BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF010D18

Length=298
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFW66128.1|  putative ribosomal protein S8e family protein           121   2e-32   
ref|XP_010060252.1|  PREDICTED: 40S ribosomal protein S8                122   4e-32   Eucalyptus grandis [rose gum]
gb|AFW66137.1|  putative ribosomal protein S8e family protein           120   5e-32   
gb|KJB13805.1|  hypothetical protein B456_002G095300                    122   6e-32   Gossypium raimondii
ref|XP_008799563.1|  PREDICTED: 40S ribosomal protein S8-like           120   6e-32   
gb|KDP39216.1|  hypothetical protein JCGZ_00973                         122   6e-32   Jatropha curcas
gb|KHM99496.1|  40S ribosomal protein S8                                122   6e-32   Glycine soja [wild soybean]
ref|XP_003532158.1|  PREDICTED: 40S ribosomal protein S8-like           122   6e-32   Glycine max [soybeans]
ref|XP_011008256.1|  PREDICTED: 40S ribosomal protein S8-like           122   6e-32   Populus euphratica
gb|KJB22170.1|  hypothetical protein B456_004G033000                    122   7e-32   Gossypium raimondii
ref|XP_007134162.1|  hypothetical protein PHAVU_010G024600g             122   7e-32   Phaseolus vulgaris [French bean]
gb|KHG18510.1|  40S ribosomal S8                                        122   7e-32   Gossypium arboreum [tree cotton]
gb|KJB84080.1|  hypothetical protein B456_N005000                       122   7e-32   Gossypium raimondii
gb|KHG04827.1|  40S ribosomal S8                                        122   7e-32   Gossypium arboreum [tree cotton]
gb|KJB81680.1|  hypothetical protein B456_013G156600                    120   7e-32   Gossypium raimondii
gb|ACU16800.1|  unknown                                                 122   7e-32   Glycine max [soybeans]
ref|XP_006452497.1|  hypothetical protein CICLE_v10009415mg             122   8e-32   Citrus clementina [clementine]
ref|XP_007049644.1|  40S ribosomal protein S8 isoform 1                 122   8e-32   Theobroma cacao [chocolate]
gb|KJB81681.1|  hypothetical protein B456_013G156600                    120   8e-32   Gossypium raimondii
gb|KDP45274.1|  hypothetical protein JCGZ_15139                         122   9e-32   Jatropha curcas
ref|XP_011025495.1|  PREDICTED: 40S ribosomal protein S8-like           122   9e-32   Populus euphratica
gb|KDO36309.1|  hypothetical protein CISIN_1g045444mg                   121   9e-32   Citrus sinensis [apfelsine]
ref|NP_001105391.1|  40S ribosomal protein S8                           122   9e-32   Zea mays [maize]
gb|KHG08050.1|  40S ribosomal S8                                        121   9e-32   Gossypium arboreum [tree cotton]
gb|ABR13294.1|  putative 40S ribosomal protein S8                       119   1e-31   Prunus dulcis [sweet almond]
ref|XP_007146564.1|  hypothetical protein PHAVU_006G051300g             121   1e-31   Phaseolus vulgaris [French bean]
ref|NP_001046866.1|  Os02g0489400                                       121   1e-31   
ref|XP_006437243.1|  hypothetical protein CICLE_v10032694mg             121   1e-31   Citrus clementina [clementine]
gb|KJB81679.1|  hypothetical protein B456_013G156600                    121   1e-31   Gossypium raimondii
ref|XP_008792950.1|  PREDICTED: 40S ribosomal protein S8                121   1e-31   Phoenix dactylifera
gb|KJB62959.1|  hypothetical protein B456_009G445800                    121   1e-31   Gossypium raimondii
gb|KHN25148.1|  40S ribosomal protein S8                                121   1e-31   Glycine soja [wild soybean]
dbj|BAA07207.1|  ribosomal protein S8                                   121   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010252680.1|  PREDICTED: 40S ribosomal protein S8                121   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006484807.1|  PREDICTED: 40S ribosomal protein S8-like           121   1e-31   Citrus sinensis [apfelsine]
ref|XP_003547779.1|  PREDICTED: 40S ribosomal protein S8                121   1e-31   Glycine max [soybeans]
ref|XP_010646836.1|  PREDICTED: 40S ribosomal protein S8                121   1e-31   
gb|KCW58021.1|  hypothetical protein EUGRSUZ_H00750                     121   1e-31   Eucalyptus grandis [rose gum]
ref|XP_010069614.1|  PREDICTED: 40S ribosomal protein S8-like           121   1e-31   Eucalyptus grandis [rose gum]
ref|XP_011069406.1|  PREDICTED: 40S ribosomal protein S8                121   1e-31   Sesamum indicum [beniseed]
ref|XP_002452585.1|  hypothetical protein SORBIDRAFT_04g028530          121   2e-31   Sorghum bicolor [broomcorn]
ref|XP_004953910.1|  PREDICTED: 40S ribosomal protein S8-like           121   2e-31   Setaria italica
gb|KJB81683.1|  hypothetical protein B456_013G156600                    122   2e-31   Gossypium raimondii
ref|XP_010905161.1|  PREDICTED: 40S ribosomal protein S8-like           121   2e-31   Elaeis guineensis
ref|XP_006833291.1|  hypothetical protein AMTR_s00109p00031400          121   2e-31   Amborella trichopoda
ref|XP_004975334.1|  PREDICTED: 40S ribosomal protein S8-like           121   2e-31   Setaria italica
ref|XP_010913108.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     121   2e-31   Elaeis guineensis
ref|XP_004240435.1|  PREDICTED: 40S ribosomal protein S8-2              120   2e-31   Solanum lycopersicum
ref|XP_010907235.1|  PREDICTED: 40S ribosomal protein S8-like           121   2e-31   Elaeis guineensis
ref|XP_002269042.2|  PREDICTED: 40S ribosomal protein S8                120   2e-31   Vitis vinifera
ref|XP_008809644.1|  PREDICTED: 40S ribosomal protein S8                120   2e-31   Phoenix dactylifera
ref|XP_003520991.1|  PREDICTED: 40S ribosomal protein S8-like           120   2e-31   Glycine max [soybeans]
ref|XP_002446216.1|  hypothetical protein SORBIDRAFT_06g004770          120   3e-31   Sorghum bicolor [broomcorn]
ref|NP_001132384.1|  uncharacterized protein LOC100193830               120   3e-31   Zea mays [maize]
ref|XP_010913109.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     120   3e-31   Elaeis guineensis
ref|XP_011021175.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     120   3e-31   Populus euphratica
ref|XP_009405538.1|  PREDICTED: 40S ribosomal protein S8-like           120   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010270147.1|  PREDICTED: 40S ribosomal protein S8-like           120   3e-31   Nelumbo nucifera [Indian lotus]
gb|EAY93669.1|  hypothetical protein OsI_15456                          120   3e-31   Oryza sativa Indica Group [Indian rice]
gb|KHF98591.1|  40S ribosomal S8                                        120   3e-31   Gossypium arboreum [tree cotton]
ref|XP_006373483.1|  hypothetical protein POPTR_0017s14180g             120   3e-31   Populus trichocarpa [western balsam poplar]
ref|NP_001052526.1|  Os04g0349500                                       120   3e-31   
ref|XP_011095494.1|  PREDICTED: 40S ribosomal protein S8                120   3e-31   Sesamum indicum [beniseed]
ref|XP_002299926.1|  40S ribosomal protein S8                           120   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_008679876.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     121   3e-31   Zea mays [maize]
ref|XP_004510234.1|  PREDICTED: 40S ribosomal protein S8-like           120   4e-31   Cicer arietinum [garbanzo]
gb|ACJ86093.1|  unknown                                                 120   4e-31   Medicago truncatula
ref|XP_009403610.1|  PREDICTED: 40S ribosomal protein S8-like           120   4e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008679872.1|  PREDICTED: 40S ribosomal protein S8-like           122   4e-31   
ref|XP_011021176.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     120   4e-31   Populus euphratica
gb|EYU33688.1|  hypothetical protein MIMGU_mgv1a013525mg                120   4e-31   Erythranthe guttata [common monkey flower]
ref|XP_006373482.1|  hypothetical protein POPTR_0017s14180g             120   4e-31   Populus trichocarpa [western balsam poplar]
ref|XP_004247043.1|  PREDICTED: 40S ribosomal protein S8                120   5e-31   Solanum lycopersicum
ref|XP_008657369.1|  PREDICTED: uncharacterized protein LOC100193...    120   5e-31   Zea mays [maize]
ref|XP_003551567.1|  PREDICTED: 40S ribosomal protein S8                120   5e-31   Glycine max [soybeans]
ref|XP_004290159.1|  PREDICTED: 40S ribosomal protein S8-like           120   5e-31   Fragaria vesca subsp. vesca
gb|AFK47179.1|  unknown                                                 119   5e-31   Medicago truncatula
ref|NP_001274851.1|  uncharacterized protein LOC102577693               120   5e-31   Solanum tuberosum [potatoes]
gb|EYU33690.1|  hypothetical protein MIMGU_mgv1a013952mg                119   5e-31   Erythranthe guttata [common monkey flower]
ref|XP_010235437.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     120   5e-31   Brachypodium distachyon [annual false brome]
ref|XP_007020644.1|  40S ribosomal protein S8 isoform 1                 119   5e-31   
ref|XP_002313320.1|  40S ribosomal protein S8                           119   5e-31   Populus trichocarpa [western balsam poplar]
gb|ABL85034.1|  ribosomal subunit 8E protein                            119   6e-31   Brachypodium sylvaticum
ref|XP_003574981.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     120   6e-31   Brachypodium distachyon [annual false brome]
ref|XP_008778380.1|  PREDICTED: 40S ribosomal protein S8-like           119   6e-31   Phoenix dactylifera
ref|XP_003557224.1|  PREDICTED: 40S ribosomal protein S8                120   6e-31   Brachypodium distachyon [annual false brome]
ref|XP_009378162.1|  PREDICTED: 40S ribosomal protein S8-like           119   6e-31   Pyrus x bretschneideri [bai li]
ref|XP_008227073.1|  PREDICTED: 40S ribosomal protein S8-like           119   6e-31   Prunus mume [ume]
ref|XP_008366424.1|  PREDICTED: 40S ribosomal protein S8                119   6e-31   Malus domestica [apple tree]
gb|EYU27406.1|  hypothetical protein MIMGU_mgv1a013520mg                119   6e-31   Erythranthe guttata [common monkey flower]
ref|XP_009373606.1|  PREDICTED: 40S ribosomal protein S8                119   6e-31   Pyrus x bretschneideri [bai li]
ref|XP_004492266.1|  PREDICTED: 40S ribosomal protein S8-like           119   6e-31   Cicer arietinum [garbanzo]
ref|XP_009413565.1|  PREDICTED: 40S ribosomal protein S8-like           119   7e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007211997.1|  hypothetical protein PRUPE_ppa011067mg             119   7e-31   
ref|XP_011461093.1|  PREDICTED: 40S ribosomal protein S8                119   7e-31   Fragaria vesca subsp. vesca
ref|NP_200732.2|  40S ribosomal protein S8-2                            119   7e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009371092.1|  PREDICTED: 40S ribosomal protein S8-like           119   7e-31   Pyrus x bretschneideri [bai li]
sp|O81361.1|RS8_PRUAR  RecName: Full=40S ribosomal protein S8           119   7e-31   Prunus armeniaca
gb|ACU16398.1|  unknown                                                 120   7e-31   Glycine max [soybeans]
ref|XP_002529032.1|  40S ribosomal protein S8, putative                 119   7e-31   Ricinus communis
ref|XP_009349000.1|  PREDICTED: 40S ribosomal protein S8-like           119   7e-31   Pyrus x bretschneideri [bai li]
ref|XP_009361080.1|  PREDICTED: 40S ribosomal protein S8-like           119   7e-31   Pyrus x bretschneideri [bai li]
ref|XP_008337490.1|  PREDICTED: 40S ribosomal protein S8                119   7e-31   Malus domestica [apple tree]
ref|XP_009416597.1|  PREDICTED: 40S ribosomal protein S8                119   7e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU19111.1|  unknown                                                 119   8e-31   Glycine max [soybeans]
ref|XP_008222788.1|  PREDICTED: 40S ribosomal protein S8                119   8e-31   Prunus mume [ume]
ref|XP_010454644.1|  PREDICTED: 40S ribosomal protein S8-2              119   8e-31   Camelina sativa [gold-of-pleasure]
ref|XP_002275094.1|  PREDICTED: 40S ribosomal protein S8                119   8e-31   Vitis vinifera
emb|CAA03954.1|  ribosomal protein S8                                   116   9e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010483522.1|  PREDICTED: 40S ribosomal protein S8-2-like         119   9e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010675861.1|  PREDICTED: 40S ribosomal protein S8                119   9e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002864608.1|  40S ribosomal protein S8                           119   9e-31   
ref|XP_007223947.1|  hypothetical protein PRUPE_ppa011148mg             119   9e-31   Prunus persica
ref|XP_010693327.1|  PREDICTED: 40S ribosomal protein S8-like           119   9e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009610547.1|  PREDICTED: 40S ribosomal protein S8                119   1e-30   Nicotiana tomentosiformis
ref|XP_004242427.1|  PREDICTED: 40S ribosomal protein S8                119   1e-30   Solanum lycopersicum
gb|KHG09566.1|  40S ribosomal protein S8                                117   1e-30   Gossypium arboreum [tree cotton]
gb|EMT18438.1|  40S ribosomal protein S8                                119   1e-30   
gb|KJB22659.1|  hypothetical protein B456_004G059300                    119   1e-30   Gossypium raimondii
ref|XP_009783183.1|  PREDICTED: 40S ribosomal protein S8                119   1e-30   Nicotiana sylvestris
emb|CDY60374.1|  BnaCnng36150D                                          119   1e-30   Brassica napus [oilseed rape]
ref|XP_010243157.1|  PREDICTED: 40S ribosomal protein S8-like iso...    119   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010243156.1|  PREDICTED: 40S ribosomal protein S8-like iso...    119   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_006409551.1|  hypothetical protein EUTSA_v10022838mg             119   1e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010278451.1|  PREDICTED: 40S ribosomal protein S8-like           119   1e-30   Nelumbo nucifera [Indian lotus]
gb|AFK37035.1|  unknown                                                 119   1e-30   Lotus japonicus
gb|KJB84081.1|  hypothetical protein B456_N005000                       119   1e-30   Gossypium raimondii
ref|XP_006400597.1|  hypothetical protein EUTSA_v10014589mg             119   1e-30   Eutrema salsugineum [saltwater cress]
ref|XP_002873989.1|  ribosomal protein S8                               119   1e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_009131790.1|  PREDICTED: 40S ribosomal protein S8-1              119   1e-30   Brassica rapa
gb|AFK33351.1|  unknown                                                 118   2e-30   Lotus japonicus
ref|XP_009771719.1|  PREDICTED: 40S ribosomal protein S8                118   2e-30   Nicotiana sylvestris
ref|XP_006352667.1|  PREDICTED: 40S ribosomal protein S8-like           118   2e-30   Solanum tuberosum [potatoes]
ref|NP_001240243.1|  uncharacterized protein LOC100813170               118   2e-30   Glycine max [soybeans]
ref|XP_006601753.1|  PREDICTED: uncharacterized protein LOC100500...    118   2e-30   
ref|XP_009120819.1|  PREDICTED: 40S ribosomal protein S8-1              118   2e-30   Brassica rapa
ref|XP_002534344.1|  40S ribosomal protein S8, putative                 118   2e-30   Ricinus communis
ref|XP_006286561.1|  hypothetical protein CARUB_v10001914mg             118   2e-30   Capsella rubella
ref|XP_009126438.1|  PREDICTED: 40S ribosomal protein S8-1-like         118   2e-30   Brassica rapa
gb|AFK40150.1|  unknown                                                 118   2e-30   Lotus japonicus
ref|XP_010493138.1|  PREDICTED: 40S ribosomal protein S8-1              117   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009778867.1|  PREDICTED: 40S ribosomal protein S8-like           117   3e-30   Nicotiana sylvestris
ref|XP_007149668.1|  hypothetical protein PHAVU_005G089100g             117   3e-30   Phaseolus vulgaris [French bean]
ref|XP_006856815.1|  hypothetical protein AMTR_s00055p00155570          117   3e-30   Amborella trichopoda
emb|CDX92472.1|  BnaA10g15110D                                          118   3e-30   
ref|XP_008451649.1|  PREDICTED: 40S ribosomal protein S8-like           117   3e-30   Cucumis melo [Oriental melon]
ref|XP_010420870.1|  PREDICTED: 40S ribosomal protein S8-1-like         117   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009596732.1|  PREDICTED: 40S ribosomal protein S8                117   4e-30   Nicotiana tomentosiformis
emb|CDY35814.1|  BnaC09g37460D                                          118   4e-30   Brassica napus [oilseed rape]
ref|XP_008364326.1|  PREDICTED: 40S ribosomal protein S8-like           117   4e-30   
emb|CDY45095.1|  BnaA02g04810D                                          118   4e-30   Brassica napus [oilseed rape]
ref|XP_009406344.1|  PREDICTED: 40S ribosomal protein S8-like           117   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ89904.1|  predicted protein                                      117   4e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008466734.1|  PREDICTED: 40S ribosomal protein S8-2              117   5e-30   Cucumis melo [Oriental melon]
ref|XP_006281069.1|  hypothetical protein CARUB_v10027092mg             117   5e-30   Capsella rubella
ref|XP_006344091.1|  PREDICTED: 40S ribosomal protein S8-like           117   5e-30   Solanum tuberosum [potatoes]
gb|KFK31870.1|  hypothetical protein AALP_AA6G169300                    117   5e-30   Arabis alpina [alpine rockcress]
ref|XP_004148331.1|  PREDICTED: 40S ribosomal protein S8-like           117   6e-30   Cucumis sativus [cucumbers]
gb|KFK26269.1|  hypothetical protein AALP_AA8G225000                    117   6e-30   Arabis alpina [alpine rockcress]
gb|AGV54796.1|  40S ribosomal protein S8                                117   7e-30   Phaseolus vulgaris [French bean]
ref|XP_009602561.1|  PREDICTED: 40S ribosomal protein S8-like           117   8e-30   Nicotiana tomentosiformis
ref|NP_001236970.1|  uncharacterized protein LOC100500112               116   1e-29   
emb|CDX88842.1|  BnaA03g08070D                                          117   1e-29   
ref|NP_197529.1|  40S ribosomal protein S8-1                            116   1e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CDP15136.1|  unnamed protein product                                117   1e-29   Coffea canephora [robusta coffee]
ref|XP_003626942.1|  Ribosomal protein S8                               120   1e-29   
ref|XP_004160707.1|  PREDICTED: 40S ribosomal protein S8-like           115   2e-29   
ref|XP_004149800.1|  PREDICTED: 40S ribosomal protein S8-like           115   2e-29   Cucumis sativus [cucumbers]
gb|ABK21933.1|  unknown                                                 115   2e-29   Picea sitchensis
gb|ABK22298.1|  unknown                                                 115   2e-29   Picea sitchensis
gb|ABK21921.1|  unknown                                                 115   2e-29   Picea sitchensis
gb|EMS65111.1|  40S ribosomal protein S8                                115   6e-29   Triticum urartu
gb|ABR16896.1|  unknown                                                 114   1e-28   Picea sitchensis
ref|XP_010535902.1|  PREDICTED: 40S ribosomal protein S8-1-like         113   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_010541736.1|  PREDICTED: 40S ribosomal protein S8-1-like         113   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_009619873.1|  PREDICTED: 40S ribosomal protein S8-like           112   2e-28   Nicotiana tomentosiformis
ref|XP_009770276.1|  PREDICTED: 40S ribosomal protein S8-like           112   3e-28   Nicotiana sylvestris
gb|ACJ83894.1|  unknown                                                 112   4e-28   Medicago truncatula
ref|XP_010519957.1|  PREDICTED: 40S ribosomal protein S8-1              112   4e-28   Tarenaya hassleriana [spider flower]
ref|XP_009765854.1|  PREDICTED: 40S ribosomal protein S8-like           112   4e-28   Nicotiana sylvestris
gb|EYU39185.1|  hypothetical protein MIMGU_mgv1a013531mg                111   4e-28   Erythranthe guttata [common monkey flower]
ref|XP_009594581.1|  PREDICTED: 40S ribosomal protein S8-2-like         112   5e-28   Nicotiana tomentosiformis
gb|EYU39184.1|  hypothetical protein MIMGU_mgv1a013531mg                112   6e-28   Erythranthe guttata [common monkey flower]
ref|XP_006346168.1|  PREDICTED: 40S ribosomal protein S8-like           111   9e-28   Solanum tuberosum [potatoes]
ref|XP_004244061.1|  PREDICTED: 40S ribosomal protein S8-like           110   1e-27   Solanum lycopersicum
ref|XP_007049645.1|  40S ribosomal protein S8 isoform 3                 110   2e-27   
gb|KJB81682.1|  hypothetical protein B456_013G156600                    110   2e-27   Gossypium raimondii
gb|AFW61714.1|  putative ribosomal protein S8e family protein           108   3e-27   
gb|KJB62960.1|  hypothetical protein B456_009G445800                    109   3e-27   Gossypium raimondii
ref|XP_011089042.1|  PREDICTED: 40S ribosomal protein S8-like           110   3e-27   Sesamum indicum [beniseed]
gb|KJB13806.1|  hypothetical protein B456_002G095300                    109   3e-27   Gossypium raimondii
gb|ACI15738.1|  putative 40S ribosomal protein S8-like protein          109   5e-27   Picrorhiza kurrooa
ref|XP_006652189.1|  PREDICTED: 40S ribosomal protein S8-like           109   5e-27   
gb|ACN31997.1|  unknown                                                 109   6e-27   Zea mays [maize]
emb|CBI39377.3|  unnamed protein product                                108   7e-27   Vitis vinifera
emb|CDP03936.1|  unnamed protein product                                108   7e-27   Coffea canephora [robusta coffee]
ref|XP_006648644.1|  PREDICTED: 40S ribosomal protein S8-like           108   9e-27   
ref|XP_006369983.1|  hypothetical protein POPTR_0001s37140g             108   9e-27   
gb|KHG14255.1|  40S ribosomal S8                                        108   9e-27   Gossypium arboreum [tree cotton]
ref|XP_010520566.1|  PREDICTED: 40S ribosomal protein S8-1-like         108   1e-26   Tarenaya hassleriana [spider flower]
ref|XP_010327196.1|  PREDICTED: 40S ribosomal protein S8                108   1e-26   Solanum lycopersicum
ref|NP_001275100.1|  putative 40S ribosomal protein S8-like protein     108   2e-26   Solanum tuberosum [potatoes]
ref|XP_006352532.1|  PREDICTED: 40S ribosomal protein S8                108   2e-26   
gb|EPS68663.1|  hypothetical protein M569_06106                         107   2e-26   Genlisea aurea
emb|CBI26725.3|  unnamed protein product                                107   3e-26   Vitis vinifera
ref|XP_008647178.1|  PREDICTED: 40S ribosomal protein S8-like           106   3e-26   
ref|XP_001761026.1|  predicted protein                                  107   4e-26   
gb|KJB22660.1|  hypothetical protein B456_004G059300                    107   4e-26   Gossypium raimondii
ref|XP_010926672.1|  PREDICTED: 40S ribosomal protein S8-like iso...    106   5e-26   
ref|XP_010926670.1|  PREDICTED: 40S ribosomal protein S8-like iso...    106   6e-26   
gb|EPS68749.1|  hypothetical protein M569_06019                         108   7e-26   Genlisea aurea
gb|KHG07290.1|  40S ribosomal S8                                        104   8e-26   Gossypium arboreum [tree cotton]
ref|XP_001777813.1|  predicted protein                                  106   8e-26   
ref|XP_001773385.1|  predicted protein                                  106   9e-26   
ref|XP_010097296.1|  40S ribosomal protein S8                           105   1e-25   
emb|CEG02139.1|  Ribosomal protein S8e/ribosomal biogenesis NSA2        105   1e-25   Ostreococcus tauri
ref|XP_001777587.1|  predicted protein                                  105   2e-25   
ref|XP_001780988.1|  predicted protein                                  105   2e-25   
gb|AFW61715.1|  putative ribosomal protein S8e family protein           105   2e-25   
gb|AFW62789.1|  putative ribosomal protein S8e family protein           105   2e-25   
ref|XP_008676181.1|  PREDICTED: thioredoxin domain-containing pro...    105   4e-25   
gb|AFW73090.1|  putative ribosomal protein S8e family protein           106   4e-25   
ref|XP_008660669.1|  PREDICTED: 40S ribosomal protein S8-like           102   7e-25   
gb|AFW85401.1|  putative ribosomal protein S8e family protein           103   8e-25   
ref|XP_001422585.1|  Ribosomal protein S8, component of cytosolic...    103   1e-24   Ostreococcus lucimarinus CCE9901
gb|AAT08014.1|  putative 40S ribosomal protein S8                       103   2e-24   Zea mays [maize]
ref|XP_002945874.1|  component of cytosolic 80S ribosome and 40S ...    101   4e-24   Volvox carteri f. nagariensis
gb|AFW85400.1|  putative ribosomal protein S8e family protein           103   4e-24   
ref|XP_001696201.1|  ribosomal protein S8, component of cytosolic...    100   1e-23   Chlamydomonas reinhardtii
tpg|DAA42540.1|  TPA: putative ribosomal protein S8e family protein     101   1e-23   
gb|ABA01100.1|  40S ribosomal protein S8                                100   1e-23   Chlamydomonas incerta
gb|KDD75705.1|  ribosomal protein S8e                                   102   1e-23   Helicosporidium sp. ATCC 50920
gb|AET01418.2|  40S ribosomal protein S8                                100   3e-23   Medicago truncatula
gb|AES86897.2|  40S ribosomal S8-like protein                         99.4    3e-23   Medicago truncatula
ref|XP_003604700.1|  Ribosomal protein S8                             99.8    6e-23   
ref|XP_002963298.1|  hypothetical protein SELMODRAFT_80565            97.1    2e-22   
ref|XP_004516802.1|  PREDICTED: 40S ribosomal protein S8-like         96.7    9e-22   
ref|XP_008676011.1|  PREDICTED: 40S ribosomal protein S8-like         97.1    9e-22   
ref|XP_003083062.1|  RS8_MAIZE 40S ribosomal protein S8 pir||T040...  96.7    1e-21   
gb|EPZ31448.1|  40S ribosomal protein S8-B                            95.1    1e-21   Rozella allomycis CSF55
ref|XP_002505425.1|  predicted protein                                95.1    1e-21   Micromonas commoda
ref|XP_003195106.1|  40S ribosomal protein S8                         94.7    2e-21   Cryptococcus gattii WM276
ref|XP_572078.1|  40S ribosomal protein S8                            94.7    2e-21   Cryptococcus neoformans var. neoformans JEC21
ref|XP_006377633.1|  hypothetical protein POPTR_0011s09100g           92.0    2e-21   
gb|AFR96425.1|  small subunit ribosomal protein S8e                   94.4    2e-21   Cryptococcus neoformans var. grubii H99
gb|KGB76549.1|  40S ribosomal protein S8                              94.4    2e-21   Cryptococcus gattii VGII R265
gb|KIR49123.1|  ribosomal protein S8.e                                94.0    3e-21   Cryptococcus gattii CA1280
ref|XP_005648786.1|  40S ribosomal protein S8                         92.8    8e-21   Coccomyxa subellipsoidea C-169
emb|CCA22399.1|  40S ribosomal protein S82 putative                   92.0    1e-20   Albugo laibachii Nc14
ref|XP_004513783.1|  PREDICTED: 40S ribosomal protein S8-like         89.7    2e-20   Cicer arietinum [garbanzo]
ref|XP_011397165.1|  40S ribosomal protein S8                         91.7    2e-20   Auxenochlorella protothecoides
ref|XP_001487630.1|  hypothetical protein PGUG_01007                  90.9    4e-20   Meyerozyma guilliermondii ATCC 6260
ref|XP_007001047.1|  hypothetical protein TREMEDRAFT_55820            90.5    5e-20   Tremella mesenterica DSM 1558
gb|EKD00868.1|  40S ribosomal protein S8                              90.5    5e-20   Trichosporon asahii var. asahii CBS 8904
ref|XP_005702569.1|  40S ribosomal protein S8e                        90.5    7e-20   Galdieria sulphuraria
gb|KIK09143.1|  hypothetical protein K443DRAFT_447984                 90.5    7e-20   Laccaria amethystina LaAM-08-1
emb|CCI48864.1|  unnamed protein product                              90.1    9e-20   Albugo candida
ref|XP_005708143.1|  40S ribosomal protein S8                         89.4    1e-19   Galdieria sulphuraria
gb|KIY95759.1|  40S ribosomal protein S8                              87.0    1e-19   Monoraphidium neglectum
ref|XP_003059699.1|  predicted protein                                89.4    2e-19   Micromonas pusilla CCMP1545
gb|KIL68834.1|  hypothetical protein M378DRAFT_157968                 89.4    2e-19   Amanita muscaria Koide BX008
ref|XP_007873882.1|  30S ribosomal protein S8e                        89.0    2e-19   
gb|KIO10111.1|  hypothetical protein M404DRAFT_996068                 89.0    3e-19   Pisolithus tinctorius Marx 270
gb|ETN68840.1|  ribosomal protein S8.e                                88.6    3e-19   Necator americanus
gb|EYB94089.1|  hypothetical protein Y032_0175g487                    88.6    3e-19   Ancylostoma ceylanicum
gb|EJT52835.1|  40S ribosomal protein S8                              88.6    4e-19   Trichosporon asahii var. asahii CBS 2479
ref|XP_001880116.1|  40S ribosomal protein S8                         88.2    4e-19   Laccaria bicolor S238N-H82
ref|XP_003291144.1|  40S ribosomal protein S8                         88.2    4e-19   Dictyostelium purpureum
ref|XP_006461206.1|  hypothetical protein AGABI2DRAFT_136253          88.2    5e-19   Agaricus bisporus var. bisporus H97
gb|KHJ83273.1|  ribosomal protein S8.e                                88.2    5e-19   Oesophagostomum dentatum [nodule worm]
gb|KDQ27658.1|  hypothetical protein PLEOSDRAFT_1089421               88.2    5e-19   Pleurotus ostreatus PC15
gb|KIY49072.1|  hypothetical protein FISHEDRAFT_65531                 88.6    5e-19   Fistulina hepatica ATCC 64428
gb|KIW06343.1|  40S ribosomal protein S8-A                            87.8    6e-19   Verruconis gallopava
ref|XP_007397269.1|  hypothetical protein PHACADRAFT_258531           87.8    7e-19   Phanerochaete carnosa HHB-10118-sp
ref|XP_009831251.1|  40S ribosomal protein S8                         87.4    7e-19   Aphanomyces astaci
gb|EJU03954.1|  40S ribosomal protein S8                              87.4    7e-19   Dacryopinax primogenitus
gb|EYB94090.1|  hypothetical protein Y032_0175g487                    88.2    9e-19   Ancylostoma ceylanicum
ref|XP_005539190.1|  40S ribosomal protein S8                         87.4    1e-18   Cyanidioschyzon merolae strain 10D
ref|XP_002552513.1|  40S ribosomal protein S8                         87.0    1e-18   Lachancea thermotolerans CBS 6340
emb|CEP60259.1|  LALA0S01e06612g1_1                                   87.0    1e-18   
ref|XP_006957934.1|  ribosomal protein S8e                            87.0    1e-18   
gb|EMG50668.1|  Ribosomal protein S8                                  86.7    1e-18   
gb|KIM92086.1|  hypothetical protein PILCRDRAFT_810109                87.0    1e-18   
emb|CDJ87972.1|  Ribosomal protein S8e domain containing protein      86.7    1e-18   
gb|KGG52480.1|  40S ribosomal protein S8                              86.7    2e-18   
ref|XP_765516.1|  40S ribosomal protein S8e                           86.3    2e-18   
ref|XP_002472702.1|  40S ribosomal protein S8                         86.7    2e-18   
ref|XP_712831.1|  likely cytosolic ribosomal protein S8               86.3    2e-18   
gb|KFH71035.1|  40S ribosomal protein S8                              86.3    2e-18   
gb|KII92951.1|  hypothetical protein PLICRDRAFT_89444                 86.7    2e-18   
ref|XP_458360.1|  40S ribosomal protein S8                            86.3    2e-18   
ref|XP_003716723.1|  40S ribosomal protein S8                         86.3    2e-18   
gb|ABM97467.1|  Rps8Ap                                                84.0    2e-18   
gb|EIF49970.1|  40s ribosomal protein s8                              85.9    2e-18   
ref|XP_008871313.1|  40S ribosomal protein S8                         86.3    2e-18   
gb|KIM64970.1|  hypothetical protein SCLCIDRAFT_1212646               86.3    2e-18   
ref|XP_007843664.1|  40s ribosomal protein s8                         86.3    3e-18   
gb|AFJ45046.1|  ribosomal protein S8                                  85.5    3e-18   
gb|KIY67149.1|  40S ribosomal protein S8                              85.9    3e-18   
ref|XP_629872.1|  40S ribosomal protein S8                            85.9    4e-18   
ref|XP_002602335.1|  hypothetical protein BRAFLDRAFT_268377           85.9    4e-18   
ref|XP_003029339.1|  40S ribosomal protein S8                         85.5    4e-18   
gb|KDQ57766.1|  hypothetical protein JAAARDRAFT_35455                 85.5    4e-18   
ref|XP_009227358.1|  40S ribosomal protein S8                         85.5    5e-18   
gb|KIK45130.1|  hypothetical protein CY34DRAFT_22712                  85.5    5e-18   
gb|AFJ45055.1|  ribosomal protein S8                                  85.1    5e-18   
ref|XP_007864455.1|  ribosomal protein S8e                            85.5    5e-18   
ref|XP_008033648.1|  40S ribosomal protein S8                         85.5    5e-18   
gb|KFH66279.1|  30S ribosomal protein S8e                             85.1    5e-18   
ref|XP_951769.1|  40S ribosomal protein S8                            84.7    5e-18   
emb|CEG73596.1|  Putative 40S ribosomal protein S8                    85.1    5e-18   
ref|XP_668115.1|  ribosomal protein S8                                85.1    5e-18   
emb|CEG65019.1|  Putative 40S ribosomal protein S8                    85.1    6e-18   
ref|XP_007266897.1|  40S ribosomal protein S8                         85.1    6e-18   
emb|CDH14245.1|  40S ribosomal protein S8-B                           85.1    6e-18   
gb|ABB86779.1|  putative 40S ribosomal protein S8                     83.2    6e-18   
ref|NP_594519.1|  40S ribosomal protein S8                            85.1    6e-18   
ref|NP_593100.1|  40S ribosomal protein S8                            85.1    6e-18   
emb|CDF90767.1|  ZYBA0S08-02542g1_1                                   85.1    7e-18   
ref|XP_009691025.1|  40S ribosomal protein S8                         84.7    7e-18   
gb|KIP11649.1|  hypothetical protein PHLGIDRAFT_27859                 85.1    7e-18   
ref|XP_005815191.1|  PREDICTED: 40S ribosomal protein S8-like iso...  85.1    7e-18   
ref|XP_007374865.1|  hypothetical protein SPAPADRAFT_60688            84.7    7e-18   
gb|ADO27837.1|  40S ribosomal protein s8                              85.1    7e-18   
ref|XP_003975488.1|  PREDICTED: 40S ribosomal protein S8-like         85.1    7e-18   
ref|NP_987041.1|  40S ribosomal protein S8                            84.7    7e-18   
gb|AGO10734.1|  AaceriAGR375Wp                                        84.7    8e-18   
gb|AFJ45049.1|  ribosomal protein S8                                  84.3    8e-18   
ref|XP_003319908.2|  40S ribosomal protein S8                         84.7    8e-18   
gb|AFJ45048.1|  ribosomal protein S8                                  84.3    8e-18   
ref|XP_001830182.1|  40S ribosomal protein S8                         84.7    8e-18   
emb|CAH57693.1|  40S ribosomal protein S8                             84.7    9e-18   
gb|ETL40555.1|  40S ribosomal protein S8                              84.7    9e-18   
ref|XP_004197370.1|  Piso0_004620                                     84.7    9e-18   
ref|XP_010746502.1|  PREDICTED: 40S ribosomal protein S8              84.7    9e-18   
ref|NP_001187073.1|  40S ribosomal protein S8                         84.7    9e-18   
gb|ABJ98605.1|  40S ribosomal protein S8                              84.0    9e-18   
gb|KIJ26939.1|  hypothetical protein M422DRAFT_76964                  84.7    1e-17   
ref|XP_005844426.1|  hypothetical protein CHLNCDRAFT_139122           84.7    1e-17   
ref|XP_009269190.1|  40S ribosomal protein S8-B                       84.3    1e-17   
ref|XP_006691073.1|  ribosomal protein S8-like protein                84.3    1e-17   
ref|XP_001622696.1|  hypothetical protein NEMVEDRAFT_v1g195152        84.3    1e-17   
dbj|BAM17705.1|  ribosomal protein S8                                 84.3    1e-17   
ref|XP_004078646.1|  PREDICTED: 40S ribosomal protein S8              84.3    1e-17   
gb|EJT41679.1|  hypothetical protein SKUD_188904                      84.3    1e-17   
gb|EHN03767.1|  Rps8bp                                                84.3    1e-17   
dbj|BAF45896.1|  ribosomal protein S8                                 84.3    1e-17   
gb|EXX59187.1|  ribosomal 40S subunit protein S8B                     82.8    1e-17   
ref|XP_007317717.1|  hypothetical protein SERLADRAFT_387784           84.3    1e-17   
gb|EHN02771.1|  Rps8bp                                                84.3    1e-17   
ref|XP_003959673.1|  hypothetical protein KAFR_0K01840                84.0    1e-17   
ref|XP_003670476.1|  ribosomal protein S8                             84.3    1e-17   
gb|KIK27780.1|  hypothetical protein PISMIDRAFT_169173                84.3    1e-17   
gb|KIK67276.1|  hypothetical protein GYMLUDRAFT_861869                84.3    1e-17   
gb|ACQ57870.1|  40S ribosomal protein S8                              84.3    1e-17   
ref|XP_011102403.1|  rps8ap                                           84.0    1e-17   
gb|AFM88001.1|  40S ribosomal protein S8                              84.3    1e-17   
ref|XP_009026500.1|  hypothetical protein HELRODRAFT_193555           84.3    1e-17   
gb|KDO22073.1|  40S ribosomal protein S8                              84.0    1e-17   
ref|XP_007509806.1|  40S ribosomal protein S8                         84.7    1e-17   
ref|NP_009481.1|  ribosomal 40S subunit protein S8A                   84.0    1e-17   
gb|EHN08504.1|  Rps8bp                                                84.0    1e-17   
gb|EFA78291.1|  40S ribosomal protein S8                              84.3    1e-17   
ref|XP_008333134.1|  PREDICTED: 40S ribosomal protein S8              84.0    1e-17   
ref|XP_007361817.1|  ribosomal protein S8e                            84.0    2e-17   
ref|XP_008608971.1|  40S ribosomal protein S8                         84.0    2e-17   
gb|AJQ07966.1|  Rps8ap                                                84.0    2e-17   
dbj|GAA21481.1|  K7_Rps8ap                                            84.0    2e-17   
gb|EDN63078.1|  ribosomal protein S8B                                 84.0    2e-17   
ref|NP_001128155.1|  40S ribosomal protein S8                         84.0    2e-17   
gb|ADX97198.1|  40S ribosomal protein s8                              84.0    2e-17   
gb|AGH70192.1|  40S ribosomal protein S8                              84.0    2e-17   
ref|XP_007567486.1|  PREDICTED: 40S ribosomal protein S8              84.0    2e-17   
emb|CCA75905.1|  probable RPS8A-ribosomal protein S8.e                82.4    2e-17   
gb|EGA75169.1|  Rps8bp                                                84.0    2e-17   
ref|XP_008290025.1|  PREDICTED: 40S ribosomal protein S8              84.0    2e-17   
gb|EXX59184.1|  ribosomal 40S subunit protein S8B                     82.8    2e-17   
gb|EPT02637.1|  hypothetical protein FOMPIDRAFT_1022771               84.0    2e-17   
ref|XP_001376099.1|  PREDICTED: 40S ribosomal protein S8              84.0    2e-17   
ref|XP_001384365.1|  40S ribosomal protein S8                         84.0    2e-17   
emb|CCK69459.1|  hypothetical protein KNAG_0C03550                    84.0    2e-17   
ref|XP_005303088.1|  PREDICTED: 40S ribosomal protein S8              84.0    2e-17   
gb|ACH44382.1|  putative 40S ribosomal protein S8                     84.0    2e-17   
ref|NP_001239055.1|  40S ribosomal protein S8                         84.0    2e-17   
emb|CCK68675.1|  hypothetical protein KNAG_0B02330                    83.6    2e-17   
ref|XP_008107755.1|  PREDICTED: 40S ribosomal protein S8              84.0    2e-17   
ref|XP_008947226.1|  PREDICTED: 40S ribosomal protein S8              84.0    2e-17   
ref|NP_001232282.1|  putative 40S ribosomal protein S8                84.0    2e-17   
ref|XP_006273333.1|  PREDICTED: 40S ribosomal protein S8              84.0    2e-17   
gb|AJP85760.1|  Rps8ap                                                83.6    2e-17   
ref|XP_007878137.1|  hypothetical protein PFL1_06854                  84.0    2e-17   
gb|ACH44381.1|  putative 40S ribosomal protein S8                     84.0    2e-17   
ref|XP_002618871.1|  hypothetical protein CLUG_00030                  83.6    2e-17   
gb|EHJ65952.1|  40S ribosomal protein S8                              84.3    2e-17   
gb|AFJ45052.1|  ribosomal protein S8                                  83.6    2e-17   
gb|KEZ46043.1|  40S ribosomal protein S8-B                            83.6    2e-17   
gb|EXX59183.1|  ribosomal 40S subunit protein S8B                     83.6    2e-17   
gb|EXX59185.1|  ribosomal 40S subunit protein S8B                     82.8    2e-17   
gb|KIX05545.1|  40S ribosomal protein S8-B                            83.6    2e-17   
emb|CDR38460.1|  CYFA0S02e01926g1_1                                   83.6    2e-17   
sp|Q9ZT56.1|RS8_GRIJA  RecName: Full=40S ribosomal protein S8         83.6    2e-17   
gb|AFJ45051.1|  ribosomal protein S8                                  83.2    2e-17   
ref|XP_627792.1|  40S ribosomal protein S8                            83.6    2e-17   
dbj|BAM18930.1|  ribosomal protein S8                                 83.2    3e-17   
ref|XP_444964.1|  40S ribosomal protein S8                            83.2    3e-17   
gb|AFJ45047.1|  ribosomal protein S8                                  83.2    3e-17   
gb|KJA28980.1|  hypothetical protein HYPSUDRAFT_155175                83.6    3e-17   
ref|XP_007725772.1|  40S ribosomal protein S8                         83.2    3e-17   
ref|XP_009524162.1|  hypothetical protein PHYSODRAFT_285611           83.2    3e-17   
dbj|GAM17360.1|  hypothetical protein SAMD00019534_005350             83.2    3e-17   
ref|XP_007355914.1|  40S ribosomal protein S8                         83.2    3e-17   
ref|XP_003646518.1|  hypothetical protein Ecym_4680                   83.2    3e-17   
ref|XP_010714500.1|  PREDICTED: 40S ribosomal protein S8              84.0    3e-17   
dbj|GAD92768.1|  hypothetical protein AN0465.2                        83.2    3e-17   
gb|ESW98222.1|  40S ribosomal protein S8-A                            83.2    3e-17   
ref|XP_008432867.1|  PREDICTED: 40S ribosomal protein S8              83.2    3e-17   
ref|XP_002547240.1|  40S ribosomal protein S8                         82.8    4e-17   
gb|KIV97209.1|  40S ribosomal protein S8-B                            82.8    4e-17   
ref|XP_001269730.1|  40S ribosomal protein S8                         82.8    4e-17   
gb|AFM90620.1|  40S ribosomal protein S8                              82.8    4e-17   
gb|EPS27920.1|  hypothetical protein PDE_02864                        82.8    4e-17   
ref|XP_008905363.1|  40S ribosomal protein S8                         82.8    4e-17   
ref|XP_002561215.1|  Pc16g08960                                       82.8    4e-17   
ref|XP_003674379.1|  hypothetical protein NCAS_0A14420                82.8    4e-17   
gb|EMD32142.1|  hypothetical protein CERSUDRAFT_88417                 82.8    4e-17   
ref|XP_001909578.1|  hypothetical protein                             82.8    4e-17   
ref|XP_007783051.1|  40S ribosomal protein S8                         82.8    4e-17   
ref|XP_003676688.1|  hypothetical protein NCAS_0E02590                82.8    4e-17   
gb|ETP45024.1|  40S ribosomal protein S8                              82.8    4e-17   
gb|AFM89547.1|  40S ribosomal protein S8                              82.8    4e-17   
gb|AFM90641.1|  40S ribosomal protein S8                              82.8    4e-17   
gb|AFM86309.1|  40S ribosomal protein S8                              82.8    5e-17   
gb|EIE77931.1|  40S ribosomal protein S8                              82.8    5e-17   
gb|AFM90919.1|  40S ribosomal protein S8                              82.8    5e-17   
gb|AFM90684.1|  40S ribosomal protein S8                              82.8    5e-17   
ref|NP_001279579.1|  ribosomal protein S8                             82.8    5e-17   
ref|XP_003107910.1|  CRE-RPS-8 protein                                82.8    5e-17   
ref|XP_008715342.1|  40S ribosomal protein S8-B                       82.4    5e-17   
ref|XP_002142692.1|  40S ribosomal protein S8                         82.4    5e-17   
ref|XP_001212958.1|  40S ribosomal protein S8                         82.4    5e-17   
emb|CEG71688.1|  Putative 40S ribosomal protein S8                    82.4    5e-17   
ref|XP_007738712.1|  40S ribosomal protein S8-B                       82.4    5e-17   
ref|XP_002175151.1|  40S ribosomal protein S8                         82.4    6e-17   
ref|XP_002173241.1|  40S ribosomal protein S8                         82.4    6e-17   
ref|XP_009637143.1|  PREDICTED: 40S ribosomal protein S8              82.4    6e-17   
ref|XP_009863870.1|  PREDICTED: 40S ribosomal protein S8              82.4    6e-17   
gb|AFJ45053.1|  ribosomal protein S8                                  82.0    6e-17   
ref|XP_002495104.1|  40S ribosomal protein S8                         82.4    7e-17   
ref|XP_003667563.1|  ribosomal protein S8                             82.0    7e-17   
ref|XP_004832544.1|  40S ribosomal protein S8, putative               82.0    7e-17   
ref|XP_007380781.1|  ribosomal protein S8e                            82.4    7e-17   
gb|EFX81462.1|  hypothetical protein DAPPUDRAFT_303431                82.4    7e-17   
ref|XP_006634805.1|  PREDICTED: 40S ribosomal protein S8-like         82.4    7e-17   
ref|XP_007414926.1|  hypothetical protein MELLADRAFT_38944            82.0    8e-17   
gb|KGO67126.1|  Ribosomal protein S8e                                 82.0    8e-17   
ref|XP_010407761.1|  PREDICTED: 40S ribosomal protein S8              82.8    9e-17   
ref|XP_004367925.1|  ribosomal protein S8e, putative                  82.4    9e-17   
gb|EYE94457.1|  40S ribosomal protein S8e                             82.0    9e-17   
gb|EFX06643.1|  40S ribosomal protein s8e                             82.0    9e-17   
ref|XP_005717008.1|  40S ribosomal protein S8                         82.0    9e-17   
gb|AEL28852.1|  ribosomal protein S8                                  82.0    9e-17   
ref|XP_003448492.1|  PREDICTED: 40S ribosomal protein S8-like         82.0    9e-17   
gb|KIW58114.1|  40S ribosomal protein S8-B                            81.6    1e-16   
gb|KIV84123.1|  40S ribosomal protein S8-B                            81.6    1e-16   
gb|KDQ21918.1|  hypothetical protein BOTBODRAFT_150960                82.0    1e-16   
ref|XP_009153813.1|  40S ribosomal protein S8-B                       81.6    1e-16   
ref|XP_006881181.1|  PREDICTED: 40S ribosomal protein S8-like         81.6    1e-16   
ref|XP_007915865.1|  putative 40s ribosomal protein s8 protein        81.6    1e-16   
ref|XP_007766704.1|  40S ribosomal protein S8                         82.0    1e-16   
gb|AAX62461.1|  ribosomal protein S8                                  81.6    1e-16   
emb|CEP18703.1|  hypothetical protein                                 81.6    1e-16   
gb|EMC77472.1|  40S ribosomal protein S8                              80.5    1e-16   
gb|KIW09990.1|  40S ribosomal protein S8-B                            81.6    1e-16   
dbj|GAM38163.1|  40S ribosomal protein                                80.9    1e-16   
gb|KIW39992.1|  40S ribosomal protein S8-A                            81.6    1e-16   
emb|CDI54285.1|  probable RPS8A-ribosomal protein S8.e                81.6    1e-16   
gb|EPX70812.1|  40S ribosomal protein S8                              81.3    1e-16   
ref|XP_001805801.1|  hypothetical protein SNOG_15657                  81.3    1e-16   
emb|CBJ28525.1|  conserved unknown protein                            81.6    1e-16   
gb|KFA47399.1|  hypothetical protein S40293_05376                     81.3    1e-16   
gb|KEY66979.1|  hypothetical protein S7711_05099                      81.3    1e-16   
gb|KFA61130.1|  hypothetical protein S40285_02177                     81.3    1e-16   
ref|XP_003857049.1|  40S ribosomal protein S8                         81.3    1e-16   
ref|XP_003742816.1|  PREDICTED: 40S ribosomal protein S8-like         81.6    1e-16   
emb|CDO76014.1|  hypothetical protein BN946_scf184665.g6              81.6    1e-16   
dbj|BAD26659.1|  Ribosomal protein S8                                 81.3    1e-16   
ref|XP_010206685.1|  PREDICTED: 40S ribosomal protein S8              81.6    1e-16   
ref|XP_009547527.1|  hypothetical protein HETIRDRAFT_440490           81.3    1e-16   
emb|CDO95023.1|  unnamed protein product                              81.3    1e-16   
dbj|BAO42676.2|  40S ribosomal protein S8                             81.3    2e-16   
gb|ERS95890.1|  40S ribosomal protein S8                              81.3    2e-16   
gb|ABV60330.1|  40S ribosomal protein S8-like protein                 81.3    2e-16   
emb|CDM26487.1|  40S ribosomal protein S8-B                           81.3    2e-16   
ref|XP_003380490.1|  tRNA guanosine-2'-O-methyltransferase TRM11-...  84.3    2e-16   
pdb|4UER|2  Chain 2, 40s-eif1-eif1a-eif3-eif3j Translation Initia...  80.9    2e-16   
dbj|BAP74049.1|  40S ribosomal protein S8                             81.3    2e-16   
ref|XP_001745896.1|  hypothetical protein                             81.3    2e-16   
ref|XP_006675830.1|  hypothetical protein BATDEDRAFT_36328            81.3    2e-16   
ref|XP_009571612.1|  PREDICTED: 40S ribosomal protein S8              81.6    2e-16   
ref|XP_454876.1|  40S ribosomal protein S8                            81.3    2e-16   



>gb|AFW66128.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66141.1| putative ribosomal protein S8e family protein [Zea mays]
Length=153

 Score =   121 bits (304),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_010060252.1| PREDICTED: 40S ribosomal protein S8 [Eucalyptus grandis]
 gb|KCW66870.1| hypothetical protein EUGRSUZ_F00627 [Eucalyptus grandis]
Length=219

 Score =   122 bits (307),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|AFW66137.1| putative ribosomal protein S8e family protein [Zea mays]
Length=128

 Score =   120 bits (300),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KJB13805.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
 gb|KJB13807.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
Length=219

 Score =   122 bits (306),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_008799563.1| PREDICTED: 40S ribosomal protein S8-like [Phoenix dactylifera]
Length=146

 Score =   120 bits (300),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KDP39216.1| hypothetical protein JCGZ_00973 [Jatropha curcas]
Length=219

 Score =   122 bits (306),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KHM99496.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   122 bits (306),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_003532158.1| PREDICTED: 40S ribosomal protein S8-like [Glycine max]
Length=219

 Score =   122 bits (306),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_011008256.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
 ref|XP_011015899.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
Length=220

 Score =   122 bits (306),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KJB22170.1| hypothetical protein B456_004G033000 [Gossypium raimondii]
Length=216

 Score =   122 bits (305),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_007134162.1| hypothetical protein PHAVU_010G024600g [Phaseolus vulgaris]
 gb|ESW06156.1| hypothetical protein PHAVU_010G024600g [Phaseolus vulgaris]
Length=218

 Score =   122 bits (305),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KHG18510.1| 40S ribosomal S8 [Gossypium arboreum]
Length=216

 Score =   122 bits (305),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KJB84080.1| hypothetical protein B456_N005000 [Gossypium raimondii]
Length=219

 Score =   122 bits (305),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KHG04827.1| 40S ribosomal S8 [Gossypium arboreum]
Length=219

 Score =   122 bits (305),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KJB81680.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=155

 Score =   120 bits (301),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|ACU16800.1| unknown [Glycine max]
Length=243

 Score =   122 bits (307),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAW KKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWGKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_006452497.1| hypothetical protein CICLE_v10009415mg [Citrus clementina]
 ref|XP_006474961.1| PREDICTED: 40S ribosomal protein S8-like [Citrus sinensis]
 gb|ESR65737.1| hypothetical protein CICLE_v10009415mg [Citrus clementina]
Length=223

 Score =   122 bits (305),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_007049644.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOX93801.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
Length=219

 Score =   122 bits (305),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KJB81681.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=153

 Score =   120 bits (300),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KDP45274.1| hypothetical protein JCGZ_15139 [Jatropha curcas]
Length=221

 Score =   122 bits (305),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_011025495.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
Length=219

 Score =   122 bits (305),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KDO36309.1| hypothetical protein CISIN_1g045444mg, partial [Citrus sinensis]
 gb|KDO60870.1| hypothetical protein CISIN_1g044642mg, partial [Citrus sinensis]
Length=217

 Score =   121 bits (304),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|NP_001105391.1| 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679873.1| PREDICTED: 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679875.1| PREDICTED: 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679877.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Zea mays]
 sp|Q08069.2|RS8_MAIZE RecName: Full=40S ribosomal protein S8 [Zea mays]
 gb|AAB06330.1| ribosomal protein S8 [Zea mays]
 gb|ACF80433.1| unknown [Zea mays]
 gb|ACG24637.1| 40S ribosomal protein S8 [Zea mays]
 gb|AFW66125.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66129.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66130.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66138.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66142.1| putative ribosomal protein S8e family protein [Zea mays]
Length=221

 Score =   122 bits (305),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KHG08050.1| 40S ribosomal S8 [Gossypium arboreum]
Length=218

 Score =   121 bits (304),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|ABR13294.1| putative 40S ribosomal protein S8 [Prunus dulcis]
Length=140

 Score =   119 bits (299),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  28   MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  87

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  88   LDTGNFSWGSEAVTRKTRL  106



>ref|XP_007146564.1| hypothetical protein PHAVU_006G051300g [Phaseolus vulgaris]
 gb|ESW18558.1| hypothetical protein PHAVU_006G051300g [Phaseolus vulgaris]
Length=218

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|NP_001046866.1| Os02g0489400 [Oryza sativa Japonica Group]
 sp|P49199.2|RS8_ORYSJ RecName: Full=40S ribosomal protein S8 [Oryza sativa Japonica 
Group]
 pdb|3J60|I Chain I, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD21871.1| putative 40S ribosomal protein S8 [Oryza sativa Japonica Group]
 dbj|BAD21876.1| putative 40S ribosomal protein S8 [Oryza sativa Japonica Group]
 dbj|BAF08780.1| Os02g0489400 [Oryza sativa Japonica Group]
 dbj|BAG95703.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73196.1| hypothetical protein OsI_07259 [Oryza sativa Indica Group]
 gb|EEE57012.1| hypothetical protein OsJ_06781 [Oryza sativa Japonica Group]
Length=220

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_006437243.1| hypothetical protein CICLE_v10032694mg [Citrus clementina]
 gb|ESR50483.1| hypothetical protein CICLE_v10032694mg [Citrus clementina]
Length=223

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KJB81679.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=217

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_008792950.1| PREDICTED: 40S ribosomal protein S8 [Phoenix dactylifera]
Length=222

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KJB62959.1| hypothetical protein B456_009G445800 [Gossypium raimondii]
Length=218

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KHN25148.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>dbj|BAA07207.1| ribosomal protein S8 [Oryza sativa Japonica Group]
Length=220

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_010252680.1| PREDICTED: 40S ribosomal protein S8 [Nelumbo nucifera]
Length=220

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_006484807.1| PREDICTED: 40S ribosomal protein S8-like [Citrus sinensis]
Length=223

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_003547779.1| PREDICTED: 40S ribosomal protein S8 [Glycine max]
Length=219

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_010646836.1| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
Length=220

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATG KKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGSKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KCW58021.1| hypothetical protein EUGRSUZ_H00750 [Eucalyptus grandis]
Length=221

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_010069614.1| PREDICTED: 40S ribosomal protein S8-like [Eucalyptus grandis]
 gb|KCW58022.1| hypothetical protein EUGRSUZ_H00750 [Eucalyptus grandis]
Length=222

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_011069406.1| PREDICTED: 40S ribosomal protein S8 [Sesamum indicum]
Length=219

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_002452585.1| hypothetical protein SORBIDRAFT_04g028530 [Sorghum bicolor]
 gb|EES05561.1| hypothetical protein SORBIDRAFT_04g028530 [Sorghum bicolor]
Length=221

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_004953910.1| PREDICTED: 40S ribosomal protein S8-like [Setaria italica]
Length=221

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KJB81683.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=245

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_010905161.1| PREDICTED: 40S ribosomal protein S8-like [Elaeis guineensis]
Length=224

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_006833291.1| hypothetical protein AMTR_s00109p00031400 [Amborella trichopoda]
 gb|ERM98569.1| hypothetical protein AMTR_s00109p00031400 [Amborella trichopoda]
Length=218

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_004975334.1| PREDICTED: 40S ribosomal protein S8-like [Setaria italica]
Length=221

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_010913108.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Elaeis guineensis]
Length=224

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_004240435.1| PREDICTED: 40S ribosomal protein S8-2 [Solanum lycopersicum]
Length=220

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_010907235.1| PREDICTED: 40S ribosomal protein S8-like [Elaeis guineensis]
Length=223

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_002269042.2| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
 emb|CAN64937.1| hypothetical protein VITISV_011515 [Vitis vinifera]
Length=221

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_008809644.1| PREDICTED: 40S ribosomal protein S8 [Phoenix dactylifera]
Length=223

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_003520991.1| PREDICTED: 40S ribosomal protein S8-like [Glycine max]
 gb|KHN05782.1| 40S ribosomal protein S8 [Glycine soja]
Length=220

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRV  79



>ref|XP_002446216.1| hypothetical protein SORBIDRAFT_06g004770 [Sorghum bicolor]
 gb|EES10544.1| hypothetical protein SORBIDRAFT_06g004770 [Sorghum bicolor]
Length=220

 Score =   120 bits (302),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEA+TRKTRI
Sbjct  61   LDTGNYSWGSEALTRKTRI  79



>ref|NP_001132384.1| uncharacterized protein LOC100193830 [Zea mays]
 gb|ACF81204.1| unknown [Zea mays]
Length=221

 Score =   120 bits (302),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEA+TRKTRI
Sbjct  61   LDTGNYSWGSEALTRKTRI  79



>ref|XP_010913109.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Elaeis guineensis]
Length=222

 Score =   120 bits (302),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_011021175.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Populus euphratica]
Length=218

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_009405538.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=224

 Score =   120 bits (302),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_010270147.1| PREDICTED: 40S ribosomal protein S8-like [Nelumbo nucifera]
Length=221

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|EAY93669.1| hypothetical protein OsI_15456 [Oryza sativa Indica Group]
Length=221

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGN+KWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNLKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KHF98591.1| 40S ribosomal S8 [Gossypium arboreum]
Length=219

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSVHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_006373483.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
 gb|ERP51280.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
Length=220

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|NP_001052526.1| Os04g0349500 [Oryza sativa Japonica Group]
 emb|CAE05511.1| OSJNBa0038P21.4 [Oryza sativa Japonica Group]
 dbj|BAF14440.1| Os04g0349500 [Oryza sativa Japonica Group]
 gb|EAZ30323.1| hypothetical protein OsJ_14370 [Oryza sativa Japonica Group]
 dbj|BAG90858.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGN+KWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNLKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_011095494.1| PREDICTED: 40S ribosomal protein S8 [Sesamum indicum]
Length=219

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTRI
Sbjct  61   LDTGNFSWGSEAVTRKTRI  79



>ref|XP_002299926.1| 40S ribosomal protein S8 [Populus trichocarpa]
 gb|ABK92677.1| unknown [Populus trichocarpa]
 gb|EEE84731.1| 40S ribosomal protein S8 [Populus trichocarpa]
Length=220

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_008679876.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Zea mays]
Length=258

 Score =   121 bits (303),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_004510234.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=217

 Score =   120 bits (300),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>gb|ACJ86093.1| unknown [Medicago truncatula]
 gb|AFK33939.1| unknown [Medicago truncatula]
 gb|KEH22555.1| 40S ribosomal S8-like protein [Medicago truncatula]
Length=217

 Score =   120 bits (300),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|XP_009403610.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=220

 Score =   120 bits (300),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LD+GNYSWGSEAVTRKTRI
Sbjct  61   LDSGNYSWGSEAVTRKTRI  79



>ref|XP_008679872.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=301

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  81   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  140

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  141  LDTGNYSWGSEAVTRKTRI  159



>ref|XP_011021176.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Populus euphratica]
Length=217

 Score =   120 bits (300),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|EYU33688.1| hypothetical protein MIMGU_mgv1a013525mg [Erythranthe guttata]
Length=218

 Score =   120 bits (300),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTRI
Sbjct  61   LDTGNFSWGSEAVTRKTRI  79



>ref|XP_006373482.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
 gb|ERP51279.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
Length=219

 Score =   120 bits (300),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_004247043.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=222

 Score =   120 bits (300),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLS+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSNNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_008657369.1| PREDICTED: uncharacterized protein LOC100193830 isoform X1 [Zea 
mays]
Length=223

 Score =   120 bits (300),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEA+TRKTRI
Sbjct  61   LDTGNYSWGSEALTRKTRI  79



>ref|XP_003551567.1| PREDICTED: 40S ribosomal protein S8 [Glycine max]
 gb|KHN28407.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   120 bits (300),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEA TRKTRI
Sbjct  61   LDTGNYSWGSEAATRKTRI  79



>ref|XP_004290159.1| PREDICTED: 40S ribosomal protein S8-like [Fragaria vesca subsp. 
vesca]
Length=224

 Score =   120 bits (300),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTRI
Sbjct  61   LDTGNFSWGSEAVTRKTRI  79



>gb|AFK47179.1| unknown [Medicago truncatula]
 gb|KEH18114.1| 40S ribosomal S8-like protein [Medicago truncatula]
Length=215

 Score =   119 bits (299),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|NP_001274851.1| uncharacterized protein LOC102577693 [Solanum tuberosum]
 gb|ABA46755.1| unknown [Solanum tuberosum]
Length=224

 Score =   120 bits (300),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLS+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSNNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|EYU33690.1| hypothetical protein MIMGU_mgv1a013952mg [Erythranthe guttata]
Length=205

 Score =   119 bits (298),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTRI
Sbjct  61   LDTGNFSWGSEAVTRKTRI  79



>ref|XP_010235437.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Brachypodium 
distachyon]
Length=226

 Score =   120 bits (300),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRL  79



>ref|XP_007020644.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 ref|XP_007020645.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOY12169.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOY12170.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
Length=220

 Score =   119 bits (299),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_002313320.1| 40S ribosomal protein S8 [Populus trichocarpa]
 gb|ABK92635.1| unknown [Populus trichocarpa]
 gb|EEE87275.1| 40S ribosomal protein S8 [Populus trichocarpa]
Length=219

 Score =   119 bits (299),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|ABL85034.1| ribosomal subunit 8E protein [Brachypodium sylvaticum]
Length=223

 Score =   119 bits (299),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRL  79



>ref|XP_003574981.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Brachypodium 
distachyon]
Length=229

 Score =   120 bits (300),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRL  79



>ref|XP_008778380.1| PREDICTED: 40S ribosomal protein S8-like [Phoenix dactylifera]
Length=222

 Score =   119 bits (299),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEA+TRKTRI
Sbjct  61   LDTGNYSWGSEALTRKTRI  79



>ref|XP_003557224.1| PREDICTED: 40S ribosomal protein S8 [Brachypodium distachyon]
Length=226

 Score =   120 bits (300),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRL  79



>ref|XP_009378162.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=221

 Score =   119 bits (299),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|XP_008227073.1| PREDICTED: 40S ribosomal protein S8-like [Prunus mume]
Length=225

 Score =   119 bits (299),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|XP_008366424.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
 ref|XP_009364625.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009364657.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009335423.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=222

 Score =   119 bits (299),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>gb|EYU27406.1| hypothetical protein MIMGU_mgv1a013520mg [Erythranthe guttata]
Length=218

 Score =   119 bits (299),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKMKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTRI
Sbjct  61   LDTGNFSWGSEAVTRKTRI  79



>ref|XP_009373606.1| PREDICTED: 40S ribosomal protein S8 [Pyrus x bretschneideri]
Length=221

 Score =   119 bits (299),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|XP_004492266.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=218

 Score =   119 bits (299),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|XP_009413565.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=222

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LD+GNYSWGSEAVTRKTR+
Sbjct  61   LDSGNYSWGSEAVTRKTRV  79



>ref|XP_007211997.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 ref|XP_007211998.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 gb|EMJ13196.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 gb|EMJ13197.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
Length=225

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|XP_011461093.1| PREDICTED: 40S ribosomal protein S8 [Fragaria vesca subsp. vesca]
 ref|XP_011461096.1| PREDICTED: 40S ribosomal protein S8 [Fragaria vesca subsp. vesca]
Length=225

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|NP_200732.2| 40S ribosomal protein S8-2 [Arabidopsis thaliana]
 sp|Q9FIF3.1|RS82_ARATH RecName: Full=40S ribosomal protein S8-2 [Arabidopsis thaliana]
 dbj|BAB09769.1| 40S ribosomal protein S8 [Arabidopsis thaliana]
 gb|AAO42849.1| At5g59240 [Arabidopsis thaliana]
 dbj|BAE99897.1| 40S ribosomal protein S8 - like [Arabidopsis thaliana]
 gb|AED97161.1| 40S ribosomal protein S8-2 [Arabidopsis thaliana]
Length=210

 Score =   119 bits (298),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTRI
Sbjct  61   LDTGNFSWGSEAVTRKTRI  79



>ref|XP_009371092.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=220

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>sp|O81361.1|RS8_PRUAR RecName: Full=40S ribosomal protein S8 [Prunus armeniaca]
 gb|AAC24583.1| 40S ribosomal protein S8 [Prunus armeniaca]
Length=221

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>gb|ACU16398.1| unknown [Glycine max]
Length=256

 Score =   120 bits (301),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEA TRKTRI
Sbjct  61   LDTGNYSWGSEAATRKTRI  79



>ref|XP_002529032.1| 40S ribosomal protein S8, putative [Ricinus communis]
 gb|EEF33343.1| 40S ribosomal protein S8, putative [Ricinus communis]
Length=219

 Score =   119 bits (298),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_009349000.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=221

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|XP_009361080.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009348460.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=222

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|XP_008337490.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
Length=221

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|XP_009416597.1| PREDICTED: 40S ribosomal protein S8 [Musa acuminata subsp. malaccensis]
Length=223

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LD GNYSWGSEAVTRKTRI
Sbjct  61   LDHGNYSWGSEAVTRKTRI  79



>gb|ACU19111.1| unknown [Glycine max]
Length=220

 Score =   119 bits (298),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRV  79



>ref|XP_008222788.1| PREDICTED: 40S ribosomal protein S8 [Prunus mume]
Length=221

 Score =   119 bits (298),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|XP_010454644.1| PREDICTED: 40S ribosomal protein S8-2 [Camelina sativa]
Length=218

 Score =   119 bits (298),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRV  79



>ref|XP_002275094.1| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
Length=219

 Score =   119 bits (298),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>emb|CAA03954.1| ribosomal protein S8 [Hordeum vulgare subsp. vulgare]
Length=126

 Score =   116 bits (291),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEA TRKTR+
Sbjct  61   LDTGNFSWGSEATTRKTRL  79



>ref|XP_010483522.1| PREDICTED: 40S ribosomal protein S8-2-like [Camelina sativa]
Length=220

 Score =   119 bits (298),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRV  79



>ref|XP_010675861.1| PREDICTED: 40S ribosomal protein S8 [Beta vulgaris subsp. vulgaris]
Length=217

 Score =   119 bits (298),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|XP_002864608.1| 40S ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40867.1| 40S ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
Length=210

 Score =   119 bits (297),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTRI
Sbjct  61   LDTGNFSWGSEAVTRKTRI  79



>ref|XP_007223947.1| hypothetical protein PRUPE_ppa011148mg [Prunus persica]
 gb|EMJ25146.1| hypothetical protein PRUPE_ppa011148mg [Prunus persica]
Length=222

 Score =   119 bits (298),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|XP_010693327.1| PREDICTED: 40S ribosomal protein S8-like [Beta vulgaris subsp. 
vulgaris]
Length=217

 Score =   119 bits (298),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>ref|XP_009610547.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana tomentosiformis]
Length=224

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISANKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_004242427.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=220

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEA TRKTRI
Sbjct  61   LDTGNYSWGSEATTRKTRI  79



>gb|KHG09566.1| 40S ribosomal protein S8 [Gossypium arboreum]
Length=163

 Score =   117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRR+TGGK+KAWRKKRK+ELGRQP NTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRSTGGKQKAWRKKRKHELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSE+VTRKTRI
Sbjct  61   LDTGNYSWGSESVTRKTRI  79



>gb|EMT18438.1| 40S ribosomal protein S8 [Aegilops tauschii]
Length=225

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRL  79



>gb|KJB22659.1| hypothetical protein B456_004G059300 [Gossypium raimondii]
Length=219

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRR+TGGK+KAWRKKRKYELGRQP NTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRSTGGKQKAWRKKRKYELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSE+VTRKTRI
Sbjct  61   LDTGNYSWGSESVTRKTRI  79



>ref|XP_009783183.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana sylvestris]
Length=224

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISTNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>emb|CDY60374.1| BnaCnng36150D, partial [Brassica napus]
Length=228

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  3    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  62

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  63   LDTGNYSWGSEAVTRKTRV  81



>ref|XP_010243157.1| PREDICTED: 40S ribosomal protein S8-like isoform X2 [Nelumbo 
nucifera]
Length=217

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSE VTRKTRI
Sbjct  61   LDTGNYSWGSEHVTRKTRI  79



>ref|XP_010243156.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Nelumbo 
nucifera]
Length=219

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSE VTRKTRI
Sbjct  61   LDTGNYSWGSEHVTRKTRI  79



>ref|XP_006409551.1| hypothetical protein EUTSA_v10022838mg [Eutrema salsugineum]
 gb|ESQ51004.1| hypothetical protein EUTSA_v10022838mg [Eutrema salsugineum]
Length=225

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRV  79



>ref|XP_010278451.1| PREDICTED: 40S ribosomal protein S8-like [Nelumbo nucifera]
Length=219

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSE VTRKTRI
Sbjct  61   LDTGNYSWGSEHVTRKTRI  79



>gb|AFK37035.1| unknown [Lotus japonicus]
Length=218

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSE VTRKTRI
Sbjct  61   LDTGNFSWGSETVTRKTRI  79



>gb|KJB84081.1| hypothetical protein B456_N005000 [Gossypium raimondii]
Length=259

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  64   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  243
            GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL
Sbjct  42   GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  101

Query  244  DTGNYSWGSEAVTRKTRI  297
            DTGNYSWGSEAVTRKTRI
Sbjct  102  DTGNYSWGSEAVTRKTRI  119



>ref|XP_006400597.1| hypothetical protein EUTSA_v10014589mg [Eutrema salsugineum]
 gb|ESQ42050.1| hypothetical protein EUTSA_v10014589mg [Eutrema salsugineum]
Length=226

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRV  79



>ref|XP_002873989.1| ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50248.1| ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
Length=220

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRV  79



>ref|XP_009131790.1| PREDICTED: 40S ribosomal protein S8-1 [Brassica rapa]
Length=226

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRV  79



>gb|AFK33351.1| unknown [Lotus japonicus]
Length=218

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWR+KRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRRKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSE VTRKTRI
Sbjct  61   LDTGNFSWGSETVTRKTRI  79



>ref|XP_009771719.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana sylvestris]
Length=224

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEA TRKTRI
Sbjct  61   LDTGNYSWGSEATTRKTRI  79



>ref|XP_006352667.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=221

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEA TRKTRI
Sbjct  61   LDTGNYSWGSEATTRKTRI  79



>ref|NP_001240243.1| uncharacterized protein LOC100813170 [Glycine max]
 gb|ACU18370.1| unknown [Glycine max]
 gb|KHN10948.1| 40S ribosomal protein S8 [Glycine soja]
Length=217

 Score =   118 bits (295),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_006601753.1| PREDICTED: uncharacterized protein LOC100500112 isoform X1 [Glycine 
max]
 gb|KHN21285.1| 40S ribosomal protein S8 [Glycine soja]
Length=217

 Score =   118 bits (295),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_009120819.1| PREDICTED: 40S ribosomal protein S8-1 [Brassica rapa]
Length=227

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRV  79



>ref|XP_002534344.1| 40S ribosomal protein S8, putative [Ricinus communis]
 gb|EEF28038.1| 40S ribosomal protein S8, putative [Ricinus communis]
Length=221

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_006286561.1| hypothetical protein CARUB_v10001914mg [Capsella rubella]
 gb|EOA19459.1| hypothetical protein CARUB_v10001914mg [Capsella rubella]
Length=221

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNY+WGSEAVTRKTR+
Sbjct  61   LDTGNYAWGSEAVTRKTRV  79



>ref|XP_009126438.1| PREDICTED: 40S ribosomal protein S8-1-like [Brassica rapa]
Length=226

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRV  79



>gb|AFK40150.1| unknown [Lotus japonicus]
Length=217

 Score =   118 bits (295),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSE VTRKTR+
Sbjct  61   LDTGNFSWGSETVTRKTRL  79



>ref|XP_010493138.1| PREDICTED: 40S ribosomal protein S8-1 [Camelina sativa]
Length=223

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNY+WGSEAVTRKTR+
Sbjct  61   LDTGNYAWGSEAVTRKTRV  79



>ref|XP_009778867.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=223

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEA TRKTRI
Sbjct  61   LDTGNYSWGSEATTRKTRI  79



>ref|XP_007149668.1| hypothetical protein PHAVU_005G089100g [Phaseolus vulgaris]
 gb|ESW21662.1| hypothetical protein PHAVU_005G089100g [Phaseolus vulgaris]
Length=217

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQSANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_006856815.1| hypothetical protein AMTR_s00055p00155570 [Amborella trichopoda]
 gb|ERN18282.1| hypothetical protein AMTR_s00055p00155570 [Amborella trichopoda]
Length=218

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN SWGSEAVTRKTRI
Sbjct  61   LDTGNCSWGSEAVTRKTRI  79



>emb|CDX92472.1| BnaA10g15110D [Brassica napus]
Length=246

 Score =   118 bits (296),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  20   MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  79

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  80   LDTGNYSWGSEAVTRKTRV  98



>ref|XP_008451649.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis melo]
Length=219

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_010420870.1| PREDICTED: 40S ribosomal protein S8-1-like [Camelina sativa]
Length=223

 Score =   117 bits (294),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNY+WGSEAVTRKTR+
Sbjct  61   LDTGNYAWGSEAVTRKTRV  79



>ref|XP_009596732.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana tomentosiformis]
Length=223

 Score =   117 bits (294),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEA TRKTRI
Sbjct  61   LDTGNYSWGSEATTRKTRI  79



>emb|CDY35814.1| BnaC09g37460D [Brassica napus]
Length=258

 Score =   118 bits (296),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  33   MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  92

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  93   LDTGNYSWGSEAVTRKTRV  111



>ref|XP_008364326.1| PREDICTED: 40S ribosomal protein S8-like [Malus domestica]
 ref|XP_008345024.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
 ref|XP_008355313.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
Length=222

 Score =   117 bits (294),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSE VTRKTR+
Sbjct  61   LDTGNFSWGSETVTRKTRL  79



>emb|CDY45095.1| BnaA02g04810D [Brassica napus]
Length=244

 Score =   118 bits (295),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  19   MGISRDSIHKRRATGGKQKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  78

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  79   LDTGNYSWGSEAVTRKTRV  97



>ref|XP_009406344.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=221

 Score =   117 bits (293),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LD GNYSWGSEAVTRKTRI
Sbjct  61   LDHGNYSWGSEAVTRKTRI  79



>dbj|BAJ89904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   117 bits (293),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEA TRKTR+
Sbjct  61   LDTGNFSWGSEATTRKTRL  79



>ref|XP_008466734.1| PREDICTED: 40S ribosomal protein S8-2 [Cucumis melo]
Length=220

 Score =   117 bits (293),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_006281069.1| hypothetical protein CARUB_v10027092mg [Capsella rubella]
 gb|EOA13967.1| hypothetical protein CARUB_v10027092mg [Capsella rubella]
Length=220

 Score =   117 bits (293),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKKWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSE VTRKTRI
Sbjct  61   LDTGNFSWGSETVTRKTRI  79



>ref|XP_006344091.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=223

 Score =   117 bits (293),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQ ANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQSANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|KFK31870.1| hypothetical protein AALP_AA6G169300 [Arabis alpina]
Length=219

 Score =   117 bits (292),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLS NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSGNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRV  79



>ref|XP_004148331.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 ref|XP_004162922.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 gb|KGN61144.1| hypothetical protein Csa_2G059750 [Cucumis sativus]
Length=219

 Score =   117 bits (292),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRL  79



>gb|KFK26269.1| hypothetical protein AALP_AA8G225000 [Arabis alpina]
Length=223

 Score =   117 bits (292),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLS NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSGNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRV  79



>gb|AGV54796.1| 40S ribosomal protein S8 [Phaseolus vulgaris]
Length=218

 Score =   117 bits (292),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELG  PANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGPPPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_009602561.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana tomentosiformis]
Length=224

 Score =   117 bits (292),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEA TRKTRI
Sbjct  61   LDTGNYSWGSEATTRKTRI  79



>ref|NP_001236970.1| uncharacterized protein LOC100500112 [Glycine max]
 gb|ACU14990.1| unknown [Glycine max]
Length=217

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/78 (97%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTR  294
            LDTGNYSWGSEAVTRKTR
Sbjct  61   LDTGNYSWGSEAVTRKTR  78



>emb|CDX88842.1| BnaA03g08070D [Brassica napus]
Length=239

 Score =   117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            +GISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  13   LGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  72

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  73   LDTGNYSWGSEAVTRKTRV  91



>ref|NP_197529.1| 40S ribosomal protein S8-1 [Arabidopsis thaliana]
 sp|Q93VG5.1|RS81_ARATH RecName: Full=40S ribosomal protein S8-1 [Arabidopsis thaliana]
 gb|AAK93614.1| unknown protein [Arabidopsis thaliana]
 gb|AAK96530.1| AT5g20290/F5O24_180 [Arabidopsis thaliana]
 gb|AAL31236.1| AT5g20290/F5O24_180 [Arabidopsis thaliana]
 gb|AAM14111.1| unknown protein [Arabidopsis thaliana]
 gb|AAM64526.1| 40S ribosomal protein S8-like [Arabidopsis thaliana]
 dbj|BAE98439.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92825.1| 40S ribosomal protein S8-1 [Arabidopsis thaliana]
Length=222

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEA TRKTR+
Sbjct  61   LDTGNYSWGSEATTRKTRV  79



>emb|CDP15136.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSS+KTVRRIRVRGGNVKWRALR
Sbjct  55   MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSDKTVRRIRVRGGNVKWRALR  114

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  115  LDTGNYSWGSEAVTRKTRI  133



>ref|XP_003626942.1| Ribosomal protein S8 [Medicago truncatula]
Length=605

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  391  MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  450

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  451  LDTGNFSWGSEAVTRKTRL  469


 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVR IRVRGGN+K RALRLDTGN SWGSEAVTRK+R+
Sbjct  128  YELGRQPANTKLSSNKTVRSIRVRGGNLKCRALRLDTGNISWGSEAVTRKSRL  180



>ref|XP_004160707.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
Length=221

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAV+RKTRI
Sbjct  61   LDTGNYSWGSEAVSRKTRI  79



>ref|XP_004149800.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 gb|KGN47709.1| hypothetical protein Csa_6G382970 [Cucumis sativus]
Length=222

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAV+RKTRI
Sbjct  61   LDTGNYSWGSEAVSRKTRI  79



>gb|ABK21933.1| unknown [Picea sitchensis]
Length=221

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|ABK22298.1| unknown [Picea sitchensis]
Length=222

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|ABK21921.1| unknown [Picea sitchensis]
Length=221

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>gb|EMS65111.1| 40S ribosomal protein S8 [Triticum urartu]
Length=274

 Score =   115 bits (289),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/78 (95%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +1

Query  64   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  243
            GISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRL
Sbjct  51   GISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRL  110

Query  244  DTGNYSWGSEAVTRKTRI  297
            DTGN+SWGSEAVTRKTR+
Sbjct  111  DTGNFSWGSEAVTRKTRL  128



>gb|ABR16896.1| unknown [Picea sitchensis]
Length=221

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSE VTRKTRI
Sbjct  61   LDTGNYSWGSEPVTRKTRI  79



>ref|XP_010535902.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=220

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYELGR  ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_010541736.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=222

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYELGR  ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_009619873.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana tomentosiformis]
Length=220

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 77/80 (96%), Gaps = 1/80 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  237
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  238  RLDTGNYSWGSEAVTRKTRI  297
            RLDTGNYSWGSEA+TRKTR+
Sbjct  61   RLDTGNYSWGSEAITRKTRL  80



>ref|XP_009770276.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=220

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 77/80 (96%), Gaps = 1/80 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  237
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  238  RLDTGNYSWGSEAVTRKTRI  297
            RLDTGNYSWGSEA+TRKTR+
Sbjct  61   RLDTGNYSWGSEAITRKTRL  80



>gb|ACJ83894.1| unknown [Medicago truncatula]
Length=216

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 74/79 (94%), Gaps = 1/79 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKRRATGGKK   +K++ YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKSWRKKRK-YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  59

Query  241  LDTGNYSWGSEAVTRKTRI  297
            L TGN+SWGSEAVTRKTR+
Sbjct  60   LGTGNFSWGSEAVTRKTRL  78



>ref|XP_010519957.1| PREDICTED: 40S ribosomal protein S8-1 [Tarenaya hassleriana]
Length=222

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYE+GR  ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTRI
Sbjct  61   LDTGNYSWGSEAVTRKTRI  79



>ref|XP_009765854.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=221

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 1/80 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  237
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL +N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVTNAKTVRRIRVRGGNVKWRAL  60

Query  238  RLDTGNYSWGSEAVTRKTRI  297
            RLDTGN+SWGSEAVTRKTR+
Sbjct  61   RLDTGNFSWGSEAVTRKTRL  80



>gb|EYU39185.1| hypothetical protein MIMGU_mgv1a013531mg [Erythranthe guttata]
Length=194

 Score =   111 bits (278),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 77/80 (96%), Gaps = 1/80 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSS-NKTVRRIRVRGGNVKWRAL  237
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKL + NKTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLDTVNKTVRRIRVRGGNVKWRAL  60

Query  238  RLDTGNYSWGSEAVTRKTRI  297
            RL+TGNYSWGSEA+TRKTR+
Sbjct  61   RLNTGNYSWGSEAITRKTRV  80



>ref|XP_009594581.1| PREDICTED: 40S ribosomal protein S8-2-like [Nicotiana tomentosiformis]
Length=221

 Score =   112 bits (279),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 1/80 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  237
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL +N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVTNAKTVRRIRVRGGNVKWRAL  60

Query  238  RLDTGNYSWGSEAVTRKTRI  297
            RLDTGN+SWGSEAVTRKTR+
Sbjct  61   RLDTGNFSWGSEAVTRKTRL  80



>gb|EYU39184.1| hypothetical protein MIMGU_mgv1a013531mg [Erythranthe guttata]
Length=218

 Score =   112 bits (279),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 77/80 (96%), Gaps = 1/80 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSS-NKTVRRIRVRGGNVKWRAL  237
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKL + NKTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLDTVNKTVRRIRVRGGNVKWRAL  60

Query  238  RLDTGNYSWGSEAVTRKTRI  297
            RL+TGNYSWGSEA+TRKTR+
Sbjct  61   RLNTGNYSWGSEAITRKTRV  80



>ref|XP_006346168.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=220

 Score =   111 bits (277),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 77/80 (96%), Gaps = 1/80 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  237
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  238  RLDTGNYSWGSEAVTRKTRI  297
            RLDTGN+SWGSEAVTRKTR+
Sbjct  61   RLDTGNFSWGSEAVTRKTRL  80



>ref|XP_004244061.1| PREDICTED: 40S ribosomal protein S8-like [Solanum lycopersicum]
Length=221

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 76/80 (95%), Gaps = 1/80 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  237
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  238  RLDTGNYSWGSEAVTRKTRI  297
            RLDTGN+SWGSEAVTRKTR+
Sbjct  61   RLDTGNFSWGSEAVTRKTRL  80



>ref|XP_007049645.1| 40S ribosomal protein S8 isoform 3 [Theobroma cacao]
 gb|EOX93802.1| 40S ribosomal protein S8 isoform 3 [Theobroma cacao]
Length=195

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI
Sbjct  9    YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  61



>gb|KJB81682.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=196

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI
Sbjct  6    YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  58



>gb|AFW61714.1| putative ribosomal protein S8e family protein [Zea mays]
Length=154

 Score =   108 bits (270),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDSMHKR+AT GK+KAWRKKRKYELGRQPANTKLSSNKTVRR+ VRGG VKWRAL+
Sbjct  1    MGISRDSMHKRQATSGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVYVRGGYVKWRALQ  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDT NYSWGSEA+TRKT I
Sbjct  61   LDTCNYSWGSEALTRKTGI  79



>gb|KJB62960.1| hypothetical protein B456_009G445800 [Gossypium raimondii]
Length=211

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  72



>ref|XP_011089042.1| PREDICTED: 40S ribosomal protein S8-like [Sesamum indicum]
Length=220

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 77/80 (96%), Gaps = 1/80 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSS-NKTVRRIRVRGGNVKWRAL  237
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKL +  KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLDTLQKTVRRIRVRGGNVKWRAL  60

Query  238  RLDTGNYSWGSEAVTRKTRI  297
            RL+TGNYSWGSEA+TRKTRI
Sbjct  61   RLNTGNYSWGSEAITRKTRI  80



>gb|KJB13806.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
Length=212

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/53 (100%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  72



>gb|ACI15738.1| putative 40S ribosomal protein S8-like protein [Picrorhiza kurrooa]
Length=216

 Score =   109 bits (272),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            M  S  SMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MSTSLLSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTRI
Sbjct  61   LDTGNFSWGSEAVTRKTRI  79



>ref|XP_006652189.1| PREDICTED: 40S ribosomal protein S8-like [Oryza brachyantha]
Length=214

 Score =   109 bits (272),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  72



>gb|ACN31997.1| unknown [Zea mays]
 gb|AFW66127.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66131.1| putative ribosomal protein S8e family protein isoform 1 [Zea 
mays]
 gb|AFW66132.1| putative ribosomal protein S8e family protein isoform 2 [Zea 
mays]
 gb|AFW66139.1| putative ribosomal protein S8e family protein isoform 1 [Zea 
mays]
 gb|AFW66140.1| putative ribosomal protein S8e family protein isoform 2 [Zea 
mays]
Length=214

 Score =   109 bits (272),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  72



>emb|CBI39377.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   108 bits (271),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  72



>emb|CDP03936.1| unnamed protein product [Coffea canephora]
Length=213

 Score =   108 bits (271),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  72



>ref|XP_006648644.1| PREDICTED: 40S ribosomal protein S8-like [Oryza brachyantha]
Length=213

 Score =   108 bits (270),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRV  72



>ref|XP_006369983.1| hypothetical protein POPTR_0001s37140g [Populus trichocarpa]
 gb|ERP66552.1| hypothetical protein POPTR_0001s37140g [Populus trichocarpa]
Length=199

 Score =   108 bits (269),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPA+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI
Sbjct  8    YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  60



>gb|KHG14255.1| 40S ribosomal S8 [Gossypium arboreum]
Length=210

 Score =   108 bits (270),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEA+TRKTRI
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEALTRKTRI  72



>ref|XP_010520566.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=224

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYELGR  ANTKLSSNKTVRR+RVRGGN+KWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRLRVRGGNIKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEA TRK+RI
Sbjct  61   LDTGNFSWGSEAATRKSRI  79



>ref|XP_010327196.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=221

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 76/80 (95%), Gaps = 1/80 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  237
            MGISRDSMHKRRATGGKKKAWRKKRKYE+GRQ ANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  238  RLDTGNYSWGSEAVTRKTRI  297
            RLDTGNYSWGSEAVTRKTR+
Sbjct  61   RLDTGNYSWGSEAVTRKTRL  80



>ref|NP_001275100.1| putative 40S ribosomal protein S8-like protein [Solanum tuberosum]
 gb|ABB72814.1| putative 40S ribosomal protein S8-like protein [Solanum tuberosum]
Length=221

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 76/80 (95%), Gaps = 1/80 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  237
            MGISRDSMHKRRATGGKKK+WRKKRKYE+GRQ ANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  238  RLDTGNYSWGSEAVTRKTRI  297
            RLDTGNYSWGSEAVTRKTR+
Sbjct  61   RLDTGNYSWGSEAVTRKTRL  80



>ref|XP_006352532.1| PREDICTED: 40S ribosomal protein S8 [Solanum tuberosum]
Length=221

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 76/80 (95%), Gaps = 1/80 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTVRRIRVRGGNVKWRAL  237
            MGISRDSMHKRRATGGKKKAWRKKRKYE+GRQ ANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  238  RLDTGNYSWGSEAVTRKTRI  297
            RLDTGNYSWGSEAVTRKTR+
Sbjct  61   RLDTGNYSWGSEAVTRKTRL  80



>gb|EPS68663.1| hypothetical protein M569_06106, partial [Genlisea aurea]
Length=217

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 77/79 (97%), Gaps = 1/79 (1%)
 Frame = +1

Query  64   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKL-SSNKTVRRIRVRGGNVKWRALR  240
            GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL ++ KTVRR+RVRGGNVKWRALR
Sbjct  1    GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLDTTQKTVRRVRVRGGNVKWRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            L+TGNYSWGSEAVTRKTRI
Sbjct  61   LNTGNYSWGSEAVTRKTRI  79



>emb|CBI26725.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI
Sbjct  20   YELGRQPASTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  72



>ref|XP_008647178.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=177

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRR+ VRGGNVKWRALRLDTGNYSWGSEA+TRKTRI
Sbjct  15   YELGRQPANTKLSSNKTVRRVCVRGGNVKWRALRLDTGNYSWGSEALTRKTRI  67



>ref|XP_001761026.1| predicted protein [Physcomitrella patens]
 gb|EDQ74093.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRKTR+
Sbjct  61   LDTGNYSWGSEAVTRKTRV  79



>gb|KJB22660.1| hypothetical protein B456_004G059300 [Gossypium raimondii]
Length=212

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQP NTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSE+VTRKTRI
Sbjct  20   YELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSESVTRKTRI  72



>ref|XP_010926672.1| PREDICTED: 40S ribosomal protein S8-like isoform X2 [Elaeis guineensis]
Length=207

 Score =   106 bits (265),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGR+PANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+
Sbjct  10   YELGRRPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRV  62



>ref|XP_010926670.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Elaeis guineensis]
 ref|XP_010926671.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Elaeis guineensis]
Length=212

 Score =   106 bits (264),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGR+PANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+
Sbjct  15   YELGRRPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRV  67



>gb|EPS68749.1| hypothetical protein M569_06019 [Genlisea aurea]
Length=411

 Score =   108 bits (271),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 77/79 (97%), Gaps = 1/79 (1%)
 Frame = +1

Query  64   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKL-SSNKTVRRIRVRGGNVKWRALR  240
            GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL ++ KTVRRIRVRGGNVKWRALR
Sbjct  194  GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLDTTTKTVRRIRVRGGNVKWRALR  253

Query  241  LDTGNYSWGSEAVTRKTRI  297
            L+TGNYSWGSEAVTRKTRI
Sbjct  254  LNTGNYSWGSEAVTRKTRI  272



>gb|KHG07290.1| 40S ribosomal S8 [Gossypium arboreum]
 gb|KHG09567.1| 40S ribosomal protein S8 [Gossypium arboreum]
Length=156

 Score =   104 bits (260),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            +ELGRQP NTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSE+VTRKTRI
Sbjct  20   HELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSESVTRKTRI  72



>ref|XP_001777813.1| predicted protein [Physcomitrella patens]
 gb|EDQ57351.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   106 bits (264),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNFKFRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRV  79



>ref|XP_001773385.1| predicted protein [Physcomitrella patens]
 gb|EDQ61758.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   106 bits (264),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTRI
Sbjct  61   LDTGNFSWGSEAVTRKTRI  79



>ref|XP_010097296.1| 40S ribosomal protein S8 [Morus notabilis]
 gb|EXB67448.1| 40S ribosomal protein S8 [Morus notabilis]
Length=215

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQ ANTKLSS+KTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI
Sbjct  20   YELGRQSANTKLSSDKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  72



>emb|CEG02139.1| Ribosomal protein S8e/ribosomal biogenesis NSA2 [Ostreococcus 
tauri]
Length=217

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSN TVR++R RGGNVK RALR
Sbjct  1    MGISRDSLHKRRATGGKQKPWRKKRKYELGRQPANTKLSSNVTVRQVRCRGGNVKHRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSE  TRKTRI
Sbjct  61   LDTGNYSWGSENCTRKTRI  79



>ref|XP_001777587.1| predicted protein [Physcomitrella patens]
 gb|EDQ57630.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRV  79



>ref|XP_001780988.1| predicted protein [Physcomitrella patens]
 gb|EDQ54172.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEAVTRKTR+
Sbjct  61   LDTGNFSWGSEAVTRKTRV  79



>gb|AFW61715.1| putative ribosomal protein S8e family protein [Zea mays]
Length=241

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +1

Query  64   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  243
            GISRDSMHKR+AT GK+KAWRKKRKYELGRQPANTKLSSNKTVRR+ VRGG VKWRAL+L
Sbjct  37   GISRDSMHKRQATSGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVYVRGGYVKWRALQL  96

Query  244  DTGNYSWGSEAVTRKTRI  297
            DT NYSWGSEA+TRKT I
Sbjct  97   DTCNYSWGSEALTRKTGI  114



>gb|AFW62789.1| putative ribosomal protein S8e family protein [Zea mays]
Length=238

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRR+RVRGGN KWRALRLDTGNYSWGSEA+TRKTRI
Sbjct  139  YELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRLDTGNYSWGSEALTRKTRI  191



>ref|XP_008676181.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Zea 
mays]
Length=264

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRR+ VRGGN KWRALRLDTGNYSWGSEA+TRKTRI
Sbjct  46   YELGRQPANTKLSSNKTVRRVCVRGGNTKWRALRLDTGNYSWGSEALTRKTRI  98



>gb|AFW73090.1| putative ribosomal protein S8e family protein [Zea mays]
Length=423

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRR+ VRGGNVKWRALRLDTGNYSWGSEA+TRKTRI
Sbjct  193  YELGRQPANTKLSSNKTVRRVCVRGGNVKWRALRLDTGNYSWGSEALTRKTRI  245



>ref|XP_008660669.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=152

 Score =   102 bits (253),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRR+RVRGGN KWRALR DT NYSWGSEA+TRKTRI
Sbjct  31   YELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRFDTCNYSWGSEALTRKTRI  83



>gb|AFW85401.1| putative ribosomal protein S8e family protein [Zea mays]
Length=191

 Score =   103 bits (256),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRR+RVRGGN KWRALR DT NYSWGSEA+TRKTRI
Sbjct  70   YELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRFDTCNYSWGSEALTRKTRI  122



>ref|XP_001422585.1| Ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP00902.1| Ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=220

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSN TVR++R RGGN+K RALR
Sbjct  1    MGISRDSLHKRRATGGKQKPWRKKRKYELGRQPANTKLSSNVTVRQVRCRGGNIKHRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN++WGSE  TRKTRI
Sbjct  61   LDTGNFAWGSENCTRKTRI  79



>gb|AAT08014.1| putative 40S ribosomal protein S8 [Zea mays]
Length=245

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRR+RVRGGN KWRALR DT NYSWGSEA+TRKTRI
Sbjct  124  YELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRFDTCNYSWGSEALTRKTRI  176



>ref|XP_002945874.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ52869.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=209

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGG+KK WRKK+KYE+GR PANTKLSSN  VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRATGGRKKHWRKKKKYEMGRVPANTKLSSNVAVRTVRVRGGHTKFRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRK RI
Sbjct  61   LDTGNYSWGSEAVTRKVRI  79



>gb|AFW85400.1| putative ribosomal protein S8e family protein [Zea mays]
Length=397

 Score =   103 bits (257),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKTVRR+RVRGGN KWRALR DT NYSWGSEA+TRKTRI
Sbjct  276  YELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRFDTCNYSWGSEALTRKTRI  328



>ref|XP_001696201.1| ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP08178.1| ribosomal protein S8 [Chlamydomonas reinhardtii]
Length=208

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRATGG+KK WRKK+KYE+GR PANTKLS+N  VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRATGGRKKHWRKKKKYEMGRVPANTKLSTNVAVRTVRVRGGHTKFRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRK RI
Sbjct  61   LDTGNYSWGSEAVTRKVRI  79



>tpg|DAA42540.1| TPA: putative ribosomal protein S8e family protein [Zea mays]
Length=245

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGR PANTKLSSNKTVRR+ VRGGNVKWRALRLDT NYSWGSEA+TRKTRI
Sbjct  120  YELGRHPANTKLSSNKTVRRVCVRGGNVKWRALRLDTCNYSWGSEALTRKTRI  172



>gb|ABA01100.1| 40S ribosomal protein S8 [Chlamydomonas incerta]
Length=208

 Score =   100 bits (248),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRR TGG+KK WRKK+KYE+GR PANTKLS+N  VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRDTGGRKKHWRKKKKYEMGRVPANTKLSTNVAVRTVRVRGGHTKFRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGNYSWGSEAVTRK RI
Sbjct  61   LDTGNYSWGSEAVTRKVRI  79



>gb|KDD75705.1| ribosomal protein S8e [Helicosporidium sp. ATCC 50920]
Length=353

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRRA+G +   WRKKRK+ELGRQPANTKLSSN TVR +R RGGN+K+RALR
Sbjct  1    MGISRDSIHKRRASGARPNIWRKKRKFELGRQPANTKLSSNVTVRPVRCRGGNMKYRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LD+GN+SWGSEA TR+TRI
Sbjct  61   LDSGNFSWGSEATTRRTRI  79



>gb|AET01418.2| 40S ribosomal protein S8 [Medicago truncatula]
Length=288

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  67   ISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLD  246
            ISRDS  KR ATGGK+K   KKRKYELGRQPANTKLSSNKTVR IRVRGGN+K RALRLD
Sbjct  74   ISRDSRDKRLATGGKRKTCIKKRKYELGRQPANTKLSSNKTVRSIRVRGGNLKCRALRLD  133

Query  247  TGNYSWGSEAVTRKTRI  297
            TGN SWGSEAVTRK+R+
Sbjct  134  TGNISWGSEAVTRKSRL  150



>gb|AES86897.2| 40S ribosomal S8-like protein [Medicago truncatula]
Length=218

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKT+R IRVRGGNVK RALRLDTGN SWGSEAVTRKTR+
Sbjct  27   YELGRQPANTKLSSNKTLRTIRVRGGNVKCRALRLDTGNCSWGSEAVTRKTRL  79



>ref|XP_003604700.1| Ribosomal protein S8 [Medicago truncatula]
Length=280

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSNKT+R IRVRGGNVK RALRLDTGN SWGSEAVTRKTR+
Sbjct  8    YELGRQPANTKLSSNKTLRTIRVRGGNVKCRALRLDTGNCSWGSEAVTRKTRL  60



>ref|XP_002963298.1| hypothetical protein SELMODRAFT_80565, partial [Selaginella moellendorffii]
 ref|XP_002974597.1| hypothetical protein SELMODRAFT_101634, partial [Selaginella 
moellendorffii]
 gb|EFJ24117.1| hypothetical protein SELMODRAFT_101634, partial [Selaginella 
moellendorffii]
 gb|EFJ35169.1| hypothetical protein SELMODRAFT_80565, partial [Selaginella moellendorffii]
Length=214

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +1

Query  64   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  243
            GISRDS+HKRRATGGKKKAWRKKRKYELGRQPA TKL++ KTVRRIRVRGGN K RALRL
Sbjct  1    GISRDSLHKRRATGGKKKAWRKKRKYELGRQPAMTKLAA-KTVRRIRVRGGNFKLRALRL  59

Query  244  DTGNYSWGSEAVTRKTRI  297
            D GNYSWG+EAV RKTRI
Sbjct  60   DAGNYSWGTEAVARKTRI  77



>ref|XP_004516802.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=312

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQ A+TKLSSNKT+RRIRVRGGNVKWR LR DTGN+SWGSEAVTRKTR+
Sbjct  21   YELGRQLASTKLSSNKTIRRIRVRGGNVKWRDLRWDTGNFSWGSEAVTRKTRL  73



>ref|XP_008676011.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=335

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSN+TVRR+ VRGGN KWRALRLDTGN SWGSEA+ RKT I
Sbjct  149  YELGRQPANTKLSSNETVRRVHVRGGNAKWRALRLDTGNCSWGSEALIRKTHI  201



>ref|XP_003083062.1| RS8_MAIZE 40S ribosomal protein S8 pir||T04088 ribosomal protein 
S8-maize (ISS) [Ostreococcus tauri]
Length=388

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQPANTKLSSN TVR++R RGGNVK RALRLDTGNYSWGSE  TRKTRI
Sbjct  33   YELGRQPANTKLSSNVTVRQVRCRGGNVKHRALRLDTGNYSWGSENCTRKTRI  85



>gb|EPZ31448.1| 40S ribosomal protein S8-B [Rozella allomycis CSF55]
Length=205

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 1/79 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS HKR  TG K+  +RKKRK+ELGRQPANTKL + K +  +RVRGGN K+RA+R
Sbjct  1    MGISRDSRHKRSHTGAKRAQYRKKRKFELGRQPANTKLGA-KRIHPVRVRGGNTKFRAMR  59

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LDTGN+SWGSEA+TRKTRI
Sbjct  60   LDTGNFSWGSEAITRKTRI  78



>ref|XP_002505425.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66683.1| predicted protein [Micromonas sp. RCC299]
Length=215

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRR TGGK+K WRKKRKYELGRQPANTKLSS+  VR +R RGGN K+RALR
Sbjct  1    MGISRDSLHKRRLTGGKQKPWRKKRKYELGRQPANTKLSSHVDVRVVRCRGGNKKFRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LD GN+SWGSE VTRK RI
Sbjct  61   LDHGNFSWGSENVTRKARI  79



>ref|XP_003195106.1| 40S ribosomal protein S8 [Cryptococcus gattii WM276]
 gb|ADV23319.1| 40S ribosomal protein S8, putative [Cryptococcus gattii WM276]
 gb|KIR51973.1| ribosomal protein S8.e [Cryptococcus gattii Ru294]
 gb|KIR77902.1| ribosomal protein S8.e [Cryptococcus gattii EJB2]
 gb|KIY31985.1| ribosomal protein S8.e [Cryptococcus gattii E566]
 gb|KJE03251.1| ribosomal protein S8.e [Cryptococcus gattii NT-10]
Length=208

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGI+RDS HKR A+G ++  +RKKRK+ELGRQPA TKL S+K V  +R RGGNVK+RALR
Sbjct  1    MGITRDSRHKRAASGARRAHYRKKRKFELGRQPAMTKLDSSKRVHEVRTRGGNVKYRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LD+GN++WGSE++TRKTR+
Sbjct  61   LDSGNFAWGSESITRKTRL  79



>ref|XP_572078.1| 40S ribosomal protein S8 [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_774458.1| 40S ribosomal protein S8 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL19811.1| hypothetical protein CNBG1040 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW44771.1| 40S ribosomal protein S8, putative [Cryptococcus neoformans var. 
neoformans JEC21]
Length=208

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGI+RDS HKR A+G ++  +RKKRK+ELGRQPA TKL S+K +  +R RGGNVK+RALR
Sbjct  1    MGITRDSRHKRAASGARRAHYRKKRKFELGRQPAMTKLDSSKRIHEVRTRGGNVKYRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LD+GN++WGSE+VTRKTR+
Sbjct  61   LDSGNFAWGSESVTRKTRL  79



>ref|XP_006377633.1| hypothetical protein POPTR_0011s09100g, partial [Populus trichocarpa]
 gb|ERP55430.1| hypothetical protein POPTR_0011s09100g, partial [Populus trichocarpa]
Length=112

 Score = 92.0 bits (227),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  154  QPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            QPANTKLSSNKTVRRIRVRGGN+KWRALRLDTGNY WGSEA+TRKT+I
Sbjct  20   QPANTKLSSNKTVRRIRVRGGNMKWRALRLDTGNYFWGSEAMTRKTKI  67



>gb|AFR96425.1| small subunit ribosomal protein S8e [Cryptococcus neoformans 
var. grubii H99]
Length=208

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGI+RDS HKR A+G ++  +RKKRK+ELGRQPA TKL S+K +  +R RGGNVK+RALR
Sbjct  1    MGITRDSRHKRAASGARRAHYRKKRKFELGRQPAMTKLDSSKRIHEVRTRGGNVKYRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LD+GN++WGSE++TRKTR+
Sbjct  61   LDSGNFAWGSESITRKTRL  79



>gb|KGB76549.1| 40S ribosomal protein S8 [Cryptococcus gattii R265]
 gb|KIR27710.1| ribosomal protein S8.e [Cryptococcus gattii LA55]
 gb|KIR31676.1| ribosomal protein S8.e [Cryptococcus gattii MMRL2647]
 gb|KIR42052.1| ribosomal protein S8.e [Cryptococcus gattii Ram5]
 gb|KIR73124.1| ribosomal protein S8.e [Cryptococcus gattii CA1014]
 gb|KIR90099.1| ribosomal protein S8.e [Cryptococcus gattii CBS 10090]
 gb|KIR98879.1| ribosomal protein S8.e [Cryptococcus gattii 2001/935-1]
 gb|KIY55947.1| ribosomal protein S8.e [Cryptococcus gattii 99/473]
Length=208

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGI+RDS HKR A+G ++  +RKKRK+ELGRQPA TKL S+K +  +R RGGNVK+RALR
Sbjct  1    MGITRDSRHKRAASGARRAHYRKKRKFELGRQPAMTKLDSSKRIHEVRTRGGNVKYRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LD+GN++WGSE++TRKTR+
Sbjct  61   LDSGNFAWGSESITRKTRL  79



>gb|KIR49123.1| ribosomal protein S8.e [Cryptococcus gattii CA1280]
 gb|KIR68232.1| ribosomal protein S8.e [Cryptococcus gattii CA1873]
 gb|KIR88625.1| ribosomal protein S8.e [Cryptococcus gattii IND107]
Length=208

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGI+RDS HKR A+G ++  +RKKRK+ELGRQPA TKL S+K +  +R RGGNVK+RALR
Sbjct  1    MGITRDSRHKRAASGARRAHYRKKRKFELGRQPAMTKLDSSKRIHEVRTRGGNVKYRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LD+GN++WGSE++TRKTR+
Sbjct  61   LDSGNFAWGSESITRKTRL  79



>ref|XP_005648786.1| 40S ribosomal protein S8 [Coccomyxa subellipsoidea C-169]
 gb|EIE24242.1| 40S ribosomal protein S8 [Coccomyxa subellipsoidea C-169]
Length=214

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS+HKRR TGGK+K WRKKRK+ELGRQPANTKLSSN TVRR+RVRGGN K+RALR
Sbjct  1    MGISRDSLHKRRLTGGKQKTWRKKRKFELGRQPANTKLSSNVTVRRVRVRGGNFKFRALR  60

Query  241  LDTGNYSWGSEAVTRKTRI  297
            LD+GN+SWGSEAVTRKTR+
Sbjct  61   LDSGNFSWGSEAVTRKTRV  79



>emb|CCA22399.1| 40S ribosomal protein S82 putative [Albugo laibachii Nc14]
Length=206

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +1

Query  61   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  240
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTKL   K V R+RVRGG+ K+RALR
Sbjct  1    MGISRDSRHKRRDTGGKRKQYRKKRKFELGRQPANTKLG-GKRVHRVRVRGGHFKFRALR  59

Query  241  LDTGNYSWGSEAVTRKTRI  297
            L+TGN+SWGSEAV+RKTRI
Sbjct  60   LETGNFSWGSEAVSRKTRI  78



>ref|XP_004513783.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=112

 Score = 89.7 bits (221),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  139  YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRI  297
            YELGRQP NTKLS NKT+RRIRV+G  VKW+ LRL+TGN+SWGSE VTRKTR+
Sbjct  9    YELGRQPTNTKLSINKTIRRIRVQGSTVKWKTLRLNTGNFSWGSEVVTRKTRL  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566700398000