ++ +P  +R++LAT +ELKLL YLAAP+V+VY++N + SMSTQIFSG
Sbjct  29   KHESDGELERILSNSSVPFIKRIQLATRVELKLLFYLAAPSVIVYLLNNVTSMSTQIFSG  88

Query  466  HLGNLELAAAS  498
            H+GNLELAAAS
Sbjct  89   HIGNLELAAAS  99



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  475  NLELAAAS  498
            NLELAAAS
Sbjct  74   NLELAAAS  81



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  262  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  441
            ++S  P    E+S ELE IL DT  P  +RL  A  +E +LL +LA PAV+VYMINYLMS
Sbjct  25   LLSPSPKTSHESSGELERILTDTTRPFLRRLGPALLMESRLLFHLAGPAVIVYMINYLMS  84

Query  442  MSTQIFSGHLGNLELAAAS  498
            MSTQI SGHLGNLELAA+S
Sbjct  85   MSTQIVSGHLGNLELAASS  103



>ref|XP_011048008.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Populus 
euphratica]
Length=485

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 68/103 (66%), Gaps = 3/103 (3%)
 Frame = +1

Query  196  LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  369
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  370  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ S
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVS  102



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +1

Query  289  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  468
            + +S+ELE +L DT +P   R K ATWIEL+LL  LAAPAV++YMIN  MSMST+IFSGH
Sbjct  34   THSSSELEKVLSDTDLPFLTRYKKATWIELRLLFKLAAPAVMMYMINNAMSMSTRIFSGH  93

Query  469  LGNLELAAA  495
            LGNLE AAA
Sbjct  94   LGNLEFAAA  102



>ref|XP_008371179.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=340

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 70/111 (63%), Gaps = 14/111 (13%)
 Frame = +1

Query  187  PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  345
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  346  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAAS
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAAS  115



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  477
            S  LESIL DT  P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLGN
Sbjct  15   SGRLESILSDTSTPLARRAWAATAIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLGN  74

Query  478  LELAAAS  498
            LELAAAS
Sbjct  75   LELAAAS  81



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 68/103 (66%), Gaps = 3/103 (3%)
 Frame = +1

Query  196  LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  369
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  370  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ S
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVS  102



>emb|CDM85992.1| unnamed protein product [Triticum aestivum]
Length=512

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +1

Query  289  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  468
              ASNELE+IL D  +P  +R+  AT +E ++L  LAAPAV+VYMINY+MSMSTQIF+GH
Sbjct  29   GRASNELEAILNDDSVPWARRMCAATAVETRMLLRLAAPAVLVYMINYMMSMSTQIFAGH  88

Query  469  LGNLELAAAS  498
            LG LELAAAS
Sbjct  89   LGTLELAAAS  98



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = +1

Query  271  SPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  447
            +P       SN ELE IL D  +P  +R+  A  +E +LL +LAAPAVVVY+INY+MSMS
Sbjct  19   TPRSNSKHGSNGELERILTDDTLPFLRRVGAALCVEFRLLFFLAAPAVVVYLINYVMSMS  78

Query  448  TQIFSGHLGNLELAAAS  498
            TQIFSGHLGNLELAA++
Sbjct  79   TQIFSGHLGNLELAASA  95



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 68/103 (66%), Gaps = 3/103 (3%)
 Frame = +1

Query  196  LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  369
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  370  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ S
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVS  102



>gb|KGN43524.1| hypothetical protein Csa_7G043660 [Cucumis sativus]
Length=485

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 61/87 (70%), Gaps = 6/87 (7%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            +PL E     S+  HE    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEK----SAAKHEA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            Y+IN LMSMST+IFSG LGNL+LAAAS
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAAS  88



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 60/86 (70%), Gaps = 7/86 (8%)
 Frame = +1

Query  241  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  420
            P P SD V        S +S+ELE +L D  +P  +R + ATWIELKLL  LAAPAV++Y
Sbjct  18   PPPPSDAV-------ASHSSSELEKVLSDADLPCLKRYRKATWIELKLLFKLAAPAVMMY  70

Query  421  MINYLMSMSTQIFSGHLGNLELAAAS  498
            +IN  MSMST+IFSGHLGNLE AAA 
Sbjct  71   LINNAMSMSTRIFSGHLGNLEFAAAC  96



>ref|XP_006348109.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Solanum 
tuberosum]
Length=427

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  475  NLELAAAS  498
            NL+LAAAS
Sbjct  79   NLQLAAAS  86



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 62/87 (71%), Gaps = 4/87 (5%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            +PL +S    +S    ES  S+ELE +L D      +R   AT IE KLL +LAAPAV+V
Sbjct  11   EPLLQSQ---TSDTKSES-TSSELEDVLSDGNSSLLERWGKATCIESKLLFHLAAPAVIV  66

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            YMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  67   YMINYLMSMSTQIFSGHLGNLELAAAS  93



>ref|XP_006467446.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Citrus 
sinensis]
 ref|XP_006467447.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Citrus 
sinensis]
Length=488

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 6/88 (7%)
 Frame = +1

Query  235  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  414
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  415  VYMINYLMSMSTQIFSGHLGNLELAAAS  498
            VYM+N L++MSTQIF GHLGNLELAA S
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVS  94



>ref|XP_003562350.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=512

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  301  NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNL  480
             +LESIL D  +P  +R+  AT +EL++L  LAAPAV+VYMINYLMSMSTQIFSGHLG L
Sbjct  33   RQLESILSDESVPWGRRMCAATAVELRMLIRLAAPAVLVYMINYLMSMSTQIFSGHLGTL  92

Query  481  ELAAAS  498
            ELAAAS
Sbjct  93   ELAAAS  98



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
            AS+ELE +L D+ +P +QRL+ A+WIE +LL  LAAPAV VYMIN  MS+ST+IFSG LG
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIEFQLLFRLAAPAVAVYMINNAMSISTRIFSGQLG  82

Query  475  NLELAAAS  498
            NL+LAAAS
Sbjct  83   NLQLAAAS  90



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 7/84 (8%)
 Frame = +1

Query  268  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  426
            S P     EASN        LE +L DT +P ++RL+ ATWIEL LL  LAAPAV+VY++
Sbjct  15   SEPDSTAPEASNHGDGLESPLEKVLSDTQLPFFKRLRSATWIELNLLFRLAAPAVLVYVV  74

Query  427  NYLMSMSTQIFSGHLGNLELAAAS  498
            N  MS+ST++F+GHLGNLELAAAS
Sbjct  75   NNSMSLSTRVFAGHLGNLELAAAS  98



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +1

Query  229  AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  408
            A   PL +S    +S    ES  S+ELE +L D      +R   AT IE KLL +LAAPA
Sbjct  8    AIRKPLFQSQ---TSDTKSES-TSSELEDVLSDGNSSLLERWGKATCIESKLLFHLAAPA  63

Query  409  VVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            V+VYMINYLMSMSTQIFSGHLGNLELAAAS
Sbjct  64   VIVYMINYLMSMSTQIFSGHLGNLELAAAS  93



>ref|XP_010546899.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546908.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=503

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +1

Query  262  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  441
            ++ SP  +ESEA + LES+L DT +P ++RL LA+ +E+K L +LAAPAV VY+IN  MS
Sbjct  13   LLDSPKPQESEADHRLESVLSDTHLPYFRRLYLASMLEMKFLFHLAAPAVFVYLINNGMS  72

Query  442  MSTQIFSGHLGNLELAAAS  498
            + T+IF+GHLG+LELAA+S
Sbjct  73   ILTRIFAGHLGSLELAASS  91



>ref|XP_008364096.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Malus 
domestica]
Length=462

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 70/111 (63%), Gaps = 14/111 (13%)
 Frame = +1

Query  187  PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  345
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  346  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAAS
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAAS  115



>gb|KDO78208.1| hypothetical protein CISIN_1g010561mg [Citrus sinensis]
Length=507

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 6/89 (7%)
 Frame = +1

Query  232  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  411
             ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA+
Sbjct  12   VHEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAI  65

Query  412  VVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +VYM+N L++MSTQIF GHLGNLELAA S
Sbjct  66   LVYMLNNLVAMSTQIFCGHLGNLELAAVS  94



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 6/89 (7%)
 Frame = +1

Query  232  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  411
             ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA+
Sbjct  12   VHEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAI  65

Query  412  VVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +VYM+N L++MSTQIF GHLGNLELAA S
Sbjct  66   LVYMLNNLVAMSTQIFCGHLGNLELAAVS  94



>ref|XP_006389634.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
 gb|ERP48548.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
Length=486

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 69/101 (68%), Gaps = 7/101 (7%)
 Frame = +1

Query  202  NSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIE  375
            N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ AT+IE
Sbjct  8    NTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRATFIE  62

Query  376  LKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LK L  LA PAVVVY++N ++SMSTQI  GHLGNLELAA+S
Sbjct  63   LKTLFQLAGPAVVVYLLNNVISMSTQILCGHLGNLELAASS  103



>ref|XP_008364095.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X5 [Malus 
domestica]
Length=509

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 70/111 (63%), Gaps = 14/111 (13%)
 Frame = +1

Query  187  PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  345
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  346  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAAS
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAAS  115



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 53/98 (54%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = +1

Query  211  MDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKL  384
            MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+WIELKL
Sbjct  1    MDSKESRGELQEPLVLSSTEPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASWIELKL  59

Query  385  LCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            L  LAAPAV VY+IN  +S+ST+IFSGHLGNLE AA S
Sbjct  60   LFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFAAVS  97



>gb|AAS01962.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
Length=534

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  304  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  483
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  484  LAAAS  498
            LAAAS
Sbjct  104  LAAAS  108



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 70/111 (63%), Gaps = 14/111 (13%)
 Frame = +1

Query  187  PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  345
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  346  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAAS
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAAS  115



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 70/111 (63%), Gaps = 14/111 (13%)
 Frame = +1

Query  187  PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  345
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  346  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAAS
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAAS  115



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 70/111 (63%), Gaps = 14/111 (13%)
 Frame = +1

Query  187  PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  345
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  346  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAAS
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAAS  115



>ref|XP_011048000.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=505

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 69/101 (68%), Gaps = 7/101 (7%)
 Frame = +1

Query  202  NSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIE  375
            N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ AT+IE
Sbjct  26   NTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRATFIE  80

Query  376  LKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LK L  LA PA+VVY++N ++SMSTQI  GHLGNLELAA+S
Sbjct  81   LKTLFQLAGPAIVVYLLNNVISMSTQILCGHLGNLELAASS  121



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  475  NLELAAAS  498
            NL+LAAAS
Sbjct  79   NLQLAAAS  86



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  475  NLELAAAS  498
            NL+LAAAS
Sbjct  79   NLQLAAAS  86



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 70/111 (63%), Gaps = 14/111 (13%)
 Frame = +1

Query  187  PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  345
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  346  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAAS
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAAS  115



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  283  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  462
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  463  GHLGNLELAAAS  498
            GHLG+LELAAAS
Sbjct  65   GHLGSLELAAAS  76



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +1

Query  262  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  441
            ++S         S+ELE  L +T +P + RL+ ATW+ELK+L  LAAPAVVVY++N ++S
Sbjct  15   LISKRSSSVQPVSSELEETLSNTELPYFHRLRRATWVELKILFRLAAPAVVVYLLNNVIS  74

Query  442  MSTQIFSGHLGNLELAAAS  498
            MSTQI+ GHLGNLELAA+S
Sbjct  75   MSTQIYCGHLGNLELAASS  93



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  304  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  483
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  484  LAAAS  498
            LAAAS
Sbjct  104  LAAAS  108



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  283  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  462
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  463  GHLGNLELAAAS  498
            GHLG+LELAAAS
Sbjct  65   GHLGSLELAAAS  76



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
             S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LG
Sbjct  20   GSSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLG  79

Query  475  NLELAAAS  498
            NL+LAAAS
Sbjct  80   NLQLAAAS  87



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
             S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LG
Sbjct  20   GSSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLG  79

Query  475  NLELAAAS  498
            NL+LAAAS
Sbjct  80   NLQLAAAS  87



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +1

Query  292  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  471
            + S ELE +L DT +P + RL+LA+WIEL+LL  LA PAV++Y+IN  MS+ST+I+ GHL
Sbjct  42   QPSTELEGVLSDTQLPLFNRLRLASWIELRLLFRLAGPAVMMYLINNAMSVSTRIYCGHL  101

Query  472  GNLELAAAS  498
            GNLELAAAS
Sbjct  102  GNLELAAAS  110



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  283  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  462
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERVWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  463  GHLGNLELAAAS  498
            GHLG+LELAAAS
Sbjct  65   GHLGSLELAAAS  76



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  477
            S+ELE IL +  + R +R+  ATW+ELK+L  LAAPA+VVYM+NYL+S+STQ+F GHLGN
Sbjct  34   SSELEDILSNMELSRSKRILRATWVELKILFPLAAPAIVVYMLNYLVSISTQMFCGHLGN  93

Query  478  LELAAAS  498
            LELAAAS
Sbjct  94   LELAAAS  100



>ref|XP_011047999.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=534

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 69/101 (68%), Gaps = 7/101 (7%)
 Frame = +1

Query  202  NSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIE  375
            N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ AT+IE
Sbjct  26   NTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRATFIE  80

Query  376  LKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LK L  LA PA+VVY++N ++SMSTQI  GHLGNLELAA+S
Sbjct  81   LKTLFQLAGPAIVVYLLNNVISMSTQILCGHLGNLELAASS  121



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 59/82 (72%), Gaps = 7/82 (9%)
 Frame = +1

Query  274  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  432
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYMIN 
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYMINN  80

Query  433  LMSMSTQIFSGHLGNLELAAAS  498
             MS+ST++F GHLGNLELAAAS
Sbjct  81   AMSLSTRVFCGHLGNLELAAAS  102



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 59/82 (72%), Gaps = 7/82 (9%)
 Frame = +1

Query  274  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  432
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYMIN 
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYMINN  80

Query  433  LMSMSTQIFSGHLGNLELAAAS  498
             MS+ST++F GHLGNLELAAAS
Sbjct  81   AMSLSTRVFCGHLGNLELAAAS  102



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  304  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  483
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATEVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  484  LAAAS  498
            LAAAS
Sbjct  104  LAAAS  108



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
            AS+ELE +L D+ +P +QRL+ A+WI+ +LL  LAAPAV VYMIN  MS+ST+IFSG LG
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIKFQLLFRLAAPAVAVYMINNAMSISTRIFSGQLG  82

Query  475  NLELAAAS  498
            NL+LAAAS
Sbjct  83   NLQLAAAS  90



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  268  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  447
            ++P  ++ + + +LE IL DT +   +RL+ A  IELKLL +LA PA  VYMINY+MSMS
Sbjct  15   TNPDSDQPQNNEQLERILSDTQLSTLKRLQSAIVIELKLLFHLATPAAFVYMINYVMSMS  74

Query  448  TQIFSGHLGNLELAAAS  498
            T++FSGHLGNLELAA S
Sbjct  75   TRVFSGHLGNLELAAVS  91



>ref|XP_011048004.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
 ref|XP_011048005.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  477
            S+ELE IL +  + R +RL  ATW+ELK+L  LAAPA+VVYM+N+L+S+STQ+F GHLGN
Sbjct  34   SSELEDILSNMELSRSKRLLRATWVELKILFPLAAPAIVVYMLNFLVSISTQMFCGHLGN  93

Query  478  LELAAAS  498
            LELAAAS
Sbjct  94   LELAAAS  100



>ref|XP_006858200.1| hypothetical protein AMTR_s00062p00173640 [Amborella trichopoda]
 gb|ERN19667.1| hypothetical protein AMTR_s00062p00173640 [Amborella trichopoda]
Length=103

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 57/78 (73%), Gaps = 2/78 (3%)
 Frame = +1

Query  265  VSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSM  444
            +  P  EE EA   LESIL D  +    R++ A  +E++LL  LAAPAV VY++NY++SM
Sbjct  8    LRRPLVEEREAV--LESILCDERLGLCLRVRAAIRVEMRLLGQLAAPAVAVYLLNYILSM  65

Query  445  STQIFSGHLGNLELAAAS  498
            +TQIFSGH+GNL+LAAAS
Sbjct  66   ATQIFSGHIGNLDLAAAS  83



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPAV VY+IN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAVAVYLINNAMSMSTRIFSGQLG  78

Query  475  NLELAAAS  498
            NL+LAAAS
Sbjct  79   NLQLAAAS  86



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  274  PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQ  453
            PP    E S++LE IL D G+    R K ATW+ELKLL  LAAPA++VY++N L++MSTQ
Sbjct  20   PPPVGEEVSSDLEQILTDDGLTFSTRYKKATWVELKLLTRLAAPAIIVYLLNNLLNMSTQ  79

Query  454  IFSGHLGNLELAAAS  498
            IF G LGNLELA ++
Sbjct  80   IFCGQLGNLELAGSA  94



>gb|KDP20755.1| hypothetical protein JCGZ_21226 [Jatropha curcas]
Length=359

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 6/87 (7%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
             PL ES        HE    ++ELE IL DT    + R++LA+W+ELKLL  +A PAV+V
Sbjct  5    QPLLESF----KSGHEG--VNSELEEILTDTETSSFTRIQLASWVELKLLFRIAGPAVIV  58

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            Y++N ++SMSTQIF GHLGNLELAA S
Sbjct  59   YLLNNVVSMSTQIFVGHLGNLELAAVS  85



>ref|XP_009345550.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  286  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  465
            +   S+ELE  L +T    +QRL+ ATW+E K LC LAAPAVVVY++N ++++STQIF G
Sbjct  22   QQIVSSELEDTLNNTDFSYFQRLRTATWLEAKTLCRLAAPAVVVYLLNNVITLSTQIFCG  81

Query  466  HLGNLELAAAS  498
            HLGNLELAA+S
Sbjct  82   HLGNLELAASS  92



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
             S+ELE +L D+ +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LG
Sbjct  20   GSSELEEVLSDSQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLG  79

Query  475  NLELAAAS  498
            NL+LAAAS
Sbjct  80   NLQLAAAS  87



>ref|XP_007212986.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
 gb|EMJ14185.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
Length=487

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
             S ELE  L +T +  +QRL+  TW+ELK+L  LAAPAVVVY++N ++SMSTQIF GHLG
Sbjct  4    VSRELEDTLNNTELSYFQRLRTGTWLELKILFRLAAPAVVVYLLNNVISMSTQIFCGHLG  63

Query  475  NLELAAAS  498
            NLELAA+S
Sbjct  64   NLELAASS  71



>ref|XP_008347106.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12-like 
[Malus domestica]
Length=508

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
             S+ELE  L +T +  +QRL+ ATW+E K+L  LAAPAVVVY++N ++SMSTQIF GHLG
Sbjct  25   VSSELEDTLNNTDLSNFQRLRTATWLETKILYRLAAPAVVVYLLNNVISMSTQIFCGHLG  84

Query  475  NLELAAAS  498
            NLELAA+S
Sbjct  85   NLELAASS  92



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  459
            H   E  + LE +L D+ +  ++RL+LA+ IEL+LL  LAAPAV VYMIN  MS+ST++F
Sbjct  34   HRGHEVDSRLEKVLTDSDLSFFKRLRLASGIELRLLFRLAAPAVFVYMINNAMSLSTRVF  93

Query  460  SGHLGNLELAAAS  498
             GHLGNLELAAAS
Sbjct  94   CGHLGNLELAAAS  106



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  456
            P  E      LESIL D+ +P  +R   AT +EL  L  L APAVV+YMINYLMSMSTQI
Sbjct  3    PGGEDGGGGRLESILTDSSLPLGERAWAATRVELGTLARLVAPAVVMYMINYLMSMSTQI  62

Query  457  FSGHLGNLELAAAS  498
            FSGHLGNLELAAAS
Sbjct  63   FSGHLGNLELAAAS  76



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +1

Query  304  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  483
             LESIL D   P  +R   A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGHLGNLE
Sbjct  16   RLESILTDASSPWTRRAWAAGGIELRLLARLAAPAVVMYMINYLMSMSTQIFSGHLGNLE  75

Query  484  LAAAS  498
            LAAAS
Sbjct  76   LAAAS  80



>gb|EYU29855.1| hypothetical protein MIMGU_mgv1a004845mg [Erythranthe guttata]
Length=507

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 62/97 (64%), Gaps = 9/97 (9%)
 Frame = +1

Query  214  DSSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  387
             S N    +PL  P S+G          E S+ELE +L DT +  W+R + A  IEL+ L
Sbjct  3    SSKNKGVSEPLLEPNSNG-------GTEEVSSELEDVLCDTTLSGWRRFQKAIVIELRYL  55

Query  388  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
              LA PAVVVY++N ++SMSTQIF GHLGNLELAA++
Sbjct  56   LRLAGPAVVVYLLNSVISMSTQIFCGHLGNLELAASA  92



>gb|KDP20759.1| hypothetical protein JCGZ_21230 [Jatropha curcas]
Length=318

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 63/87 (72%), Gaps = 2/87 (2%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            +P+ +S    ++  H  +E ++ LE +L DT +P  +R+ LA+ IELKLL  LA PAV V
Sbjct  9    EPILQSHSQPAAALH--NEVNSMLEKVLNDTELPYLKRIMLASAIELKLLYRLAGPAVFV  66

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            YMIN  MS+ST+IF+GHLGNL+LAAAS
Sbjct  67   YMINNFMSLSTRIFAGHLGNLQLAAAS  93



>gb|KCW76957.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=458

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 62/95 (65%), Gaps = 14/95 (15%)
 Frame = +1

Query  256  DGVVSSPPHEESE--------------ASNELESILMDTGIPRWQRLKLATWIELKLLCY  393
            DG+++S   ++ +               S+ LE +L DT +PR++RL  AT IEL  L  
Sbjct  7    DGIIASDESDQHQEPLLQPKQQPTAETVSSALEDMLSDTELPRFRRLSRATRIELNTLFR  66

Query  394  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LAAPAVVVY++N + SMSTQIF GHLGNLELAAAS
Sbjct  67   LAAPAVVVYLLNNVTSMSTQIFCGHLGNLELAAAS  101



>gb|EMT26283.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=86

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 52/70 (74%), Gaps = 5/70 (7%)
 Frame = +1

Query  292  EASNELESILMDTGIPRWQRLKLATW-IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  468
            +A   LESIL DT     +R     W +EL+LL  LAAPAVVVYMI+Y++SMS QIFSGH
Sbjct  6    DAPGRLESILTDTSATLAER----AWAVELRLLSRLAAPAVVVYMISYVISMSRQIFSGH  61

Query  469  LGNLELAAAS  498
            LGNLELAAAS
Sbjct  62   LGNLELAAAS  71



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            +P+ +S    ++  H  +E ++ LE +L DT +P  +R+ LA+ IELKLL  LA PAV V
Sbjct  9    EPILQSRSQPAAVLH--NEVNSRLEKVLNDTELPYLKRILLASAIELKLLFPLAGPAVFV  66

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            YMIN LMS+ST+IF+GHLGNLELAAAS
Sbjct  67   YMINNLMSLSTRIFAGHLGNLELAAAS  93



>ref|XP_009361291.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
 ref|XP_009361361.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  301  NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNL  480
            +ELE  L +T    +QRL+ ATW+E K LC LAAPAVVVY++N ++++STQIF GHLGNL
Sbjct  27   SELEDTLNNTDFSYFQRLRTATWLETKTLCRLAAPAVVVYLLNNVITLSTQIFCGHLGNL  86

Query  481  ELAAAS  498
            ELAA+S
Sbjct  87   ELAASS  92



>gb|EYU29852.1| hypothetical protein MIMGU_mgv1a004818mg [Erythranthe guttata]
Length=508

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 61/95 (64%), Gaps = 5/95 (5%)
 Frame = +1

Query  214  DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  393
              + G   DPL ES     S      E S+ELE +L DT +  W+R + A  IEL+ L  
Sbjct  4    SKNKGETTDPLLES-----SYGGGVEEVSSELEDVLCDTTLSGWRRFQKAIVIELRYLLR  58

Query  394  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LA PAV+VY++N ++SMSTQIF GHLGNLELAA++
Sbjct  59   LAGPAVLVYLLNSVVSMSTQIFCGHLGNLELAASA  93



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +1

Query  280  HE-ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  456
            HE E  AS  LESIL DT  P   R  LA  +EL+LL  LA PAVVVYMIN++MSMSTQI
Sbjct  7    HEHEHAASCRLESILTDTSAPLATRAWLAGAVELRLLARLATPAVVVYMINFVMSMSTQI  66

Query  457  FSGHLGNLELAAAS  498
              GHLG LELAAAS
Sbjct  67   LCGHLGTLELAAAS  80



>ref|XP_010052837.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76956.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=514

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 62/95 (65%), Gaps = 14/95 (15%)
 Frame = +1

Query  256  DGVVSSPPHEESE--------------ASNELESILMDTGIPRWQRLKLATWIELKLLCY  393
            DG+++S   ++ +               S+ LE +L DT +PR++RL  AT IEL  L  
Sbjct  7    DGIIASDESDQHQEPLLQPKQQPTAETVSSALEDMLSDTELPRFRRLSRATRIELNTLFR  66

Query  394  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LAAPAVVVY++N + SMSTQIF GHLGNLELAAAS
Sbjct  67   LAAPAVVVYLLNNVTSMSTQIFCGHLGNLELAAAS  101



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = +1

Query  247  PESDGVVSSPPHEESEAS-----NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  411
            P SD  +S P      +S      ELE  L +T +  +QR +  TW+ELK L  LAAPAV
Sbjct  3    PSSDNELSEPLLLSKSSSMHIVSRELEDTLNNTELSYFQRFRTGTWLELKTLFRLAAPAV  62

Query  412  VVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            VVY++N ++SMSTQIF GHLGNLELAA+S
Sbjct  63   VVYLLNNVISMSTQIFCGHLGNLELAASS  91



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 61/87 (70%), Gaps = 5/87 (6%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            +PL ES+      P    + S+ELE IL DT + R QR + A+ IEL+ L  LAAP+++V
Sbjct  5    EPLLESE-----EPILAEQISSELEEILSDTSLSRIQRFRRASVIELRNLFRLAAPSIIV  59

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            Y++N + SMSTQIF GHLGNLELAAAS
Sbjct  60   YLLNNVTSMSTQIFCGHLGNLELAAAS  86



>gb|EMT13256.1| hypothetical protein F775_42803 [Aegilops tauschii]
Length=100

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +1

Query  286  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  465
            + +AS  LESIL D+ +P  +R   A  IEL +L  LAAPAVVVYMINYLMSMSTQ+  G
Sbjct  5    DGDASGRLESILTDSSVPLARR-AWAAAIELGMLARLAAPAVVVYMINYLMSMSTQVLCG  63

Query  466  HLGNLELAAA  495
             LG LE A A
Sbjct  64   RLGTLEFAGA  73



>ref|XP_008371177.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  286  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  465
            +   S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVVY++N +++MSTQIF G
Sbjct  21   QQIVSSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVVYLLNNVITMSTQIFCG  80

Query  466  HLGNLELAAAS  498
            HLGNLELAA+S
Sbjct  81   HLGNLELAASS  91



>emb|CBI23252.3| unnamed protein product [Vitis vinifera]
Length=293

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  304  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  483
             LE +L D  +P  +RL  ATWIELKLL  LAAPA++VY+IN  MS+ST++F+GHLGNLE
Sbjct  157  SLEKVLSDLQLPWLRRLLKATWIELKLLFRLAAPAILVYLINNAMSLSTRVFAGHLGNLE  216

Query  484  LAAAS  498
            LAAA+
Sbjct  217  LAAAT  221



>ref|XP_008371097.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  286  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  465
            +   S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVVY++N +++MSTQIF G
Sbjct  21   QQIVSSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVVYLLNNVITMSTQIFCG  80

Query  466  HLGNLELAAAS  498
            HLGNLELAA+S
Sbjct  81   HLGNLELAASS  91



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
            AS  LESIL DT  P  +R  LA  +EL+LL  LAAPAVVVYMIN++MSMSTQI  GHLG
Sbjct  15   ASCLLESILTDTSAPLARRAWLAGAVELRLLARLAAPAVVVYMINFVMSMSTQILCGHLG  74

Query  475  NLELAAAS  498
             LELAAAS
Sbjct  75   TLELAAAS  82



>gb|EYU29854.1| hypothetical protein MIMGU_mgv1a005159mg [Erythranthe guttata]
Length=495

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = +1

Query  220  SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLA  399
            + GA   PL ES     + P    E S+ELE IL D  +  W+R + A+ IEL+    LA
Sbjct  6    NKGAVNQPLLESYK--PALPEAAEEVSSELEEILSDATLSWWRRYQKASVIELRYFFRLA  63

Query  400  APAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
             PAV+VY++N + SMSTQIF GHLGNLELAA+S
Sbjct  64   GPAVIVYLLNNVTSMSTQIFCGHLGNLELAASS  96



>tpg|DAA50097.1| TPA: putative MATE efflux family protein, partial [Zea mays]
Length=167

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +1

Query  283  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  462
            + ++AS  LESIL             A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFS
Sbjct  5    DGADASERLESILTAE---AAASPWAAAAIELRLLTRLAAPAVVMYMINYLMSMSTQIFS  61

Query  463  GHLGNLELAAAS  498
            GHLGNLELAAAS
Sbjct  62   GHLGNLELAAAS  73



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            +PL ES+  + +    E + S+ELE IL DT +   QR K A+ IEL+ L  LAAPA++V
Sbjct  5    EPLLESESPILASAATE-KISSELEEILSDTSLSCIQRFKRASVIELRNLFRLAAPAIIV  63

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            Y++N + SMSTQIF GHLGNLELAAAS
Sbjct  64   YLLNNVTSMSTQIFCGHLGNLELAAAS  90



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +1

Query  286  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  465
            E   S+ LE  L D  +  + R++ ATWIEL +L +LAAPAVVVY+ N L+SMSTQIF G
Sbjct  30   EPCVSDLLEDTLSDNSLSLFWRIQRATWIELGILFHLAAPAVVVYLFNNLISMSTQIFCG  89

Query  466  HLGNLELAAAS  498
            HLGNLELAAAS
Sbjct  90   HLGNLELAAAS  100



>gb|EPS67796.1| hypothetical protein M569_06975, partial [Genlisea aurea]
Length=484

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +1

Query  292  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  471
            E S+ LE +L +  + RW+RL+ AT IELK+LC LA PAVV Y++  ++SMSTQIF GH+
Sbjct  13   EISSHLEDVLSNAEMARWRRLQKATSIELKILCRLAGPAVVSYLLGNVISMSTQIFCGHV  72

Query  472  GNLELAAAS  498
            GNLELAA+S
Sbjct  73   GNLELAASS  81



>gb|EPS61219.1| hypothetical protein M569_13580, partial [Genlisea aurea]
Length=159

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  292  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  471
            E S++LE  L +T +P+W+RL+ A  IEL++L  LA PAV+ Y++  ++S STQIF GH+
Sbjct  2    EVSSDLEDALSNTAVPQWRRLERAVRIELRILSRLAGPAVISYLLGNVISTSTQIFCGHI  61

Query  472  GNLELAAAS  498
            GNLELAA+S
Sbjct  62   GNLELAASS  70



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
            AS  LESIL DT  P  +R   A  +EL+LL  LAAPAVVVYMIN++MSMSTQI  GHLG
Sbjct  13   ASCRLESILTDTSAPLAERAWAAGTVELRLLARLAAPAVVVYMINFVMSMSTQILCGHLG  72

Query  475  NLELAAAS  498
             LELAAAS
Sbjct  73   TLELAAAS  80



>ref|XP_011037659.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%), Gaps = 5/88 (6%)
 Frame = +1

Query  235  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  414
            Y+P+       S  P      S+ELE IL     PR QR+  AT +ELK+L  LAAPA+V
Sbjct  18   YEPILHDKRSFSGEP-----VSSELEEILSVMEFPRSQRILRATRLELKILSRLAAPAIV  72

Query  415  VYMINYLMSMSTQIFSGHLGNLELAAAS  498
            VY++N+L+S+ST +F GHLGNL+LAAAS
Sbjct  73   VYLLNFLISISTHVFCGHLGNLQLAAAS  100



>ref|XP_009798076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 4/87 (5%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  417
            +PL ES+     P    ++ S+ELE IL DT +   QR   A+ +EL+ L  LAAPA++V
Sbjct  13   EPLLESE----PPTLAAAKISSELEEILSDTSLSHLQRFGRASVVELRNLFRLAAPAIIV  68

Query  418  YMINYLMSMSTQIFSGHLGNLELAAAS  498
            Y++N + SMSTQIF GHLGNLELAAAS
Sbjct  69   YLLNNITSMSTQIFCGHLGNLELAAAS  95



>ref|XP_010533819.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Tarenaya 
hassleriana]
Length=320

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +1

Query  268  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  447
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  448  TQIFSGHLGNLELAAAS  498
            T+IF+GHLG+L+LAA S
Sbjct  73   TRIFAGHLGSLQLAAVS  89



>ref|XP_010533821.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X5 [Tarenaya 
hassleriana]
 ref|XP_010533822.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Tarenaya 
hassleriana]
Length=313

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +1

Query  268  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  447
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  448  TQIFSGHLGNLELAAAS  498
            T+IF+GHLG+L+LAA S
Sbjct  73   TRIFAGHLGSLQLAAVS  89



>ref|XP_009361804.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=509

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  477
            S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI  GHLGN
Sbjct  26   SSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQILCGHLGN  85

Query  478  LELAAAS  498
            LELAA+S
Sbjct  86   LELAASS  92



>ref|XP_010533820.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Tarenaya 
hassleriana]
Length=315

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +1

Query  268  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  447
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  448  TQIFSGHLGNLELAAAS  498
            T+IF+GHLG+L+LAA S
Sbjct  73   TRIFAGHLGSLQLAAVS  89



>ref|XP_009361725.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=509

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  477
            S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI  GHLGN
Sbjct  26   SSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQILCGHLGN  85

Query  478  LELAAAS  498
            LELAA+S
Sbjct  86   LELAASS  92



>ref|XP_010533818.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=328

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +1

Query  268  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  447
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  448  TQIFSGHLGNLELAAAS  498
            T+IF+GHLG+L+LAA S
Sbjct  73   TRIFAGHLGSLQLAAVS  89



>ref|XP_009345545.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  295  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  474
             S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI  GHLG
Sbjct  25   VSSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQILCGHLG  84

Query  475  NLELAAAS  498
            NLELAA+S
Sbjct  85   NLELAASS  92



>gb|KDO78210.1| hypothetical protein CISIN_1g043801mg, partial [Citrus sinensis]
Length=215

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  328  TGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            T +  +QR+K ATWIELK L  LAAPA++VYM+N L++MSTQIF GHLGNLELAA S
Sbjct  10   TSLSFFQRIKKATWIELKSLFRLAAPAILVYMLNNLVAMSTQIFCGHLGNLELAAVS  66



>ref|XP_010533817.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
Length=351

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +1

Query  268  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  447
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  448  TQIFSGHLGNLELAAAS  498
            T+IF+GHLG+L+LAA S
Sbjct  73   TRIFAGHLGSLQLAAVS  89



>ref|XP_011037658.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 65/101 (64%), Gaps = 6/101 (6%)
 Frame = +1

Query  211  MDSSNGAAYDPLPESDGVVSSPPHEESE-----ASNELESILMDTGIPRWQRLKLATWIE  375
            M +SNG   D   + D       HE         S+ELE IL +  + R +R+  AT++E
Sbjct  1    MGTSNGCRID-YADLDESYQPILHERRSFSGETVSSELEEILSNMELSRSRRILRATFLE  59

Query  376  LKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAAS  498
            LK+L  LAAPA+VVY++N+L+S+STQIF GHLGNL+LA AS
Sbjct  60   LKILFPLAAPAIVVYLLNFLISISTQIFCGHLGNLQLAGAS  100



>ref|XP_002518493.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43880.1| multidrug resistance pump, putative [Ricinus communis]
Length=510

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +1

Query  289  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  468
            S  S+ELE IL +T +  +QRLK A  +ELK+L  LA PAV VY++N ++SMSTQIF GH
Sbjct  28   SPVSSELEEILSNTNLSCFQRLKKAALLELKILFRLAGPAVFVYLLNNVVSMSTQIFCGH  87

Query  469  LGNLELAAAS  498
            LGNL+LAAAS
Sbjct  88   LGNLQLAAAS  97



>ref|XP_009618512.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=418

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 59/88 (67%), Gaps = 6/88 (7%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  414
            +PL ES+     PP   +E  S ELE IL DT +   QR   A+ IEL+ L  LAAPA++
Sbjct  12   EPLLESE-----PPTLAAEQISPELEEILSDTSLSHLQRFGRASVIELRNLFRLAAPAII  66

Query  415  VYMINYLMSMSTQIFSGHLGNLELAAAS  498
            VY++N   SMSTQIF GHLGNLELAAAS
Sbjct  67   VYLLNNTTSMSTQIFCGHLGNLELAAAS  94



>ref|XP_009618511.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=439

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 59/88 (67%), Gaps = 6/88 (7%)
 Frame = +1

Query  238  DPLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  414
            +PL ES+     PP   +E  S ELE IL DT +   QR   A+ IEL+ L  LAAPA++
Sbjct  12   EPLLESE-----PPTLAAEQISPELEEILSDTSLSHLQRFGRASVIELRNLFRLAAPAII  66

Query  415  VYMINYLMSMSTQIFSGHLGNLELAAAS  498
            VY++N   SMSTQIF GHLGNLELAAAS
Sbjct  67   VYLLNNTTSMSTQIFCGHLGNLELAAAS  94



>gb|ACG29464.1| hypothetical protein [Zea mays]
 tpg|DAA62914.1| TPA: putative MATE efflux family protein [Zea mays]
Length=119

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  456
            P +  E S ELE+IL D   P   R      +EL LL  +A PAV VYMIN++MSMSTQI
Sbjct  25   PAQHGEGSRELEAILADASKPWAWRAWEGARLELPLLLRVALPAVAVYMINFVMSMSTQI  84

Query  457  FSGHLGNLELAAAS  498
            F G LGNLELAA+S
Sbjct  85   FCGQLGNLELAASS  98



>gb|KDP20756.1| hypothetical protein JCGZ_21227 [Jatropha curcas]
Length=999

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  477
            S+ELE IL +T     QR + AT +ELK L YLAAPA+VVY++N ++SMSTQI  GHLGN
Sbjct  30   SDELEQILCNTQFTYLQRTRKATLVELKTLFYLAAPAIVVYLLNNVVSMSTQILVGHLGN  89

Query  478  LELAAAS  498
            LELAAAS
Sbjct  90   LELAAAS  96


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  456
             H     S+ELE IL +  +   QRLK A  +ELK L  LA PAV+VY++N ++SMSTQI
Sbjct  513  KHSPPPVSSELEDILSNMELSYSQRLKSAVLVELKTLFLLAGPAVIVYLLNNVVSMSTQI  572

Query  457  FSGHLGNLELAAAS  498
            F GHLGNLELAAAS
Sbjct  573  FCGHLGNLELAAAS  586



>ref|XP_004232715.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 58/82 (71%), Gaps = 5/82 (6%)
 Frame = +1

Query  268  SSPPHEESEA-----SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  432
            S P  EE EA     S+ELE IL+D  +  +QRL+ A+ +E   L  LAAPA++VY++N 
Sbjct  8    SEPLIEEKEATVEHVSSELEDILLDARLSHFQRLRRASAVEFSNLFRLAAPAIIVYLLNN  67

Query  433  LMSMSTQIFSGHLGNLELAAAS  498
            + S+STQIF GHLGNLELAAAS
Sbjct  68   VTSVSTQIFCGHLGNLELAAAS  89



>ref|XP_006389635.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
 gb|ERP48549.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
Length=513

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  477
            S+ELE IL +  + R  R+  ATW+ELK+L  LAAPA+VVY++N+ +S+STQ+F GHLGN
Sbjct  34   SSELEDILCNMELSRSHRILRATWVELKILFPLAAPAIVVYLLNFFVSISTQMFCGHLGN  93

Query  478  LELAAAS  498
            LELA  S
Sbjct  94   LELAGVS  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567283606695