BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF010D13

Length=310
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB15311.1|  hypothetical protein B456_002G170500                  82.0    8e-16   Gossypium raimondii
gb|KJB15313.1|  hypothetical protein B456_002G170500                  82.0    1e-15   Gossypium raimondii
gb|KJB15310.1|  hypothetical protein B456_002G170500                  81.6    1e-15   Gossypium raimondii
ref|XP_007210263.1|  hypothetical protein PRUPE_ppa003204mg           81.6    2e-15   Prunus persica
gb|KJB60875.1|  hypothetical protein B456_009G329300                  81.3    2e-15   Gossypium raimondii
emb|CDY03085.1|  BnaC07g21420D                                        80.9    2e-15   
gb|KJB60874.1|  hypothetical protein B456_009G329300                  81.3    2e-15   Gossypium raimondii
ref|XP_010244840.1|  PREDICTED: putative phagocytic receptor 1b       81.3    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_007158822.1|  hypothetical protein PHAVU_002G184900g           80.9    3e-15   Phaseolus vulgaris [French bean]
emb|CDY15803.1|  BnaC02g34220D                                        80.9    3e-15   Brassica napus [oilseed rape]
gb|KHG04463.1|  Putative phagocytic receptor 1b                       80.9    3e-15   Gossypium arboreum [tree cotton]
ref|XP_002890068.1|  predicted protein                                80.5    3e-15   
ref|XP_010527833.1|  PREDICTED: putative phagocytic receptor 1b       80.5    4e-15   Tarenaya hassleriana [spider flower]
ref|XP_007045410.1|  Endomembrane protein 70 protein family isofo...  80.5    4e-15   
ref|XP_010276303.1|  PREDICTED: putative phagocytic receptor 1b       80.5    4e-15   Nelumbo nucifera [Indian lotus]
ref|XP_007045409.1|  Endomembrane protein 70 protein family isofo...  80.5    4e-15   
gb|AAF63170.1|AC010657_6  T5E21.15                                    80.5    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554368.1|  PREDICTED: putative phagocytic receptor 1b       80.5    4e-15   Tarenaya hassleriana [spider flower]
ref|XP_006395825.1|  hypothetical protein EUTSA_v10003877mg           80.1    5e-15   Eutrema salsugineum [saltwater cress]
gb|EPS59962.1|  hypothetical protein M569_14842                       79.7    5e-15   Genlisea aurea
ref|XP_002521898.1|  transporter, putative                            80.1    5e-15   
ref|NP_172919.1|  putative endomembrane protein 70                    80.1    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006448060.1|  hypothetical protein CICLE_v10014688mg           80.1    5e-15   
ref|XP_011011376.1|  PREDICTED: transmembrane 9 superfamily membe...  79.7    6e-15   Populus euphratica
emb|CDY41095.1|  BnaC05g10860D                                        80.1    6e-15   Brassica napus [oilseed rape]
ref|XP_010920044.1|  PREDICTED: transmembrane 9 superfamily membe...  79.7    6e-15   
ref|NP_178306.1|  putative endomembrane protein 70                    80.1    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010920043.1|  PREDICTED: transmembrane 9 superfamily membe...  79.7    6e-15   
ref|XP_008393472.1|  PREDICTED: putative phagocytic receptor 1b       80.1    6e-15   Malus domestica [apple tree]
ref|XP_003531127.1|  PREDICTED: putative phagocytic receptor 1b-like  80.1    6e-15   Glycine max [soybeans]
ref|XP_011038406.1|  PREDICTED: transmembrane 9 superfamily membe...  79.7    6e-15   Populus euphratica
ref|XP_006372422.1|  endomembrane protein 70                          79.7    6e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006416990.1|  hypothetical protein EUTSA_v10007150mg           79.7    7e-15   Eutrema salsugineum [saltwater cress]
ref|XP_007152616.1|  hypothetical protein PHAVU_004G145000g           79.7    7e-15   Phaseolus vulgaris [French bean]
gb|KHN28892.1|  Putative phagocytic receptor 1b                       79.7    7e-15   Glycine soja [wild soybean]
ref|XP_002876790.1|  hypothetical protein ARALYDRAFT_904415           79.7    7e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_003524839.1|  PREDICTED: putative phagocytic receptor 1b-like  79.7    7e-15   Glycine max [soybeans]
ref|XP_009355975.1|  PREDICTED: putative phagocytic receptor 1b       79.7    7e-15   Pyrus x bretschneideri [bai li]
ref|XP_008389133.1|  PREDICTED: putative phagocytic receptor 1b       79.7    8e-15   
ref|XP_006448061.1|  hypothetical protein CICLE_v10014688mg           79.7    8e-15   Citrus clementina [clementine]
gb|KHG00678.1|  Putative phagocytic receptor 1b                       79.3    8e-15   Gossypium arboreum [tree cotton]
ref|XP_002521900.1|  transporter, putative                            79.7    8e-15   Ricinus communis
ref|XP_008340538.1|  PREDICTED: putative phagocytic receptor 1b       79.3    9e-15   Malus domestica [apple tree]
ref|XP_010920042.1|  PREDICTED: transmembrane 9 superfamily membe...  79.3    9e-15   
ref|XP_008375035.1|  PREDICTED: putative phagocytic receptor 1b       79.3    9e-15   
gb|AHA84153.1|  phagocytic receptor 1b                                79.3    1e-14   Phaseolus vulgaris [French bean]
emb|CDY56297.1|  BnaC09g52300D                                        79.0    1e-14   Brassica napus [oilseed rape]
gb|AAF79216.1|AC006917_1  F10B6.2                                     76.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008220963.1|  PREDICTED: putative phagocytic receptor 1b       79.0    1e-14   Prunus mume [ume]
ref|XP_009110524.1|  PREDICTED: putative phagocytic receptor 1b       79.0    1e-14   Brassica rapa
gb|KDP38191.1|  hypothetical protein JCGZ_04834                       79.0    1e-14   Jatropha curcas
ref|XP_007225615.1|  hypothetical protein PRUPE_ppa003229mg           79.0    1e-14   Prunus persica
ref|XP_010920041.1|  PREDICTED: transmembrane 9 superfamily membe...  79.0    1e-14   
gb|KHN43674.1|  Putative phagocytic receptor 1b                       79.0    1e-14   Glycine soja [wild soybean]
ref|XP_009351612.1|  PREDICTED: putative phagocytic receptor 1b       79.0    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_011099916.1|  PREDICTED: transmembrane 9 superfamily member 3  79.0    2e-14   
ref|XP_009380058.1|  PREDICTED: putative phagocytic receptor 1b       79.0    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY52035.1|  BnaA08g31480D                                        79.0    2e-14   Brassica napus [oilseed rape]
gb|KDP38192.1|  hypothetical protein JCGZ_04835                       78.6    2e-14   Jatropha curcas
ref|XP_010528590.1|  PREDICTED: putative phagocytic receptor 1b       78.6    2e-14   Tarenaya hassleriana [spider flower]
emb|CDY52038.1|  BnaA08g31510D                                        78.2    2e-14   Brassica napus [oilseed rape]
gb|KFK33411.1|  hypothetical protein AALP_AA5G009400                  78.6    2e-14   Arabis alpina [alpine rockcress]
emb|CDX84018.1|  BnaC08g16270D                                        78.6    2e-14   
ref|XP_008788644.1|  PREDICTED: putative phagocytic receptor 1b       78.6    2e-14   Phoenix dactylifera
ref|XP_009785097.1|  PREDICTED: putative phagocytic receptor 1b       78.6    2e-14   Nicotiana sylvestris
ref|XP_010910475.1|  PREDICTED: transmembrane 9 superfamily membe...  78.2    2e-14   
ref|XP_010440842.1|  PREDICTED: putative phagocytic receptor 1b i...  77.4    2e-14   
ref|XP_006372420.1|  hypothetical protein POPTR_0017s01480g           78.2    2e-14   
gb|KHN24548.1|  Putative phagocytic receptor 1b                       78.2    2e-14   Glycine soja [wild soybean]
ref|XP_009631354.1|  PREDICTED: putative phagocytic receptor 1b       78.2    2e-14   Nicotiana tomentosiformis
ref|XP_003548324.1|  PREDICTED: putative phagocytic receptor 1b-like  78.2    2e-14   Glycine max [soybeans]
ref|XP_006352389.1|  PREDICTED: putative phagocytic receptor 1b-l...  78.2    2e-14   Solanum tuberosum [potatoes]
ref|XP_010910473.1|  PREDICTED: transmembrane 9 superfamily membe...  78.2    2e-14   Elaeis guineensis
gb|KJB08471.1|  hypothetical protein B456_001G083100                  78.2    2e-14   Gossypium raimondii
ref|NP_001148367.1|  transmembrane 9 superfamily protein member 1...  78.2    3e-14   Zea mays [maize]
ref|XP_004250237.1|  PREDICTED: putative phagocytic receptor 1b       78.2    3e-14   Solanum lycopersicum
ref|XP_010910474.1|  PREDICTED: transmembrane 9 superfamily membe...  78.2    3e-14   
ref|XP_010069472.1|  PREDICTED: putative phagocytic receptor 1b       78.2    3e-14   Eucalyptus grandis [rose gum]
ref|XP_008461818.1|  PREDICTED: putative phagocytic receptor 1b i...  78.2    3e-14   Cucumis melo [Oriental melon]
ref|XP_011038404.1|  PREDICTED: transmembrane 9 superfamily member 4  78.2    3e-14   Populus euphratica
ref|XP_006372421.1|  hypothetical protein POPTR_0017s01480g           78.2    3e-14   Populus trichocarpa [western balsam poplar]
emb|CDY47549.1|  BnaA08g07380D                                        78.2    3e-14   Brassica napus [oilseed rape]
ref|XP_006854108.1|  hypothetical protein AMTR_s00048p00146310        78.2    3e-14   
ref|XP_010523531.1|  PREDICTED: putative phagocytic receptor 1b       78.2    3e-14   Tarenaya hassleriana [spider flower]
ref|XP_010523409.1|  PREDICTED: putative phagocytic receptor 1b       78.2    3e-14   Tarenaya hassleriana [spider flower]
gb|KFK43715.1|  hypothetical protein AALP_AA1G163400                  77.8    3e-14   Arabis alpina [alpine rockcress]
ref|XP_004137376.1|  PREDICTED: putative phagocytic receptor 1b-like  77.8    3e-14   Cucumis sativus [cucumbers]
ref|XP_006431398.1|  hypothetical protein CICLE_v10000657mg           77.8    3e-14   
ref|XP_004972769.1|  PREDICTED: putative phagocytic receptor 1b-l...  77.8    3e-14   Setaria italica
gb|KJB08472.1|  hypothetical protein B456_001G083100                  77.8    3e-14   Gossypium raimondii
ref|XP_004972768.1|  PREDICTED: putative phagocytic receptor 1b-l...  78.2    3e-14   
ref|XP_010440841.1|  PREDICTED: putative phagocytic receptor 1b i...  77.8    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010691703.1|  PREDICTED: transmembrane 9 superfamily member 2  77.8    4e-14   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY62621.1|  BnaC08g46810D                                        77.8    4e-14   Brassica napus [oilseed rape]
ref|XP_010450487.1|  PREDICTED: putative phagocytic receptor 1b       77.8    4e-14   Camelina sativa [gold-of-pleasure]
ref|NP_198547.3|  putative endomembrane protein 70                    77.8    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870515.1|  transporter                                      77.8    4e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_008813153.1|  PREDICTED: putative phagocytic receptor 1b       77.8    4e-14   Phoenix dactylifera
ref|XP_006470811.1|  PREDICTED: putative phagocytic receptor 1b-like  77.8    4e-14   Citrus sinensis [apfelsine]
ref|XP_006431397.1|  hypothetical protein CICLE_v10000657mg           77.8    4e-14   Citrus clementina [clementine]
ref|XP_006405901.1|  hypothetical protein EUTSA_v10027693mg           77.4    4e-14   
ref|XP_008356712.1|  PREDICTED: putative phagocytic receptor 1b       75.5    4e-14   
ref|XP_004299493.1|  PREDICTED: transmembrane 9 superfamily membe...  77.4    4e-14   Fragaria vesca subsp. vesca
gb|EYU30892.1|  hypothetical protein MIMGU_mgv1a003326mg              77.4    4e-14   Erythranthe guttata [common monkey flower]
ref|XP_009108077.1|  PREDICTED: putative phagocytic receptor 1b       77.4    5e-14   Brassica rapa
gb|AES99151.2|  transmembrane 9 family protein                        77.4    5e-14   Medicago truncatula
ref|XP_010476529.1|  PREDICTED: putative phagocytic receptor 1b       77.4    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010496367.1|  PREDICTED: putative phagocytic receptor 1b       77.4    5e-14   Camelina sativa [gold-of-pleasure]
ref|NP_001175393.1|  Os08g0162000                                     72.0    5e-14   
ref|XP_010458976.1|  PREDICTED: putative phagocytic receptor 1b       77.4    5e-14   Camelina sativa [gold-of-pleasure]
gb|EYU30878.1|  hypothetical protein MIMGU_mgv1a003324mg              77.4    5e-14   Erythranthe guttata [common monkey flower]
gb|KJB08470.1|  hypothetical protein B456_001G083100                  77.4    5e-14   Gossypium raimondii
gb|EEC82941.1|  hypothetical protein OsI_27915                        77.4    5e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_003573450.1|  PREDICTED: putative phagocytic receptor 1b       77.4    5e-14   Brachypodium distachyon [annual false brome]
gb|KHG09925.1|  Putative phagocytic receptor 1b                       77.0    6e-14   Gossypium arboreum [tree cotton]
ref|XP_006292411.1|  hypothetical protein CARUB_v10018624mg           77.0    6e-14   Capsella rubella
ref|XP_010513951.1|  PREDICTED: putative phagocytic receptor 1b       77.0    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010502204.1|  PREDICTED: putative phagocytic receptor 1b       77.0    7e-14   Camelina sativa [gold-of-pleasure]
emb|CDX81659.1|  BnaC08g39420D                                        77.0    7e-14   
ref|XP_009388099.1|  PREDICTED: putative phagocytic receptor 1b       77.0    7e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010691704.1|  PREDICTED: transmembrane 9 superfamily membe...  77.0    7e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011463508.1|  PREDICTED: transmembrane 9 superfamily member 2  77.0    7e-14   Fragaria vesca subsp. vesca
ref|XP_010105529.1|  Putative phagocytic receptor 1b                  77.0    7e-14   Morus notabilis
gb|EMT19161.1|  Putative phagocytic receptor 1b                       77.0    7e-14   
ref|XP_010445554.1|  PREDICTED: putative phagocytic receptor 1b       75.9    7e-14   Camelina sativa [gold-of-pleasure]
ref|XP_003616193.1|  Transmembrane 9 superfamily protein member       77.0    7e-14   
ref|XP_002521899.1|  transporter, putative                            76.6    9e-14   Ricinus communis
ref|XP_006307070.1|  hypothetical protein CARUB_v10008657mg           76.6    9e-14   Capsella rubella
dbj|BAJ89640.1|  predicted protein                                    76.6    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010066537.1|  PREDICTED: putative phagocytic receptor 1b       76.6    1e-13   Eucalyptus grandis [rose gum]
ref|XP_011005915.1|  PREDICTED: transmembrane 9 superfamily membe...  76.6    1e-13   Populus euphratica
gb|EEE68090.1|  hypothetical protein OsJ_26137                        76.6    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009404153.1|  PREDICTED: putative phagocytic receptor 1b       76.3    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387842.1|  PREDICTED: putative phagocytic receptor 1b       76.3    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN41041.1|  Putative phagocytic receptor 1b                       76.3    1e-13   Glycine soja [wild soybean]
ref|XP_003518365.2|  PREDICTED: putative phagocytic receptor 1b-l...  76.3    1e-13   Glycine max [soybeans]
ref|XP_006575472.1|  PREDICTED: putative phagocytic receptor 1b-l...  76.3    1e-13   Glycine max [soybeans]
ref|XP_004504610.1|  PREDICTED: putative phagocytic receptor 1b-like  76.3    1e-13   Cicer arietinum [garbanzo]
emb|CDP01680.1|  unnamed protein product                              76.3    1e-13   Coffea canephora [robusta coffee]
dbj|BAJ89513.1|  predicted protein                                    75.9    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008789222.1|  PREDICTED: putative phagocytic receptor 1b       75.9    1e-13   
ref|XP_007031333.1|  Endomembrane protein 70 protein family           75.9    2e-13   
ref|XP_006346764.1|  PREDICTED: putative phagocytic receptor 1b-like  75.9    2e-13   Solanum tuberosum [potatoes]
gb|EMS60954.1|  Putative phagocytic receptor 1b                       75.9    2e-13   Triticum urartu
ref|XP_004236681.1|  PREDICTED: putative phagocytic receptor 1b       75.9    2e-13   Solanum lycopersicum
ref|XP_006365862.1|  PREDICTED: putative phagocytic receptor 1b-like  75.5    2e-13   
ref|XP_008462539.1|  PREDICTED: putative phagocytic receptor 1b i...  75.5    2e-13   Cucumis melo [Oriental melon]
ref|XP_004239834.1|  PREDICTED: putative phagocytic receptor 1b       75.5    2e-13   Solanum lycopersicum
ref|XP_009616336.1|  PREDICTED: putative phagocytic receptor 1b       75.5    2e-13   Nicotiana tomentosiformis
ref|XP_007141945.1|  hypothetical protein PHAVU_008G239300g           75.5    2e-13   Phaseolus vulgaris [French bean]
ref|XP_009419338.1|  PREDICTED: putative phagocytic receptor 1b       75.5    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009784369.1|  PREDICTED: putative phagocytic receptor 1b i...  75.5    2e-13   Nicotiana sylvestris
ref|XP_008356702.1|  PREDICTED: transmembrane 9 superfamily membe...  74.7    3e-13   
ref|XP_010435562.1|  PREDICTED: putative phagocytic receptor 1b       75.1    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006283389.1|  hypothetical protein CARUB_v10004434mg           75.1    3e-13   Capsella rubella
ref|XP_004515238.1|  PREDICTED: putative phagocytic receptor 1b-like  75.1    3e-13   Cicer arietinum [garbanzo]
ref|XP_010917284.1|  PREDICTED: transmembrane 9 superfamily membe...  75.1    3e-13   Elaeis guineensis
ref|XP_009774478.1|  PREDICTED: putative phagocytic receptor 1b       75.1    3e-13   Nicotiana sylvestris
ref|XP_011005913.1|  PREDICTED: transmembrane 9 superfamily membe...  75.1    3e-13   Populus euphratica
ref|XP_002305925.2|  endomembrane protein 70                          75.1    3e-13   Populus trichocarpa [western balsam poplar]
ref|XP_009389646.1|  PREDICTED: putative phagocytic receptor 1b       75.1    3e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008356706.1|  PREDICTED: transmembrane 9 superfamily membe...  74.3    3e-13   
gb|KHG03505.1|  Putative phagocytic receptor 1b                       75.1    3e-13   Gossypium arboreum [tree cotton]
ref|XP_003544357.1|  PREDICTED: putative phagocytic receptor 1b-like  74.7    3e-13   Glycine max [soybeans]
ref|XP_009110529.1|  PREDICTED: putative phagocytic receptor 1b       74.7    3e-13   Brassica rapa
ref|XP_002285238.1|  PREDICTED: transmembrane 9 superfamily member 2  74.7    4e-13   Vitis vinifera
ref|XP_004170088.1|  PREDICTED: putative phagocytic receptor 1b-like  74.7    4e-13   
gb|ADQ43185.1|  endomemebrane protein 70                              74.7    4e-13   Schrenkiella parvula
ref|XP_009602054.1|  PREDICTED: putative phagocytic receptor 1b       74.7    4e-13   Nicotiana tomentosiformis
gb|KJB10378.1|  hypothetical protein B456_001G198000                  74.3    5e-13   Gossypium raimondii
ref|XP_009775043.1|  PREDICTED: putative phagocytic receptor 1b       74.7    5e-13   Nicotiana sylvestris
ref|XP_009408099.1|  PREDICTED: putative phagocytic receptor 1b       74.3    5e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB43179.1|  hypothetical protein B456_007G188200                  74.3    5e-13   Gossypium raimondii
gb|KHG20583.1|  Putative phagocytic receptor 1b                       74.3    5e-13   Gossypium arboreum [tree cotton]
ref|XP_008466877.1|  PREDICTED: putative phagocytic receptor 1b       74.3    6e-13   Cucumis melo [Oriental melon]
ref|XP_010932502.1|  PREDICTED: transmembrane 9 superfamily membe...  74.3    6e-13   Elaeis guineensis
ref|XP_006384123.1|  hypothetical protein POPTR_0004s07400g           73.9    7e-13   
ref|XP_004150159.1|  PREDICTED: putative phagocytic receptor 1b-like  73.9    8e-13   
ref|XP_004985073.1|  PREDICTED: putative phagocytic receptor 1b-like  73.9    8e-13   Setaria italica
ref|XP_003620064.1|  Transmembrane 9 superfamily protein member       73.6    9e-13   Medicago truncatula
ref|XP_008798135.1|  PREDICTED: putative phagocytic receptor 1b       73.6    1e-12   Phoenix dactylifera
ref|XP_008791844.1|  PREDICTED: putative phagocytic receptor 1b       73.6    1e-12   Phoenix dactylifera
ref|XP_003558407.1|  PREDICTED: putative phagocytic receptor 1b       73.2    1e-12   Brachypodium distachyon [annual false brome]
emb|CDP05457.1|  unnamed protein product                              72.4    2e-12   Coffea canephora [robusta coffee]
ref|XP_011003770.1|  PREDICTED: transmembrane 9 superfamily membe...  72.4    3e-12   Populus euphratica
ref|XP_004490795.1|  PREDICTED: putative phagocytic receptor 1b-like  72.0    3e-12   Cicer arietinum [garbanzo]
ref|XP_006659860.1|  PREDICTED: putative phagocytic receptor 1b-like  72.0    4e-12   Oryza brachyantha
ref|XP_006849485.1|  hypothetical protein AMTR_s00024p00115620        72.0    4e-12   
ref|XP_002317710.2|  hypothetical protein POPTR_0012s03920g           71.6    5e-12   
ref|XP_010936838.1|  PREDICTED: transmembrane 9 superfamily membe...  71.2    6e-12   Elaeis guineensis
gb|AGT15903.1|  transmembrane 9 superfamily protein                   71.2    6e-12   Saccharum hybrid cultivar R570
ref|XP_002468203.1|  hypothetical protein SORBIDRAFT_01g041650        71.2    6e-12   Sorghum bicolor [broomcorn]
gb|ABK24901.1|  unknown                                               71.2    7e-12   Picea sitchensis
ref|XP_009628015.1|  PREDICTED: putative phagocytic receptor 1b i...  71.2    7e-12   Nicotiana tomentosiformis
ref|NP_001049492.1|  Os03g0237000                                     70.9    8e-12   
gb|ABK25212.1|  unknown                                               69.7    9e-12   Picea sitchensis
ref|XP_006376703.1|  hypothetical protein POPTR_0012s03920g           70.9    9e-12   
ref|XP_004240860.1|  PREDICTED: putative phagocytic receptor 1b i...  70.9    1e-11   
ref|XP_010276746.1|  PREDICTED: putative phagocytic receptor 1b       70.9    1e-11   Nelumbo nucifera [Indian lotus]
ref|XP_009615617.1|  PREDICTED: putative phagocytic receptor 1b i...  70.5    1e-11   Nicotiana tomentosiformis
emb|CDP01681.1|  unnamed protein product                              70.5    1e-11   Coffea canephora [robusta coffee]
ref|XP_001783681.1|  predicted protein                                69.3    3e-11   
ref|NP_001151315.1|  transmembrane 9 superfamily protein member 1...  69.3    3e-11   Zea mays [maize]
gb|ACG42357.1|  transmembrane 9 superfamily protein member 1 prec...  69.3    3e-11   Zea mays [maize]
ref|XP_010521657.1|  PREDICTED: putative phagocytic receptor 1b i...  68.9    4e-11   Tarenaya hassleriana [spider flower]
ref|XP_006358745.1|  PREDICTED: putative phagocytic receptor 1b-like  68.9    5e-11   
ref|XP_009782678.1|  PREDICTED: putative phagocytic receptor 1b i...  68.6    5e-11   Nicotiana sylvestris
ref|XP_010099693.1|  Putative phagocytic receptor 1b                  68.6    6e-11   
tpg|DAA44289.1|  TPA: hypothetical protein ZEAMMB73_547933            67.8    9e-11   
ref|XP_010939968.1|  PREDICTED: transmembrane 9 superfamily membe...  68.2    9e-11   Elaeis guineensis
emb|CDP05449.1|  unnamed protein product                              66.2    1e-10   Coffea canephora [robusta coffee]
emb|CDP05443.1|  unnamed protein product                              67.8    1e-10   Coffea canephora [robusta coffee]
ref|NP_001148980.1|  LOC100282600 precursor                           67.8    1e-10   Zea mays [maize]
gb|EEC66468.1|  hypothetical protein OsI_32547                        67.4    1e-10   Oryza sativa Indica Group [Indian rice]
gb|AAK52585.1|AC079685_16  Putative endosomal protein                 67.4    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064040.1|  Os10g0112600                                     67.0    2e-10   
ref|XP_011085893.1|  PREDICTED: transmembrane 9 superfamily membe...  67.0    2e-10   Sesamum indicum [beniseed]
ref|XP_006849484.1|  hypothetical protein AMTR_s00024p00115000        67.0    2e-10   Amborella trichopoda
ref|XP_008787888.1|  PREDICTED: putative phagocytic receptor 1b i...  66.6    2e-10   Phoenix dactylifera
ref|XP_008787887.1|  PREDICTED: putative phagocytic receptor 1b i...  66.6    2e-10   Phoenix dactylifera
ref|XP_001775546.1|  predicted protein                                66.2    3e-10   
ref|XP_010036999.1|  PREDICTED: putative phagocytic receptor 1b       66.2    3e-10   Eucalyptus grandis [rose gum]
ref|XP_006661606.1|  PREDICTED: putative phagocytic receptor 1b-like  65.9    5e-10   Oryza brachyantha
ref|XP_004228944.1|  PREDICTED: putative phagocytic receptor 1b       65.9    5e-10   Solanum lycopersicum
gb|ABR16201.1|  unknown                                               65.5    6e-10   Picea sitchensis
emb|CDP05446.1|  unnamed protein product                              65.5    6e-10   Coffea canephora [robusta coffee]
ref|XP_002969094.1|  hypothetical protein SELMODRAFT_170330           65.5    6e-10   Selaginella moellendorffii
ref|XP_001770691.1|  predicted protein                                65.5    7e-10   
ref|XP_002973969.1|  hypothetical protein SELMODRAFT_173941           65.5    7e-10   Selaginella moellendorffii
ref|XP_010037000.1|  PREDICTED: putative phagocytic receptor 1b       65.5    7e-10   Eucalyptus grandis [rose gum]
ref|XP_002974646.1|  hypothetical protein SELMODRAFT_101645           64.7    1e-09   
ref|XP_002963357.1|  hypothetical protein SELMODRAFT_166118           64.7    1e-09   
ref|XP_003059958.1|  predicted protein                                63.5    3e-09   Micromonas pusilla CCMP1545
ref|XP_006361076.1|  PREDICTED: putative phagocytic receptor 1b-like  62.8    5e-09   Solanum tuberosum [potatoes]
ref|XP_005650990.1|  EMP/nonaspanin domain family protein             62.8    6e-09   Coccomyxa subellipsoidea C-169
ref|XP_009779343.1|  PREDICTED: putative phagocytic receptor 1b       62.8    6e-09   Nicotiana sylvestris
dbj|BAJ87519.1|  predicted protein                                    62.8    6e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010322438.1|  PREDICTED: putative phagocytic receptor 1b i...  62.4    7e-09   Solanum lycopersicum
ref|XP_002274254.1|  PREDICTED: transmembrane 9 superfamily member 5  62.4    7e-09   Vitis vinifera
ref|XP_001699211.1|  EMP/nonaspanin domain family protein             62.4    7e-09   Chlamydomonas reinhardtii
emb|CBI28324.3|  unnamed protein product                              62.4    7e-09   Vitis vinifera
ref|XP_004241321.1|  PREDICTED: putative phagocytic receptor 1b i...  62.4    8e-09   Solanum lycopersicum
gb|EWM22128.1|  transmembrane 9 superfamily member 3                  62.0    9e-09   Nannochloropsis gaditana
emb|CAN67239.1|  hypothetical protein VITISV_004804                   62.4    9e-09   Vitis vinifera
ref|XP_001422764.1|  predicted protein                                62.0    1e-08   Ostreococcus lucimarinus CCE9901
ref|XP_010238659.1|  PREDICTED: transmembrane 9 superfamily membe...  62.0    1e-08   Brachypodium distachyon [annual false brome]
ref|XP_006384818.1|  hypothetical protein POPTR_0004s21340g           62.0    1e-08   Populus trichocarpa [western balsam poplar]
gb|KDP33127.1|  hypothetical protein JCGZ_13574                       61.6    1e-08   Jatropha curcas
ref|XP_004293072.1|  PREDICTED: transmembrane 9 superfamily member 5  61.2    2e-08   Fragaria vesca subsp. vesca
ref|XP_008382598.1|  PREDICTED: putative phagocytic receptor 1b       61.2    2e-08   
ref|XP_010045209.1|  PREDICTED: putative phagocytic receptor 1b       61.2    2e-08   Eucalyptus grandis [rose gum]
ref|XP_010089827.1|  Putative phagocytic receptor 1b                  60.8    3e-08   Morus notabilis
ref|XP_002892454.1|  endomembrane protein 70 family protein           60.5    3e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_002509072.1|  predicted protein                                60.5    4e-08   Micromonas commoda
ref|XP_006364083.1|  PREDICTED: putative phagocytic receptor 1b-like  60.5    4e-08   Solanum tuberosum [potatoes]
ref|XP_009592973.1|  PREDICTED: putative phagocytic receptor 1b       60.5    4e-08   Nicotiana tomentosiformis
ref|XP_010475626.1|  PREDICTED: putative phagocytic receptor 1b i...  60.1    5e-08   
ref|XP_010488740.1|  PREDICTED: putative phagocytic receptor 1b i...  60.1    5e-08   
ref|XP_009350847.1|  PREDICTED: putative phagocytic receptor 1b       59.7    5e-08   
ref|XP_009343744.1|  PREDICTED: putative phagocytic receptor 1b       59.7    5e-08   
ref|XP_008807671.1|  PREDICTED: transmembrane 9 superfamily membe...  59.7    6e-08   Phoenix dactylifera
gb|KHN21147.1|  Putative phagocytic receptor 1b                       59.7    6e-08   Glycine soja [wild soybean]
ref|XP_003540797.1|  PREDICTED: putative phagocytic receptor 1b-like  59.7    6e-08   Glycine max [soybeans]
emb|CEG02174.1|  Nonaspanin (TM9SF)                                   59.7    6e-08   Ostreococcus tauri
ref|XP_007512838.1|  predicted protein                                59.7    6e-08   Bathycoccus prasinos
emb|CDX95066.1|  BnaC05g06050D                                        59.7    7e-08   
emb|CDX93569.1|  BnaA06g04790D                                        59.7    7e-08   
ref|XP_005650801.1|  putative endosomal protein                       59.3    8e-08   Coccomyxa subellipsoidea C-169
ref|XP_006487943.1|  PREDICTED: putative phagocytic receptor 1b-l...  59.3    8e-08   Citrus sinensis [apfelsine]
ref|XP_006424246.1|  hypothetical protein CICLE_v10028069mg           59.3    9e-08   Citrus clementina [clementine]
ref|XP_002523798.1|  transporter, putative                            58.9    9e-08   
gb|KCW64445.1|  hypothetical protein EUGRSUZ_G02063                   58.9    1e-07   Eucalyptus grandis [rose gum]
ref|XP_010066531.1|  PREDICTED: putative phagocytic receptor 1b i...  58.9    1e-07   Eucalyptus grandis [rose gum]
ref|XP_005850808.1|  hypothetical protein CHLNCDRAFT_29709            58.9    1e-07   Chlorella variabilis
ref|XP_001785045.1|  predicted protein                                58.9    1e-07   
ref|XP_007132435.1|  hypothetical protein PHAVU_011G094100g           58.9    1e-07   Phaseolus vulgaris [French bean]
gb|KHN45466.1|  Transmembrane 9 superfamily member 3                  58.9    1e-07   Glycine soja [wild soybean]
ref|XP_003540158.1|  PREDICTED: transmembrane 9 superfamily membe...  58.9    1e-07   Glycine max [soybeans]
gb|AAF22904.1|AC006932_21  T27G7.5                                    58.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077489.1|  endomembrane protein 70                          58.5    1e-07   
ref|XP_004506179.1|  PREDICTED: putative phagocytic receptor 1b-like  58.5    2e-07   
ref|XP_011007160.1|  PREDICTED: transmembrane 9 superfamily member 5  58.5    2e-07   
dbj|BAC57816.1|  putative syntaxin SYP111                             58.5    2e-07   
gb|KHN11244.1|  Transmembrane 9 superfamily member 3                  58.2    2e-07   
ref|XP_003532994.1|  PREDICTED: transmembrane 9 superfamily membe...  58.2    2e-07   
ref|XP_009148094.1|  PREDICTED: putative phagocytic receptor 1b i...  58.2    2e-07   
ref|XP_009148093.1|  PREDICTED: putative phagocytic receptor 1b i...  58.2    2e-07   
ref|XP_007015826.1|  Endomembrane protein 70 protein family isofo...  58.2    2e-07   
gb|EPS73381.1|  hypothetical protein M569_01372                       58.2    2e-07   
gb|KJB55630.1|  hypothetical protein B456_009G086000                  57.8    2e-07   
ref|XP_004352299.1|  TM9 protein B                                    58.2    2e-07   
ref|XP_004504187.1|  PREDICTED: transmembrane 9 superfamily membe...  57.8    3e-07   
ref|XP_006307081.1|  hypothetical protein CARUB_v10008667mg           57.8    3e-07   
ref|XP_002939067.1|  PREDICTED: transmembrane 9 superfamily membe...  57.8    3e-07   
gb|KHG11801.1|  Putative phagocytic receptor 1b                       57.8    3e-07   
gb|KHN39489.1|  Putative phagocytic receptor 1b                       57.4    3e-07   
ref|XP_007509634.1|  predicted protein                                57.4    3e-07   
ref|XP_006417702.1|  hypothetical protein EUTSA_v10007170mg           57.4    3e-07   
ref|XP_004335868.1|  endomembrane protein EMP70 precursor isolog,...  57.4    3e-07   
ref|XP_004485475.1|  PREDICTED: transmembrane 9 superfamily membe...  57.4    4e-07   
ref|XP_004485474.1|  PREDICTED: transmembrane 9 superfamily membe...  57.4    4e-07   
ref|XP_010475983.1|  PREDICTED: transmembrane 9 superfamily membe...  57.4    4e-07   
ref|XP_003226712.1|  PREDICTED: transmembrane 9 superfamily member 1  57.0    5e-07   
emb|CDP05453.1|  unnamed protein product                              56.6    6e-07   
gb|KJB55631.1|  hypothetical protein B456_009G086000                  56.6    6e-07   
ref|XP_006036573.1|  PREDICTED: transmembrane 9 superfamily membe...  56.6    6e-07   
ref|XP_010246919.1|  PREDICTED: transmembrane 9 superfamily member 3  56.6    6e-07   
ref|XP_006259786.1|  PREDICTED: transmembrane 9 superfamily member 1  56.6    6e-07   
ref|XP_003629959.1|  Transmembrane 9 superfamily protein member       56.6    7e-07   
ref|XP_005770609.1|  hypothetical protein EMIHUDRAFT_196296           53.9    7e-07   
ref|XP_011399711.1|  Putative phagocytic receptor 1b                  56.2    8e-07   
ref|XP_008228600.1|  PREDICTED: putative phagocytic receptor 1b       56.2    8e-07   
ref|XP_010272575.1|  PREDICTED: transmembrane 9 superfamily membe...  56.2    8e-07   
ref|XP_010912524.1|  PREDICTED: transmembrane 9 superfamily membe...  56.2    8e-07   
ref|NP_001066292.1|  Os12g0175700                                     56.2    8e-07   
ref|XP_010271661.1|  PREDICTED: putative phagocytic receptor 1b       56.2    8e-07   
ref|XP_010912523.1|  PREDICTED: transmembrane 9 superfamily membe...  56.2    9e-07   
ref|XP_010912522.1|  PREDICTED: transmembrane 9 superfamily membe...  56.2    9e-07   
emb|CDP06928.1|  unnamed protein product                              55.8    1e-06   
ref|XP_005780441.1|  hypothetical protein EMIHUDRAFT_60194            53.9    1e-06   
gb|EMP30576.1|  Transmembrane 9 superfamily member 1                  55.8    1e-06   
gb|KDO50082.1|  hypothetical protein CISIN_1g012251mg                 55.5    1e-06   
emb|CDY44835.1|  BnaCnng11910D                                        53.1    1e-06   
ref|XP_006580221.1|  PREDICTED: transmembrane 9 superfamily membe...  55.8    1e-06   
ref|XP_003524235.1|  PREDICTED: transmembrane 9 superfamily membe...  55.8    1e-06   
ref|XP_011092338.1|  PREDICTED: transmembrane 9 superfamily membe...  55.8    1e-06   
ref|XP_004081008.1|  PREDICTED: transmembrane 9 superfamily member 1  55.8    1e-06   
emb|CBN81815.1|  Transmembrane 9 superfamily member 1                 55.8    1e-06   
ref|XP_003457937.2|  PREDICTED: transmembrane 9 superfamily membe...  55.8    1e-06   
ref|XP_010235535.1|  PREDICTED: transmembrane 9 superfamily membe...  55.5    1e-06   
ref|XP_006471014.1|  PREDICTED: transmembrane 9 superfamily membe...  55.5    1e-06   
ref|XP_006431823.1|  hypothetical protein CICLE_v10000670mg           55.5    1e-06   
ref|XP_011395771.1|  Transmembrane 9 superfamily member 3             55.5    1e-06   
ref|XP_002530674.1|  endomembrane protein emp70, putative             55.5    2e-06   
ref|XP_005092501.1|  PREDICTED: transmembrane 9 superfamily membe...  55.5    2e-06   
ref|XP_002412937.1|  endosomal membrane protein EMP70, putative       55.5    2e-06   
emb|CDQ70386.1|  unnamed protein product                              55.5    2e-06   
ref|XP_007255923.1|  PREDICTED: transmembrane 9 superfamily member 1  55.5    2e-06   
ref|XP_010884102.1|  PREDICTED: transmembrane 9 superfamily member 1  55.5    2e-06   
ref|XP_006643045.1|  PREDICTED: solute carrier family 22 member 1...  55.5    2e-06   
ref|XP_010686009.1|  PREDICTED: transmembrane 9 superfamily membe...  55.5    2e-06   
ref|XP_005186343.1|  PREDICTED: transmembrane 9 superfamily member 3  55.1    2e-06   
gb|KJB77693.1|  hypothetical protein B456_012G151500                  55.1    2e-06   
ref|XP_009390763.1|  PREDICTED: transmembrane 9 superfamily membe...  55.1    2e-06   
ref|XP_009602812.1|  PREDICTED: transmembrane 9 superfamily membe...  55.1    2e-06   
ref|XP_006349354.1|  PREDICTED: transmembrane 9 superfamily membe...  55.1    2e-06   
ref|XP_004230474.1|  PREDICTED: transmembrane 9 superfamily membe...  55.1    2e-06   
gb|KJB77692.1|  hypothetical protein B456_012G151500                  55.1    2e-06   
ref|XP_002304054.2|  hypothetical protein POPTR_0003s011001g          54.7    2e-06   
ref|XP_007208295.1|  hypothetical protein PRUPE_ppa003325mg           54.7    3e-06   
ref|XP_006384984.1|  endomembrane protein 70                          54.7    3e-06   
ref|XP_008783371.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
ref|XP_006339920.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
ref|XP_004248848.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
ref|XP_008456054.1|  PREDICTED: transmembrane 9 superfamily member 3  55.1    3e-06   
dbj|GAM27660.1|  hypothetical protein SAMD00019534_108360             54.7    3e-06   
ref|XP_011009384.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
ref|XP_002181450.1|  predicted protein                                54.7    3e-06   
ref|XP_005845268.1|  hypothetical protein CHLNCDRAFT_36511            54.7    3e-06   
ref|XP_007148532.1|  hypothetical protein PHAVU_006G216500g           54.7    3e-06   
gb|KHG16990.1|  Transmembrane 9 superfamily member 3                  53.9    3e-06   
ref|NP_001003550.1|  transmembrane 9 superfamily member 1             54.7    3e-06   
ref|XP_010553598.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
gb|EMT08384.1|  Transmembrane 9 superfamily member 3                  54.7    3e-06   
ref|XP_003592976.1|  Transmembrane 9 superfamily protein member       54.7    3e-06   
ref|XP_003577775.1|  PREDICTED: transmembrane 9 superfamily member 3  54.7    3e-06   
ref|XP_008838041.1|  PREDICTED: transmembrane 9 superfamily member 1  54.7    3e-06   
gb|KHG21692.1|  Transmembrane 9 superfamily member 3                  54.7    3e-06   
ref|XP_009776073.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
ref|XP_009796637.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
ref|XP_009600607.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
gb|KJB79238.1|  hypothetical protein B456_013G038900                  54.7    3e-06   
gb|AAX96186.1|  Endomembrane protein 70                               54.7    3e-06   
ref|XP_006662781.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
ref|NP_001065897.1|  Os11g0181100                                     54.7    3e-06   
ref|XP_010930775.1|  PREDICTED: transmembrane 9 superfamily member 1  54.7    3e-06   
ref|XP_011088889.1|  PREDICTED: transmembrane 9 superfamily membe...  54.3    3e-06   
ref|XP_006585219.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
ref|XP_008339497.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
ref|XP_003531298.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
tpg|DAA55531.1|  TPA: hypothetical protein ZEAMMB73_446969            54.7    3e-06   
ref|XP_002442907.1|  hypothetical protein SORBIDRAFT_08g004730        54.7    3e-06   
ref|XP_008662281.1|  PREDICTED: uncharacterized protein LOC100501...  54.7    3e-06   
ref|XP_009390071.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
ref|XP_009379854.1|  PREDICTED: transmembrane 9 superfamily membe...  54.7    3e-06   
ref|XP_003061693.1|  predicted protein                                54.7    3e-06   
ref|XP_009348753.1|  PREDICTED: transmembrane 9 superfamily membe...  54.3    3e-06   
ref|XP_004146261.1|  PREDICTED: transmembrane 9 superfamily membe...  54.3    3e-06   
ref|XP_003606114.1|  Transmembrane 9 superfamily member               54.3    4e-06   
gb|EMT15069.1|  Transmembrane 9 superfamily member 3                  54.3    4e-06   
dbj|BAJ96423.1|  predicted protein                                    54.3    4e-06   
dbj|BAJ86318.1|  predicted protein                                    54.3    4e-06   
ref|XP_010492170.1|  PREDICTED: transmembrane 9 superfamily membe...  54.3    4e-06   
gb|KGN57596.1|  hypothetical protein Csa_3G222780                     54.3    4e-06   
gb|ETE64264.1|  Transmembrane 9 superfamily member 1                  54.3    4e-06   
ref|XP_002269498.1|  PREDICTED: transmembrane 9 superfamily member 1  54.3    4e-06   
emb|CDY46193.1|  BnaA01g23150D                                        54.3    4e-06   
ref|XP_009144405.1|  PREDICTED: transmembrane 9 superfamily membe...  54.3    4e-06   
emb|CDX94774.1|  BnaC07g17830D                                        54.3    4e-06   
emb|CDY20974.1|  BnaA08g25510D                                        54.3    4e-06   
emb|CDY14555.1|  BnaC03g49040D                                        54.3    4e-06   
ref|XP_006417401.1|  hypothetical protein EUTSA_v10007167mg           54.3    4e-06   
emb|CDY19333.1|  BnaC05g08420D                                        54.3    4e-06   
gb|KFK43390.1|  hypothetical protein AALP_AA1G119800                  54.3    4e-06   
ref|XP_002889842.1|  hypothetical protein ARALYDRAFT_471233           54.3    4e-06   
ref|XP_010458475.1|  PREDICTED: transmembrane 9 superfamily membe...  54.3    4e-06   
ref|XP_010492178.1|  PREDICTED: transmembrane 9 superfamily membe...  54.3    4e-06   
ref|XP_006304923.1|  hypothetical protein CARUB_v10011995mg           54.3    4e-06   
ref|XP_009148436.1|  PREDICTED: transmembrane 9 superfamily membe...  54.3    4e-06   
emb|CDX97924.1|  BnaA06g06750D                                        54.3    4e-06   
ref|XP_006392092.1|  hypothetical protein EUTSA_v10023368mg           54.3    4e-06   
ref|XP_009104187.1|  PREDICTED: transmembrane 9 superfamily membe...  54.3    4e-06   
emb|CDY03772.1|  BnaC01g28890D                                        54.3    4e-06   
ref|XP_006859169.1|  hypothetical protein AMTR_s00070p00145350        54.3    4e-06   
emb|CDY34667.1|  BnaC08g42260D                                        54.3    4e-06   
ref|XP_011088887.1|  PREDICTED: transmembrane 9 superfamily membe...  54.3    4e-06   
ref|XP_010739917.1|  PREDICTED: transmembrane 9 superfamily membe...  54.3    4e-06   
gb|KJB12212.1|  hypothetical protein B456_002G006200                  54.3    5e-06   
ref|XP_008067922.1|  PREDICTED: transmembrane 9 superfamily member 1  54.3    5e-06   
ref|XP_010953066.1|  PREDICTED: transmembrane 9 superfamily membe...  53.9    5e-06   
emb|CDO97576.1|  unnamed protein product                              53.9    5e-06   
ref|XP_010953065.1|  PREDICTED: transmembrane 9 superfamily membe...  53.9    5e-06   
ref|XP_010101151.1|  Transmembrane 9 superfamily member 3             53.9    5e-06   
ref|XP_008436895.1|  PREDICTED: transmembrane 9 superfamily member 1  53.9    5e-06   
ref|XP_007548006.1|  PREDICTED: transmembrane 9 superfamily member 1  53.9    5e-06   
ref|XP_005803703.1|  PREDICTED: transmembrane 9 superfamily membe...  53.9    5e-06   
gb|AAB65482.1|  endomembrane protein EMP70 precusor isolog; 68664...  53.9    5e-06   
ref|NP_563881.1|  transmembrane nine 1                                53.9    5e-06   
ref|XP_002960054.1|  hypothetical protein SELMODRAFT_163520           53.9    5e-06   
ref|XP_002984084.1|  hypothetical protein SELMODRAFT_156331           53.9    5e-06   
ref|XP_007536361.1|  PREDICTED: transmembrane 9 superfamily membe...  54.3    5e-06   
gb|KGN64924.1|  hypothetical protein Csa_1G162600                     53.1    5e-06   
ref|XP_010533958.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  53.9    5e-06   
ref|XP_010994078.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  53.9    5e-06   
ref|XP_008461519.1|  PREDICTED: putative phagocytic receptor 1b i...  53.9    5e-06   
ref|XP_006172880.1|  PREDICTED: charged multivesicular body prote...  53.9    5e-06   
ref|XP_006217338.1|  PREDICTED: charged multivesicular body prote...  53.9    5e-06   
ref|XP_004694659.1|  PREDICTED: transmembrane 9 superfamily member 1  53.9    5e-06   
gb|EEE57172.1|  hypothetical protein OsJ_07106                        53.9    5e-06   
ref|XP_010779259.1|  PREDICTED: transmembrane 9 superfamily member 1  53.9    5e-06   
ref|XP_003967994.1|  PREDICTED: transmembrane 9 superfamily membe...  53.9    5e-06   
ref|XP_004172236.1|  PREDICTED: LOW QUALITY PROTEIN: putative pha...  53.1    5e-06   
gb|AFW71773.1|  hypothetical protein ZEAMMB73_948581                  53.5    5e-06   
ref|NP_001047104.1|  Os02g0552000                                     53.9    6e-06   
emb|CDY20592.1|  BnaC08g14660D                                        53.9    6e-06   
ref|XP_004698552.1|  PREDICTED: transmembrane 9 superfamily member 1  53.9    6e-06   
ref|XP_004139482.1|  PREDICTED: putative phagocytic receptor 1b-like  53.9    6e-06   
ref|XP_009355251.1|  PREDICTED: transmembrane 9 superfamily membe...  53.9    6e-06   
ref|XP_008461493.1|  PREDICTED: putative phagocytic receptor 1b i...  53.9    6e-06   
ref|XP_010547447.1|  PREDICTED: transmembrane 9 superfamily membe...  53.5    6e-06   
ref|XP_008681382.1|  PREDICTED: uncharacterized protein LOC100272...  53.5    6e-06   
ref|XP_008681381.1|  PREDICTED: uncharacterized protein LOC100272...  53.5    6e-06   
ref|XP_011028284.1|  PREDICTED: transmembrane 9 superfamily member 1  53.5    6e-06   
ref|XP_005822074.1|  hypothetical protein GUITHDRAFT_166088           53.5    7e-06   
gb|KIY96549.1|  Putative phagocytic receptor 1b                       53.1    7e-06   
emb|CCI39562.1|  unnamed protein product                              53.5    7e-06   
ref|XP_008895869.1|  hypothetical protein, variant 3                  53.5    7e-06   
gb|ETK76718.1|  hypothetical protein, variant 3                       53.5    7e-06   
gb|ETI36486.1|  hypothetical protein, variant 2                       53.5    7e-06   
ref|XP_008895867.1|  hypothetical protein PPTG_03848                  53.5    7e-06   
gb|ETK76715.1|  hypothetical protein L915_16929                       53.5    7e-06   
gb|ETI36484.1|  hypothetical protein F443_17408                       53.5    7e-06   
gb|EPY89936.1|  importin-4                                            53.9    8e-06   
ref|XP_002903970.1|  endomembrane protein 70-like protein, putative   53.5    8e-06   
ref|XP_007015827.1|  Endomembrane protein 70 protein family isofo...  53.5    8e-06   
ref|XP_002449107.1|  hypothetical protein SORBIDRAFT_05g005240        53.5    8e-06   
ref|XP_005824782.1|  hypothetical protein GUITHDRAFT_158562           53.1    8e-06   
ref|XP_004978867.1|  PREDICTED: transmembrane 9 superfamily membe...  53.1    8e-06   
gb|KHN75714.1|  Transmembrane 9 superfamily member 3                  53.1    8e-06   
ref|XP_004977232.1|  PREDICTED: transmembrane 9 superfamily membe...  53.1    8e-06   
gb|EFA76586.1|  TM9 protein B                                         53.1    9e-06   
ref|XP_005645983.1|  hypothetical protein COCSUDRAFT_53991            53.1    9e-06   
gb|KCW57093.1|  hypothetical protein EUGRSUZ_I02743                   53.1    1e-05   
emb|CAN77106.1|  hypothetical protein VITISV_037096                   53.1    1e-05   
ref|XP_010682931.1|  PREDICTED: transmembrane 9 superfamily member 1  53.1    1e-05   
ref|XP_003755940.1|  PREDICTED: transmembrane 9 superfamily member 1  53.1    1e-05   
emb|CDY34861.1|  BnaA09g47870D                                        53.1    1e-05   
ref|XP_010271660.1|  PREDICTED: putative phagocytic receptor 1b       53.1    1e-05   
ref|XP_004952828.1|  PREDICTED: transmembrane 9 superfamily membe...  53.1    1e-05   
gb|EYU26707.1|  hypothetical protein MIMGU_mgv1a002565mg              53.1    1e-05   
ref|XP_009524748.1|  hypothetical protein PHYSODRAFT_299515           53.1    1e-05   
ref|XP_010665394.1|  PREDICTED: transmembrane 9 superfamily member 1  53.1    1e-05   
ref|XP_001380199.1|  PREDICTED: transmembrane 9 superfamily membe...  53.1    1e-05   
ref|XP_010030126.1|  PREDICTED: transmembrane 9 superfamily member 3  53.1    1e-05   
gb|KJB47460.1|  hypothetical protein B456_008G027700                  52.8    1e-05   
gb|KJB47461.1|  hypothetical protein B456_008G027700                  52.8    1e-05   
gb|KFK40744.1|  hypothetical protein AALP_AA2G035500                  52.8    1e-05   
gb|KJB47458.1|  hypothetical protein B456_008G027700                  52.8    1e-05   
ref|XP_002178644.1|  predicted protein                                52.8    1e-05   
gb|KHG27380.1|  Tm9sf3                                                52.8    1e-05   
ref|XP_004661882.1|  PREDICTED: transmembrane 9 superfamily member 1  52.8    1e-05   
emb|CCA19624.1|  endomembrane protein 70like protein putative         52.8    1e-05   
gb|KDP38816.1|  hypothetical protein JCGZ_04973                       52.8    1e-05   
ref|XP_002956625.1|  hypothetical protein VOLCADRAFT_110022           52.8    1e-05   
ref|XP_001689987.1|  EMP/nonaspanin domain family protein             52.8    1e-05   
ref|XP_011155183.1|  PREDICTED: transmembrane 9 superfamily member 3  52.8    1e-05   
ref|XP_002452255.1|  hypothetical protein SORBIDRAFT_04g022500        52.8    1e-05   
ref|XP_010910845.1|  PREDICTED: transmembrane 9 superfamily membe...  52.8    1e-05   
gb|AGE46034.1|  putative transmembrane 9 superfamily member 3 pro...  52.8    1e-05   
ref|XP_008305730.1|  PREDICTED: transmembrane 9 superfamily member 1  52.8    1e-05   



>gb|KJB15311.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=540

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCS  65



>gb|KJB15313.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=560

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCS  65



>gb|KJB15310.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
 gb|KJB15312.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=594

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCS  65



>ref|XP_007210263.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
 ref|XP_008240392.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
 gb|EMJ11462.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
Length=593

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   RSDASDHRYKEGDLVPLYANKVGPFHNPSETYRYFDLPFCS  65



>gb|KJB60875.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=549

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   RSDASDHRYKDGDAVPLYANKVGPFHNPSETYRYFDLPFCS  65



>emb|CDY03085.1| BnaC07g21420D [Brassica napus]
Length=535

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFC  62



>gb|KJB60874.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=594

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   RSDASDHRYKDGDAVPLYANKVGPFHNPSETYRYFDLPFCS  65



>ref|XP_010244840.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
 ref|XP_010244916.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHRYKAGDPVPLYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_007158822.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
 gb|ESW30816.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
Length=592

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEGDHVPLYANKVGPFHNPSETYRYFDLPFC  62



>emb|CDY15803.1| BnaC02g34220D [Brassica napus]
Length=592

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFC  62



>gb|KHG04463.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=629

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  60   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCS  100



>ref|XP_002890068.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66327.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=532

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_010527833.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=593

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  24   RSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFC  63



>ref|XP_007045410.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
 gb|EOY01242.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
Length=594

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   RSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCS  65



>ref|XP_010276303.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHRYKAGDPVPLYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_007045409.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
 gb|EOY01241.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
Length=594

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   RSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCS  65



>gb|AAF63170.1|AC010657_6 T5E21.15 [Arabidopsis thaliana]
Length=546

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_010554368.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=592

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_006395825.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
 gb|ACQ90591.1| putative transmembrane transporter [Eutrema halophilum]
 gb|ESQ33111.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
Length=592

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFC  62



>gb|EPS59962.1| hypothetical protein M569_14842, partial [Genlisea aurea]
Length=510

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDAS+HRY QGD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  13   RSDASNHRYNQGDTVPLYANKVGPFHNPSETYRYFDLPFCS  53



>ref|XP_002521898.1| transporter, putative [Ricinus communis]
 gb|EEF40534.1| transporter, putative [Ricinus communis]
Length=525

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  22   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFC  61



>ref|NP_172919.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q940S0.1|TMN2_ARATH RecName: Full=Transmembrane 9 superfamily member 2; AltName: 
Full=Endomembrane protein 8; AltName: Full=Transmembrane nine 
protein 2; Short=AtTMN2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96649.1| T5E21.14/T5E21.14 [Arabidopsis thaliana]
 gb|AAM16222.1| At1g14670/T5E21.14 [Arabidopsis thaliana]
 gb|AEE29200.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_006448060.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 gb|ESR61300.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=545

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHRYKVGDVVPLYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_011011376.1| PREDICTED: transmembrane 9 superfamily member 3-like [Populus 
euphratica]
Length=542

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK GD+V LY NKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCS  63



>emb|CDY41095.1| BnaC05g10860D [Brassica napus]
Length=589

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLAFC  62



>ref|XP_010920044.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X4 [Elaeis guineensis]
Length=516

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            ++D SDHRYK+GD V LYANKVGPFHNPSETY Y+DL FCS
Sbjct  20   KADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCS  60



>ref|NP_178306.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9ZPS7.1|TMN3_ARATH RecName: Full=Transmembrane 9 superfamily member 3; AltName: 
Full=Endomembrane protein 9; AltName: Full=Transmembrane nine 
protein 3; Short=AtTMN3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD20090.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AAL24256.1| At2g01970/F14H20.4 [Arabidopsis thaliana]
 dbj|BAE98629.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AEC05528.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_010920043.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X3 [Elaeis guineensis]
Length=524

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            ++D SDHRYK+GD V LYANKVGPFHNPSETY Y+DL FCS
Sbjct  20   KADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCS  60



>ref|XP_008393472.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=593

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   RSDGSDHRYKEGDLVPLYANKVGPFHNPSETYRYFDLPFCS  65



>ref|XP_003531127.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=604

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  35   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFC  74



>ref|XP_011038406.1| PREDICTED: transmembrane 9 superfamily member 3-like [Populus 
euphratica]
Length=592

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK GD+V LY NKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_006372422.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP50219.1| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK GD+V LY NKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_006416990.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
 gb|ESQ35343.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
Length=592

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_007152616.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
 gb|ESW24610.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
Length=594

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSD+SDHRYKQGD V LYANKVGPFHNPSETY Y DL FC
Sbjct  26   RSDSSDHRYKQGDIVPLYANKVGPFHNPSETYRYFDLPFC  65



>gb|KHN28892.1| Putative phagocytic receptor 1b [Glycine soja]
Length=604

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  35   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFC  74



>ref|XP_002876790.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53049.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
Length=592

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_003524839.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
 gb|KHN25962.1| Putative phagocytic receptor 1b [Glycine soja]
Length=601

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  32   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFC  71



>ref|XP_009355975.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=593

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   RSDGSDHRYKEGDFVPLYANKVGPFHNPSETYRYFDLPFCS  65



>ref|XP_008389133.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=591

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRY +GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  22   RSDASDHRYNEGDAVPLYANKVGPFHNPSETYRYFDLPFCS  62



>ref|XP_006448061.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 ref|XP_006492286.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492287.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Citrus 
sinensis]
 gb|ESR61301.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=593

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHRYKVGDVVPLYANKVGPFHNPSETYRYFDLPFCS  63



>gb|KHG00678.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=528

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   RSDASDHRYKDGDAVPLYANKVGPFHNPSETYRYFDLPFCS  65



>ref|XP_002521900.1| transporter, putative [Ricinus communis]
 gb|EEF40536.1| transporter, putative [Ricinus communis]
Length=588

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  25   RSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFC  64



>ref|XP_008340538.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=592

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRY +GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHRYNEGDAVPLYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_010920042.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Elaeis guineensis]
Length=582

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            ++D SDHRYK+GD V LYANKVGPFHNPSETY Y+DL FCS
Sbjct  20   KADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCS  60



>ref|XP_008375035.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=611

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  43   RSDGSDHRYKEGDFVPLYANKVGPFHNPSETYRYFDLPFCS  83



>gb|AHA84153.1| phagocytic receptor 1b [Phaseolus vulgaris]
Length=588

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSD+SDHRYKQGD V LYANKVGPFHNPSETY Y DL FC
Sbjct  26   RSDSSDHRYKQGDIVPLYANKVGPFHNPSETYRYFDLPFC  65



>emb|CDY56297.1| BnaC09g52300D [Brassica napus]
Length=535

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            R DASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RPDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFC  62



>gb|AAF79216.1|AC006917_1 F10B6.2 [Arabidopsis thaliana]
Length=260

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_008220963.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
Length=591

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRY  GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  22   RSDASDHRYNDGDAVPLYANKVGPFHNPSETYRYFDLPFCS  62



>ref|XP_009110524.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  20   RSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFC  59



>gb|KDP38191.1| hypothetical protein JCGZ_04834 [Jatropha curcas]
Length=591

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  22   RSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFC  61



>ref|XP_007225615.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
 gb|EMJ26814.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
Length=591

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRY  GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  22   RSDASDHRYNDGDAVPLYANKVGPFHNPSETYRYFDLPFCS  62



>ref|XP_010920041.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=588

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            ++D SDHRYK+GD V LYANKVGPFHNPSETY Y+DL FCS
Sbjct  20   KADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCS  60



>gb|KHN43674.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  20   RSDPSDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFC  59



>ref|XP_009351612.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=592

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRY +GD V LY+NKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHRYNEGDAVPLYSNKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_011099916.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099917.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099918.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099919.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
Length=592

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDH+YK GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHKYKIGDAVPLYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_009380058.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            SDASDHRYKQGD V LYANKVGPFHNPSETY Y DL FC
Sbjct  20   SDASDHRYKQGDPVPLYANKVGPFHNPSETYRYFDLPFC  58



>emb|CDY52035.1| BnaA08g31480D [Brassica napus]
Length=589

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  20   RSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFC  59



>gb|KDP38192.1| hypothetical protein JCGZ_04835 [Jatropha curcas]
Length=591

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  22   RSDGSDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFC  61



>ref|XP_010528590.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=595

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDHRY+ GD+V LYANKVGPFHNPSETY Y DL FCS
Sbjct  26   RSDGSDHRYRAGDDVPLYANKVGPFHNPSETYRYFDLPFCS  66



>emb|CDY52038.1| BnaA08g31510D [Brassica napus]
Length=480

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  20   RSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFC  59



>gb|KFK33411.1| hypothetical protein AALP_AA5G009400 [Arabis alpina]
Length=592

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+G+ V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEGETVPLYANKVGPFHNPSETYRYFDLPFC  62



>emb|CDX84018.1| BnaC08g16270D [Brassica napus]
Length=589

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  20   RSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFC  59



>ref|XP_008788644.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008788651.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=588

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DL FCS
Sbjct  21   ADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCS  60



>ref|XP_009785097.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=596

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD+SDH+YK G+EV LYANKVGPFHNPSETY Y DL FCS
Sbjct  27   RSDSSDHKYKNGEEVPLYANKVGPFHNPSETYRYFDLPFCS  67



>ref|XP_010910475.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X3 [Elaeis guineensis]
Length=515

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DL FCS
Sbjct  23   ADGSDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCS  62



>ref|XP_010440842.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Camelina 
sativa]
Length=386

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DL FCS
Sbjct  19   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCS  58



>ref|XP_006372420.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
 gb|ERP50217.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
Length=526

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK G++V LY NKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCS  63



>gb|KHN24548.1| Putative phagocytic receptor 1b [Glycine soja]
Length=586

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  18   RSDPSDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFC  57



>ref|XP_009631354.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
 ref|XP_009631355.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=596

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD+SDH+YK G+EV LYANKVGPFHNPSETY Y DL FCS
Sbjct  27   RSDSSDHKYKNGEEVPLYANKVGPFHNPSETYRYFDLPFCS  67



>ref|XP_003548324.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=587

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  19   RSDPSDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFC  58



>ref|XP_006352389.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006352390.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Solanum 
tuberosum]
Length=596

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD+SDH+YK G+EV LYANKVGPFHNPSETY Y DL FCS
Sbjct  27   RSDSSDHKYKSGEEVPLYANKVGPFHNPSETYRYFDLPFCS  67



>ref|XP_010910473.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=590

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DL FCS
Sbjct  23   ADGSDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCS  62



>gb|KJB08471.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=531

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RS ASDHRYK GDEV LYANKVGP+HNPSETY Y D  FCS
Sbjct  23   RSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCS  63



>ref|NP_001148367.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACG31130.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN29105.1| unknown [Zea mays]
 gb|AFW57246.1| putative Transmembrane 9 family protein member 1 [Zea mays]
Length=589

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            R+D SDH+YK+GD V LYANKVGPFHNPSETY Y+DL FC+
Sbjct  22   RADGSDHKYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCA  62



>ref|XP_004250237.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
 ref|XP_010312729.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=596

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD+SDH+YK G+EV LYANKVGPFHNPSETY Y DL FCS
Sbjct  27   RSDSSDHKYKSGEEVPLYANKVGPFHNPSETYRYFDLPFCS  67



>ref|XP_010910474.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Elaeis guineensis]
Length=554

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DL FCS
Sbjct  23   ADGSDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCS  62



>ref|XP_010069472.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW57835.1| hypothetical protein EUGRSUZ_H00588 [Eucalyptus grandis]
Length=590

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSD SDHRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  22   RSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFC  61



>ref|XP_008461818.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Cucumis 
melo]
Length=591

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSD SDHRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_011038404.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
 ref|XP_011038405.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
Length=592

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK G++V LY NKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_006372421.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
 gb|ERP50218.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
Length=592

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK G++V LY NKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCS  63



>emb|CDY47549.1| BnaA08g07380D [Brassica napus]
Length=592

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +SD SDHRYK GD+V LYANKVGPFHNPSETY Y DL FCS
Sbjct  23   KSDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_006854108.1| hypothetical protein AMTR_s00048p00146310 [Amborella trichopoda]
 gb|ERN15575.1| hypothetical protein AMTR_s00048p00146310 [Amborella trichopoda]
Length=631

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D SDH+YKQGD V LYANKVGPFHNPSETY Y+DL FCS
Sbjct  63   ADGSDHKYKQGDRVPLYANKVGPFHNPSETYRYYDLPFCS  102



>ref|XP_010523531.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=584

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+ D V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEADSVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_010523409.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
 ref|XP_010523411.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523412.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010523413.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Tarenaya 
hassleriana]
Length=592

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+ D V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEADSVPLYANKVGPFHNPSETYRYFDLPFC  62



>gb|KFK43715.1| hypothetical protein AALP_AA1G163400 [Arabis alpina]
Length=592

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+ D V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKEADNVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_004137376.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
 ref|XP_004171887.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
 gb|KGN63933.1| hypothetical protein Csa_1G029600 [Cucumis sativus]
Length=591

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSD SDHRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_006431398.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
 gb|ESR44638.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
Length=545

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD+SDHR+K GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDSSDHRFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_004972769.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Setaria 
italica]
Length=589

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            R+D SDH+YK+GD V LYANKVGPFHNPSETY Y+DL FC+
Sbjct  22   RADGSDHKYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCA  62



>gb|KJB08472.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=592

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RS ASDHRYK GDEV LYANKVGP+HNPSETY Y D  FCS
Sbjct  23   RSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCS  63



>ref|XP_004972768.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Setaria 
italica]
Length=768

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            R+D SDH+YK+GD V LYANKVGPFHNPSETY Y+DL FC+
Sbjct  201  RADGSDHKYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCA  241



>ref|XP_010440841.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Camelina 
sativa]
Length=587

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DL FCS
Sbjct  19   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCS  58



>ref|XP_010691703.1| PREDICTED: transmembrane 9 superfamily member 2 [Beta vulgaris 
subsp. vulgaris]
Length=592

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK G+ V LYANKVGPFHNPSETY Y DL FC+
Sbjct  23   RSDASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCA  63



>emb|CDY62621.1| BnaC08g46810D [Brassica napus]
Length=592

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DL FCS
Sbjct  24   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_010450487.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=593

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCS  64



>ref|NP_198547.3| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9FHT4.1|TMN4_ARATH RecName: Full=Transmembrane 9 superfamily member 4; AltName: 
Full=Endomembrane protein 10; AltName: Full=Transmembrane nine 
protein 4; Short=AtTMN4; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09103.1| endosomal protein-like [Arabidopsis thaliana]
 dbj|BAE99006.1| multispanning membrane protein - like [Arabidopsis thaliana]
 gb|AED94164.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=593

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCS  64



>ref|XP_002870515.1| transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46774.1| transporter [Arabidopsis lyrata subsp. lyrata]
Length=593

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCS  64



>ref|XP_008813153.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=590

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DL FCS
Sbjct  23   ADESDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCS  62



>ref|XP_006470811.1| PREDICTED: putative phagocytic receptor 1b-like [Citrus sinensis]
Length=593

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD+SDHR+K GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDSSDHRFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_006431397.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
 gb|ESR44637.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
Length=593

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD+SDHR+K GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDSSDHRFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_006405901.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 ref|XP_006405902.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47354.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47355.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
Length=595

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DL FCS
Sbjct  27   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCS  66



>ref|XP_008356712.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=301

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   RSDGSDHRYKEGDFVPLYANKVGPFHNPSETYRYFDLPFCS  65



>ref|XP_004299493.1| PREDICTED: transmembrane 9 superfamily member 3-like [Fragaria 
vesca subsp. vesca]
Length=599

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDAS+HRYK+GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  32   SDASNHRYKEGDVVPLYANKVGPFHNPSETYRYFDLPFCS  71



>gb|EYU30892.1| hypothetical protein MIMGU_mgv1a003326mg [Erythranthe guttata]
Length=592

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDH++K GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHKFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_009108077.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=592

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DL FCS
Sbjct  24   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCS  63



>gb|AES99151.2| transmembrane 9 family protein [Medicago truncatula]
Length=591

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDASDHRYK+GD V  YANKVGPFHNPSETY Y DL FCS
Sbjct  22   SDASDHRYKEGDFVPFYANKVGPFHNPSETYRYFDLPFCS  61



>ref|XP_010476529.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDAS+HRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASNHRYKDGDTVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_010496367.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDAS+HRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASNHRYKDGDTVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|NP_001175393.1| Os08g0162000 [Oryza sativa Japonica Group]
 dbj|BAH94121.1| Os08g0162000 [Oryza sativa Japonica Group]
Length=68

 Score = 72.0 bits (175),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            R+D SDHRYK GD V LYANKVGPFHNPSETY Y+DL FC+
Sbjct  25   RADGSDHRYKDGDYVPLYANKVGPFHNPSETYRYYDLPFCA  65



>ref|XP_010458976.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDAS+HRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASNHRYKDGDTVPLYANKVGPFHNPSETYRYFDLPFC  62



>gb|EYU30878.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
 gb|EYU30879.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
Length=592

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDH+YK GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDGSDHKYKVGDPVPLYANKVGPFHNPSETYRYFDLPFCS  63



>gb|KJB08470.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=592

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RS ASDHRYK GDEV LYANKVGP+HNPSETY Y D  FCS
Sbjct  23   RSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCS  63



>gb|EEC82941.1| hypothetical protein OsI_27915 [Oryza sativa Indica Group]
Length=592

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            R+D SDHRYK GD V LYANKVGPFHNPSETY Y+DL FC+
Sbjct  25   RADGSDHRYKDGDYVPLYANKVGPFHNPSETYRYYDLPFCA  65



>ref|XP_003573450.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=588

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DL FC+
Sbjct  22   ADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCA  61



>gb|KHG09925.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RS ASDHRYK GDEV LYANKVGP+HNPSETY Y D  FCS
Sbjct  23   RSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCS  63



>ref|XP_006292411.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
 gb|EOA25309.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
Length=592

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK  D V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKDSDSVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_010513951.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
 ref|XP_010424990.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK  D V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKDSDSVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_010502204.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK  D V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKDSDSVPLYANKVGPFHNPSETYRYFDLPFC  62



>emb|CDX81659.1| BnaC08g39420D [Brassica napus]
Length=589

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSD+SDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  20   RSDSSDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFC  59



>ref|XP_009388099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388100.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=586

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D SDHRYK+GD V LYANKVGPFHNPSETY ++DL FCS
Sbjct  19   ADGSDHRYKEGDHVPLYANKVGPFHNPSETYRFYDLPFCS  58



>ref|XP_010691704.1| PREDICTED: transmembrane 9 superfamily member 3-like [Beta vulgaris 
subsp. vulgaris]
Length=593

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK G+ V LYANKVGPFHNPSETY Y DL FC
Sbjct  24   RSDASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFC  63



>ref|XP_011463508.1| PREDICTED: transmembrane 9 superfamily member 2 [Fragaria vesca 
subsp. vesca]
Length=592

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRY + D V LYANKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDHRYNENDVVPLYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_010105529.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXC05024.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=591

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDHRYK G+ V LYANKVGPFHNPSETY Y DL FCS
Sbjct  22   RSDDSDHRYKDGNPVPLYANKVGPFHNPSETYRYFDLPFCS  62



>gb|EMT19161.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=590

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DL FC+
Sbjct  24   ADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCA  63



>ref|XP_010445554.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=400

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DL FCS
Sbjct  19   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCS  58



>ref|XP_003616193.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
Length=682

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDASDHRYK+GD V  YANKVGPFHNPSETY Y DL FCS
Sbjct  22   SDASDHRYKEGDFVPFYANKVGPFHNPSETYRYFDLPFCS  61



>ref|XP_002521899.1| transporter, putative [Ricinus communis]
 gb|EEF40535.1| transporter, putative [Ricinus communis]
Length=592

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSD SDHRYK+GD V  YANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDTSDHRYKEGDPVPFYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_006307070.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
 gb|EOA39968.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
Length=592

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+ D V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYKERDTVPLYANKVGPFHNPSETYRYFDLPFC  62



>dbj|BAJ89640.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT32275.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=593

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SD SDHRYK GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   SDGSDHRYKLGDPVPLYANKVGPFHNPSETYRYFDLPFCS  64



>ref|XP_010066537.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW64446.1| hypothetical protein EUGRSUZ_G02064 [Eucalyptus grandis]
Length=598

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASDHRYK G+ V LYANKVGPFHNPSETY + DL FCS
Sbjct  29   RSDASDHRYKDGEVVPLYANKVGPFHNPSETYRFFDLPFCS  69



>ref|XP_011005915.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005916.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDAS+HRYK GD V LY NKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASNHRYKVGDGVPLYVNKVGPFHNPSETYRYFDLPFCS  63



>gb|EEE68090.1| hypothetical protein OsJ_26137 [Oryza sativa Japonica Group]
Length=864

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            R+D SDHRYK GD V LYANKVGPFHNPSETY Y+DL FC+
Sbjct  25   RADGSDHRYKDGDYVPLYANKVGPFHNPSETYRYYDLPFCA  65



>ref|XP_009404153.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            S+ASDHRYKQGD V LYANKVGPFHNPSETY + DL FC
Sbjct  20   SEASDHRYKQGDPVPLYANKVGPFHNPSETYRFFDLPFC  58



>ref|XP_009387842.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=597

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDAS+HRYK GD V LY NKVGPFHNPSETY Y DL FC+
Sbjct  29   RSDASNHRYKTGDHVPLYVNKVGPFHNPSETYRYFDLPFCT  69



>gb|KHN41041.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDASDHRY +GD V  YANKVGPFHNPSETY Y DL FCS
Sbjct  20   SDASDHRYMKGDSVPFYANKVGPFHNPSETYRYFDLPFCS  59



>ref|XP_003518365.2| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Glycine 
max]
Length=592

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDASDHRY +GD V  YANKVGPFHNPSETY Y DL FCS
Sbjct  24   SDASDHRYMKGDSVPFYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_006575472.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Glycine 
max]
Length=594

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDASDHRY +GD V  YANKVGPFHNPSETY Y DL FCS
Sbjct  24   SDASDHRYMKGDSVPFYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_004504610.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRY  GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   RSDASDHRYGDGDPVPLYANKVGPFHNPSETYRYLDLPFC  62



>emb|CDP01680.1| unnamed protein product [Coffea canephora]
Length=594

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDH+YK  D+V LYANKVGPFHNPSETY Y DL FC
Sbjct  25   RSDASDHKYKVSDQVPLYANKVGPFHNPSETYRYFDLPFC  64



>dbj|BAJ89513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D SDHRYK GD V LYANK+GPFHNPSETY Y+DL FC+
Sbjct  24   ADGSDHRYKAGDRVPLYANKIGPFHNPSETYRYYDLSFCA  63



>ref|XP_008789222.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789223.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789224.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789225.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789226.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=595

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +DASDHRYK G+ V LYANKVGPFHNPSETY Y DL FCS
Sbjct  27   ADASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCS  66



>ref|XP_007031333.1| Endomembrane protein 70 protein family [Theobroma cacao]
 gb|EOY02259.1| Endomembrane protein 70 protein family [Theobroma cacao]
Length=561

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RS ASDHRYK G EV LYANKVGPFHNPSETY Y D  FCS
Sbjct  23   RSSASDHRYKAGAEVPLYANKVGPFHNPSETYRYFDFPFCS  63



>ref|XP_006346764.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=598

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDH+YK GD+V LYANKVGPFHNPSETY + DL FC+
Sbjct  29   RSDGSDHKYKSGDQVPLYANKVGPFHNPSETYRFFDLPFCT  69



>gb|EMS60954.1| Putative phagocytic receptor 1b [Triticum urartu]
Length=590

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D SDH+YK+GD V LYANKVGPFHNPSETY Y+DL FC+
Sbjct  24   ADGSDHKYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCA  63



>ref|XP_004236681.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=598

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDH+YK GD+V LYANKVGPFHNPSETY + DL FC+
Sbjct  29   RSDGSDHKYKSGDQVPLYANKVGPFHNPSETYRFFDLPFCT  69



>ref|XP_006365862.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=588

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDH+YK GD+V +YANKVGPFHNPSETY + DL FC+
Sbjct  19   RSDGSDHKYKAGDQVTMYANKVGPFHNPSETYRFFDLPFCA  59



>ref|XP_008462539.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Cucumis 
melo]
Length=601

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            SD SDHRYK GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  34   SDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFC  72



>ref|XP_004239834.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=597

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDH+YK GD+V +YANKVGPFHNPSETY + DL FC+
Sbjct  28   RSDGSDHKYKAGDQVTMYANKVGPFHNPSETYRFFDLPFCA  68



>ref|XP_009616336.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=593

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDH+YK GD V LYANKVGPFHNPSETY + DL FC+
Sbjct  24   RSDGSDHKYKAGDSVPLYANKVGPFHNPSETYRFFDLPFCA  64



>ref|XP_007141945.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
 gb|ESW13939.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
Length=596

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDA+DHRY +GD V  YANKVGPFHNPSETY Y DL FCS
Sbjct  28   SDAADHRYNKGDSVPFYANKVGPFHNPSETYKYFDLPFCS  67



>ref|XP_009419338.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=593

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDASDHRYK+ D V LYANKVGPFHNPSETY Y DL FC+
Sbjct  26   SDASDHRYKKRDSVPLYANKVGPFHNPSETYRYFDLPFCA  65



>ref|XP_009784369.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=595

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  194  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            DASDHRYK+GD V LYANKVGPFHNPSE+Y Y+DL FC
Sbjct  26   DASDHRYKRGDPVPLYANKVGPFHNPSESYRYYDLPFC  63



>ref|XP_008356702.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
 ref|XP_008356703.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
 ref|XP_008356704.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
 ref|XP_008356705.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
Length=433

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDHRYK+GD V LYANKVGPFHNPSE Y Y DL FCS
Sbjct  25   RSDGSDHRYKEGDFVPLYANKVGPFHNPSEAYGYFDLPFCS  65



>ref|XP_010435562.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=589

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SD SDHRYK  D+V LYANKVGPFHNPSETY Y DL FCS
Sbjct  21   SDGSDHRYKVSDDVPLYANKVGPFHNPSETYRYFDLPFCS  60



>ref|XP_006283389.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 ref|XP_006283390.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16287.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16288.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
Length=590

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SD SDHRY  GD+V LYANKVGPFHNPSETY Y DL FCS
Sbjct  22   SDGSDHRYMVGDDVPLYANKVGPFHNPSETYRYFDLPFCS  61



>ref|XP_004515238.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSD+SDHR+K+GD V L+ANKVGPFHNPSETY Y DL FC
Sbjct  24   RSDSSDHRFKEGDLVPLFANKVGPFHNPSETYRYFDLPFC  63



>ref|XP_010917284.1| PREDICTED: transmembrane 9 superfamily member 2-like [Elaeis 
guineensis]
Length=596

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +DASDHRYK G+ V LYANKVGPFHNPSETY Y DL FCS
Sbjct  28   ADASDHRYKAGEPVPLYANKVGPFHNPSETYRYFDLPFCS  67



>ref|XP_009774478.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDH+YK GD V LYANKVGPFHNPSETY + DL FC+
Sbjct  24   RSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRFFDLPFCA  64



>ref|XP_011005913.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005914.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASD+RYK G++V LY NKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDNRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_002305925.2| endomembrane protein 70 [Populus trichocarpa]
 gb|EEE86436.2| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDASD+RYK G++V LY NKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASDNRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_009389646.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=599

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDASDHRYK GD V LY NKVGPFHNPSETY Y DL FC+
Sbjct  32   SDASDHRYKTGDHVPLYVNKVGPFHNPSETYRYFDLPFCT  71



>ref|XP_008356706.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Malus domestica]
Length=421

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDHRYK+GD V LYANKVGPFHNPSE Y Y DL FCS
Sbjct  25   RSDGSDHRYKEGDFVPLYANKVGPFHNPSEAYGYFDLPFCS  65



>gb|KHG03505.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RS ASDHRY  GDEV LYANKVGPFHNPSETY + D  FCS
Sbjct  23   RSSASDHRYTAGDEVPLYANKVGPFHNPSETYRFFDFPFCS  63



>ref|XP_003544357.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=593

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDASDHRY +GD V  YANKVGPFHNPSETY Y DL FCS
Sbjct  24   SDASDHRYMKGDFVPFYANKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_009110529.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RS ASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  20   RSYASDHRYKEGDIVLLYANKVGPFHNPSETYRYFDLPFC  59



>ref|XP_002285238.1| PREDICTED: transmembrane 9 superfamily member 2 [Vitis vinifera]
 emb|CBI26762.3| unnamed protein product [Vitis vinifera]
Length=591

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDAS HRYK G+ V LYANKVGPFHNPSETY Y DL FC
Sbjct  22   RSDASSHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFC  61



>ref|XP_004170088.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
 gb|KGN49739.1| hypothetical protein Csa_5G096460 [Cucumis sativus]
Length=589

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  194  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            DAS+HRY +GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  22   DASNHRYSEGDSVPLYANKVGPFHNPSETYRYFDLPFCS  60



>gb|ADQ43185.1| endomemebrane protein 70 [Schrenkiella parvula]
Length=587

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDASDHRYK+GD V LYANKVGPFHNP ETY Y DL FC
Sbjct  23   RSDASDHRYKEGDSVPLYANKVGPFHNP-ETYRYFDLPFC  61



>ref|XP_009602054.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=594

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDH+YK GD V LYANKVGPFHNPSETY + DL FC+
Sbjct  25   RSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRFFDLPFCA  65



>gb|KJB10378.1| hypothetical protein B456_001G198000 [Gossypium raimondii]
Length=500

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RS ASDHRY  GDEV LYANKVGPFHNPSETY   D  FCS
Sbjct  23   RSSASDHRYTAGDEVPLYANKVGPFHNPSETYRLFDFPFCS  63



>ref|XP_009775043.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSD SDH+YK GD V LYANKVGPFHNPSETY + DL FC+
Sbjct  24   RSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRFFDLPFCA  64



>ref|XP_009408099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=589

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D  DHRYK+GD V LYANKVGPFHNPSETY ++DL FCS
Sbjct  22   ADGRDHRYKEGDHVPLYANKVGPFHNPSETYRFYDLPFCS  61



>gb|KJB43179.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
 gb|KJB43180.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
Length=589

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RS ASDHRYK GDEV LYANKVGPF NPSETY Y D  FCS
Sbjct  23   RSSASDHRYKAGDEVPLYANKVGPFGNPSETYRYFDFPFCS  63



>gb|KHG20583.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=589

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RS ASDHRYK GDEV LYANKVGPF NPSETY Y D  FCS
Sbjct  23   RSSASDHRYKAGDEVPLYANKVGPFGNPSETYRYFDFPFCS  63



>ref|XP_008466877.1| PREDICTED: putative phagocytic receptor 1b [Cucumis melo]
Length=602

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  194  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            DAS+HRY +GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  35   DASNHRYSEGDSVPLYANKVGPFHNPSETYRYFDLPFCS  73



>ref|XP_010932502.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
 ref|XP_010932503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=597

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +DASDHRYK G+ V LYANKVGPFHNPSETY Y DL FC
Sbjct  29   ADASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFC  67



>ref|XP_006384123.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
 gb|ERP61920.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
Length=592

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            RSDAS +RYK GD+V LY NKVGPFHNPSETY Y DL FCS
Sbjct  23   RSDASTNRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCS  63



>ref|XP_004150159.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
Length=654

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  194  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            DAS+HRY +GD V LYANKVGPFHNPSETY Y DL FCS
Sbjct  87   DASNHRYSEGDSVPLYANKVGPFHNPSETYRYFDLPFCS  125



>ref|XP_004985073.1| PREDICTED: putative phagocytic receptor 1b-like [Setaria italica]
Length=593

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  194  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            D SDHRYK G+ V LYANKVGPFHNPSETY Y DL FCS
Sbjct  26   DGSDHRYKAGEPVPLYANKVGPFHNPSETYRYFDLPFCS  64



>ref|XP_003620064.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES76282.1| transmembrane 9 family protein [Medicago truncatula]
Length=588

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSD+SD RYK+GD V L+ANKVGPFHNPSETY Y DL FC
Sbjct  20   RSDSSDKRYKEGDLVPLFANKVGPFHNPSETYRYFDLPFC  59



>ref|XP_008798135.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=592

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDASDHRYK  D V LYANKVGPFHNPSETY Y DL FC+
Sbjct  25   SDASDHRYKPDDPVPLYANKVGPFHNPSETYRYFDLPFCT  64



>ref|XP_008791844.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=596

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +DASDHRYK G+ V LYANKVGPFHNPSETY Y DL FC
Sbjct  28   ADASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFC  66



>ref|XP_003558407.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=593

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SD SDHRYK  + V LYANKVGPFHNPSETY Y DL FCS
Sbjct  25   SDGSDHRYKSSEPVPLYANKVGPFHNPSETYRYFDLPFCS  64



>emb|CDP05457.1| unnamed protein product [Coffea canephora]
Length=607

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RSDAS+HRY+ G+ V LYANK+GPFHNPSETY Y DL FC
Sbjct  21   RSDASNHRYQPGEPVPLYANKIGPFHNPSETYRYFDLPFC  60



>ref|XP_011003770.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Populus euphratica]
Length=586

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            SD SDHRY+QGD+V  Y NKVGPFHNPSETY Y DL +C
Sbjct  25   SDESDHRYRQGDQVPFYVNKVGPFHNPSETYRYFDLPYC  63



>ref|XP_004490795.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=593

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +SD+ DHRYK+GD V  YANKVGPFHNPSETY Y DL FC+
Sbjct  24   KSDSLDHRYKEGDFVPFYANKVGPFHNPSETYRYFDLPFCA  64



>ref|XP_006659860.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=590

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D SDHRYK  D V LYANKVGPFHNPSETY Y+DL FC+
Sbjct  24   ADGSDHRYKDRDYVPLYANKVGPFHNPSETYRYYDLPFCA  63



>ref|XP_006849485.1| hypothetical protein AMTR_s00024p00115620 [Amborella trichopoda]
 gb|ERN11066.1| hypothetical protein AMTR_s00024p00115620 [Amborella trichopoda]
Length=591

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +SDAS+H+YK GD V LY NKVGPFHNPSETY Y DL FC
Sbjct  19   QSDASNHKYKPGDPVPLYVNKVGPFHNPSETYRYFDLPFC  58



>ref|XP_002317710.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|EEE95930.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=594

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            SD  DHRY+QGD+V  Y NKVGPFHNPSETY Y DL +C
Sbjct  26   SDEPDHRYRQGDQVPFYVNKVGPFHNPSETYRYFDLPYC  64



>ref|XP_010936838.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=592

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDASDHRYK  D V LYANKVGPF NPSETY Y DL FC+
Sbjct  25   SDASDHRYKPEDPVPLYANKVGPFQNPSETYRYFDLPFCT  64



>gb|AGT15903.1| transmembrane 9 superfamily protein [Saccharum hybrid cultivar 
R570]
Length=593

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  194  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            D SDHRYK  + V LYANKVGPFHNPSETY Y DL FCS
Sbjct  26   DGSDHRYKMNEPVPLYANKVGPFHNPSETYRYFDLPFCS  64



>ref|XP_002468203.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
 gb|EER95201.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
Length=595

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  194  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            D SDHRYK  + V LYANKVGPFHNPSETY Y DL FCS
Sbjct  28   DGSDHRYKMNEPVPLYANKVGPFHNPSETYRYFDLPFCS  66



>gb|ABK24901.1| unknown [Picea sitchensis]
Length=585

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            ASDHRY +GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   ASDHRYSKGDHVPLYANKVGPFHNPSETYRYFDLPFC  59



>ref|XP_009628015.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628016.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=592

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +SDAS HRYK G+EV LYANKVGPF NPSETY Y DL FC
Sbjct  22   QSDASTHRYKSGEEVPLYANKVGPFFNPSETYAYFDLPFC  61



>ref|NP_001049492.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|AAO06970.1| Putative endosomal protein [Oryza sativa Japonica Group]
 gb|ABF94848.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11406.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|EAZ26202.1| hypothetical protein OsJ_10070 [Oryza sativa Japonica Group]
 dbj|BAG89207.1| unnamed protein product [Oryza sativa Japonica Group]
Length=595

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D SDHRYK  + V LYANKVGPFHNPSETY Y DL FCS
Sbjct  27   ADGSDHRYKANELVPLYANKVGPFHNPSETYRYFDLPFCS  66



>gb|ABK25212.1| unknown [Picea sitchensis]
Length=355

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            ASDHRY +GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  23   ASDHRYSKGDHVPLYANKVGPFHNPSETYRYFDLPFC  59



>ref|XP_006376703.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|ERP54500.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=625

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            SD  DHRY+QGD+V  Y NKVGPFHNPSETY Y DL +C
Sbjct  57   SDEPDHRYRQGDQVPFYVNKVGPFHNPSETYRYFDLPYC  95



>ref|XP_004240860.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322124.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
Length=591

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +SDAS HRYK GD+V  YANKVGPF NPSETY Y DL FC
Sbjct  22   QSDASTHRYKSGDDVPFYANKVGPFSNPSETYAYFDLPFC  61



>ref|XP_010276746.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=590

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +D S+H+YK+ D V LYANKVGPFHNPSETY Y+DL FCS
Sbjct  22   ADGSNHKYKERDLVPLYANKVGPFHNPSETYRYYDLPFCS  61



>ref|XP_009615617.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=596

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = +2

Query  194  DASD-HRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            DASD HRYK+GD V LYANKVGPFHNPSE+Y Y+DL FC
Sbjct  26   DASDDHRYKRGDPVPLYANKVGPFHNPSESYRYYDLPFC  64



>emb|CDP01681.1| unnamed protein product [Coffea canephora]
Length=595

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            +SDASDH YK  D+V LYANKVGPF NPSETY + DL FCS
Sbjct  23   KSDASDHTYKPKDQVPLYANKVGPFQNPSETYRFFDLPFCS  63



>ref|XP_001783681.1| predicted protein [Physcomitrella patens]
 gb|EDQ51511.1| predicted protein [Physcomitrella patens]
Length=586

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            A DHRYK+ D V L+ANKVGPFHNPSETY Y+DL FC
Sbjct  25   AKDHRYKENDNVPLFANKVGPFHNPSETYQYYDLPFC  61



>ref|NP_001151315.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN28721.1| unknown [Zea mays]
 gb|AFW89069.1| transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  194  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            D SDHRYK  + V LYANKVGPFHNPSETY Y DL FCS
Sbjct  26   DGSDHRYKIREPVPLYANKVGPFHNPSETYRYFDLPFCS  64



>gb|ACG42357.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
Length=593

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  194  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            D SDHRYK  + V LYANKVGPFHNPSETY Y DL FCS
Sbjct  26   DGSDHRYKIREPVPLYANKVGPFHNPSETYRYFDLPFCS  64



>ref|XP_010521657.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Tarenaya 
hassleriana]
Length=590

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            S  SDHRY  GD V L+ NKVGPFHNPSETY Y+DL FC
Sbjct  23   SSPSDHRYNVGDHVPLFVNKVGPFHNPSETYQYYDLPFC  61



>ref|XP_006358745.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=591

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +SDAS HRYK GD+V  YANKVGP+ NPSETY Y DL FC
Sbjct  22   QSDASTHRYKSGDDVPFYANKVGPYFNPSETYAYFDLPFC  61



>ref|XP_009782678.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009782682.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009782687.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=592

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +SDAS H+YK G++V LYANKVGPF NPSETY Y+DL FC
Sbjct  22   QSDASTHQYKSGEKVPLYANKVGPFFNPSETYSYYDLPFC  61



>ref|XP_010099693.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXB80270.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=637

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  200  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDHRY +GD V LYANKVGPF NPSETY Y DL FCS
Sbjct  26   SDHRYHEGDSVPLYANKVGPFQNPSETYRYFDLPFCS  62



>tpg|DAA44289.1| TPA: hypothetical protein ZEAMMB73_547933 [Zea mays]
Length=526

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  200  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDHRYK  + V LYANKVGPFHNPSETY Y DL FCS
Sbjct  28   SDHRYKMYEPVPLYANKVGPFHNPSETYRYFDLPFCS  64



>ref|XP_010939968.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=609

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            S ASDHRYK  D V LYANKVGPF NPSETY Y DL FC+
Sbjct  42   SSASDHRYKPEDPVPLYANKVGPFQNPSETYRYFDLPFCT  81



>emb|CDP05449.1| unnamed protein product [Coffea canephora]
Length=296

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +SDAS HRY+QGD V LY NKV PFHNPSET+ Y+ L FC
Sbjct  24   KSDASKHRYQQGDSVPLYGNKVAPFHNPSETHAYYSLPFC  63



>emb|CDP05443.1| unnamed protein product [Coffea canephora]
Length=587

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            SDA DH+Y +GD V LY NKVGP+HNPSETY Y+D  FC
Sbjct  23   SDAFDHKYNKGDPVPLYVNKVGPYHNPSETYPYYDFPFC  61



>ref|NP_001148980.1| LOC100282600 precursor [Zea mays]
 gb|ACG33705.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 tpg|DAA44288.1| TPA: transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  200  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDHRYK  + V LYANKVGPFHNPSETY Y DL FCS
Sbjct  28   SDHRYKMYEPVPLYANKVGPFHNPSETYRYFDLPFCS  64



>gb|EEC66468.1| hypothetical protein OsI_32547 [Oryza sativa Indica Group]
Length=631

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            A  HRY+ GD V LYANKVGPFHNPSETY Y DL FC+
Sbjct  23   ADSHRYRPGDAVPLYANKVGPFHNPSETYRYFDLPFCA  60



>gb|AAK52585.1|AC079685_16 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|AAM44876.1|AC098694_15 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|EAZ15105.1| hypothetical protein OsJ_30519 [Oryza sativa Japonica Group]
Length=627

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            A  HRY+ GD V LYANKVGPFHNPSETY Y DL FC+
Sbjct  19   ADSHRYRPGDAVPLYANKVGPFHNPSETYRYFDLPFCA  56



>ref|NP_001064040.1| Os10g0112600 [Oryza sativa Japonica Group]
 gb|AAP51848.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF25954.1| Os10g0112600 [Oryza sativa Japonica Group]
 dbj|BAG94270.1| unnamed protein product [Oryza sativa Japonica Group]
Length=585

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            A  HRY+ GD V LYANKVGPFHNPSETY Y DL FC+
Sbjct  22   ADSHRYRPGDAVPLYANKVGPFHNPSETYRYFDLPFCA  59



>ref|XP_011085893.1| PREDICTED: transmembrane 9 superfamily member 2-like [Sesamum 
indicum]
Length=587

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  200  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            SDH +K GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  22   SDHTFKAGDPVPLYANKVGPFHNPSETYRYFDLPFC  57



>ref|XP_006849484.1| hypothetical protein AMTR_s00024p00115000 [Amborella trichopoda]
 gb|ERN11065.1| hypothetical protein AMTR_s00024p00115000 [Amborella trichopoda]
Length=590

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDA D RYK GD V LYA K+GP HNPSETY Y+D+ FCS
Sbjct  24   SDAFDQRYKHGDFVPLYATKIGPSHNPSETYRYYDMPFCS  63



>ref|XP_008787888.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Phoenix 
dactylifera]
Length=555

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            ASD RYK  D V LYANKVGPFHNPSETY Y DL FC+
Sbjct  27   ASDRRYKPEDPVPLYANKVGPFHNPSETYRYFDLPFCT  64



>ref|XP_008787887.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Phoenix 
dactylifera]
Length=592

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            ASD RYK  D V LYANKVGPFHNPSETY Y DL FC+
Sbjct  27   ASDRRYKPEDPVPLYANKVGPFHNPSETYRYFDLPFCT  64



>ref|XP_001775546.1| predicted protein [Physcomitrella patens]
 gb|EDQ59629.1| predicted protein [Physcomitrella patens]
Length=590

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +  S+H+Y  GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  25   ASGSNHKYATGDPVPLYANKVGPFHNPSETYKYFDLPFC  63



>ref|XP_010036999.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48635.1| hypothetical protein EUGRSUZ_K02293 [Eucalyptus grandis]
Length=592

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            S  S+HRY++ D V LYANKVGPFHNPSETY Y DL +C+
Sbjct  25   SSPSNHRYEERDPVPLYANKVGPFHNPSETYRYFDLPYCT  64



>ref|XP_006661606.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=586

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            + A  HR++ GD V LYANKVGPFHNPSETY Y DL FC+
Sbjct  21   ATADSHRFRPGDAVPLYANKVGPFHNPSETYRYFDLPFCA  60



>ref|XP_004228944.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=594

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  203  DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            DH YKQGD V L+ANK+GPFHNPSE+Y Y+DL FC
Sbjct  32   DHFYKQGDHVPLFANKIGPFHNPSESYRYYDLPFC  66



>gb|ABR16201.1| unknown [Picea sitchensis]
Length=585

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  200  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            SDH+Y +GD V LYANKVGPF NPSETY Y DL FC
Sbjct  23   SDHKYSKGDHVPLYANKVGPFQNPSETYRYFDLPFC  58



>emb|CDP05446.1| unnamed protein product [Coffea canephora]
Length=585

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +SDA  H+Y++GD V LYAN VGPFHNPSETY Y+ L FC
Sbjct  22   KSDAFTHKYEKGDPVPLYANTVGPFHNPSETYPYYSLPFC  61



>ref|XP_002969094.1| hypothetical protein SELMODRAFT_170330 [Selaginella moellendorffii]
 gb|EFJ30210.1| hypothetical protein SELMODRAFT_170330 [Selaginella moellendorffii]
Length=591

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  206  HRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            H Y  GD+V LYANKVGPFHNPSETY Y+DL FC+
Sbjct  34   HSYNDGDKVPLYANKVGPFHNPSETYQYYDLPFCA  68



>ref|XP_001770691.1| predicted protein [Physcomitrella patens]
 gb|EDQ64515.1| predicted protein [Physcomitrella patens]
Length=590

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +S+H+Y  GD V LYANKVGPFHNPSETY Y DL FC
Sbjct  27   SSNHKYGAGDPVPLYANKVGPFHNPSETYKYFDLPFC  63



>ref|XP_002973969.1| hypothetical protein SELMODRAFT_173941 [Selaginella moellendorffii]
 gb|EFJ24924.1| hypothetical protein SELMODRAFT_173941 [Selaginella moellendorffii]
Length=591

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  206  HRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            H Y  GD+V LYANKVGPFHNPSETY Y+DL FC+
Sbjct  34   HSYNDGDKVPLYANKVGPFHNPSETYQYYDLPFCA  68



>ref|XP_010037000.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48638.1| hypothetical protein EUGRSUZ_K02296 [Eucalyptus grandis]
Length=592

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            S  S  RYK+G+ V LYANKVGPFHNPSETY Y DL +C+
Sbjct  25   SSPSGQRYKEGEPVPLYANKVGPFHNPSETYRYFDLPYCT  64



>ref|XP_002974646.1| hypothetical protein SELMODRAFT_101645 [Selaginella moellendorffii]
 gb|EFJ24166.1| hypothetical protein SELMODRAFT_101645 [Selaginella moellendorffii]
Length=589

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            A DH Y + D+V LYANKVGPFHNPSETY Y DL FC
Sbjct  28   ARDHTYGENDKVPLYANKVGPFHNPSETYQYFDLPFC  64



>ref|XP_002963357.1| hypothetical protein SELMODRAFT_166118 [Selaginella moellendorffii]
 gb|EFJ35228.1| hypothetical protein SELMODRAFT_166118 [Selaginella moellendorffii]
Length=589

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            A DH Y + D+V LYANKVGPFHNPSETY Y DL FC
Sbjct  28   ARDHTYGENDKVPLYANKVGPFHNPSETYQYFDLPFC  64



>ref|XP_003059958.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55910.1| predicted protein [Micromonas pusilla CCMP1545]
Length=614

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            AS H Y   D+V LYANKVGPFHNPSETY Y+DL FC
Sbjct  47   ASSHSYLVRDDVPLYANKVGPFHNPSETYQYYDLPFC  83



>ref|XP_006361076.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=589

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  200  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +DHRY  GDEV L+ NKVGP +NPSETY Y+DL FC
Sbjct  26   NDHRYNIGDEVPLFVNKVGPLNNPSETYQYYDLPFC  61



>ref|XP_005650990.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26446.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
Length=624

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  200  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFCS  310
            SDHRY   D + LYANKVGPF NPSETY Y++L FC+
Sbjct  52   SDHRYDMHDPIKLYANKVGPFSNPSETYQYYNLPFCT  88



>ref|XP_009779343.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=610

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +  +DHRY  GDEV L+ NKVGP +NPSETY Y+DL FC
Sbjct  44   ASPNDHRYNFGDEVPLFVNKVGPLNNPSETYQYYDLPFC  82



>dbj|BAJ87519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  200  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            SDH+YK GD V L+ NKVGP++NP ETY YH L FC
Sbjct  36   SDHKYKSGDSVKLWVNKVGPYNNPQETYNYHSLPFC  71



>ref|XP_010322438.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Solanum 
lycopersicum]
Length=507

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  200  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +DHRY  GDEV L+ NKVGP  NPSETY Y+DL FC
Sbjct  26   NDHRYNIGDEVPLFVNKVGPLSNPSETYQYYDLPFC  61



>ref|XP_002274254.1| PREDICTED: transmembrane 9 superfamily member 5 [Vitis vinifera]
Length=608

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            A DHRY  GD V L+ NKVGP +NPSETY Y+DL FC
Sbjct  44   AQDHRYNVGDHVSLFVNKVGPLNNPSETYHYYDLPFC  80



>ref|XP_001699211.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDO98851.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=594

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
             SDH++K G ++ LYANKVGPF NP+ETY Y++L FC
Sbjct  29   GSDHKFKPGSDIMLYANKVGPFQNPTETYQYYNLPFC  65



>emb|CBI28324.3| unnamed protein product [Vitis vinifera]
Length=636

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            A DHRY  GD V L+ NKVGP +NPSETY Y+DL FC
Sbjct  72   AQDHRYNVGDHVSLFVNKVGPLNNPSETYHYYDLPFC  108



>ref|XP_004241321.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
Length=589

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  200  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +DHRY  GDEV L+ NKVGP  NPSETY Y+DL FC
Sbjct  26   NDHRYNIGDEVPLFVNKVGPLSNPSETYQYYDLPFC  61



>gb|EWM22128.1| transmembrane 9 superfamily member 3 [Nannochloropsis gaditana]
Length=601

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  203  DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +H+Y +GDEV L+ NKVGP+HNP ETY Y+DL FC
Sbjct  30   NHKYAEGDEVTLWVNKVGPYHNPHETYEYYDLPFC  64



>emb|CAN67239.1| hypothetical protein VITISV_004804 [Vitis vinifera]
Length=920

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  197  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            A DHRY  GD V L+ NKVGP +NPSETY Y+DL FC
Sbjct  28   AQDHRYNVGDHVSLFVNKVGPLNNPSETYHYYDLPFC  64



>ref|XP_001422764.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01081.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=624

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            RS  +  +Y +GD++ L+ANKVGPFHNPSETY Y+D  FC
Sbjct  53   RSLLAGSKYDRGDDIALFANKVGPFHNPSETYQYYDFPFC  92



>ref|XP_010238659.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=594

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  200  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            SDH+YK GD V L+ NKVGP++NP ETY YH L FC
Sbjct  35   SDHKYKTGDPVKLWVNKVGPYNNPQETYNYHSLPFC  70



>ref|XP_006384818.1| hypothetical protein POPTR_0004s21340g [Populus trichocarpa]
 gb|ERP62615.1| hypothetical protein POPTR_0004s21340g [Populus trichocarpa]
Length=586

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            S  S+HRY  GD V L+ NKVGP HNPS TY Y+DL FC
Sbjct  20   SSPSNHRYNAGDHVPLFVNKVGPLHNPSATYWYYDLPFC  58



>gb|KDP33127.1| hypothetical protein JCGZ_13574 [Jatropha curcas]
Length=587

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            S  +DHRY   D V L+ NK+GP HNPSETY Y+DL FC
Sbjct  21   SSPTDHRYNVRDNVPLFVNKIGPLHNPSETYQYYDLPFC  59



>ref|XP_004293072.1| PREDICTED: transmembrane 9 superfamily member 5 [Fragaria vesca 
subsp. vesca]
Length=590

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            +S A+DH Y  GD V L+ NK+GP +NPSETY Y+DL FC
Sbjct  23   KSSATDHIYNVGDNVPLFVNKIGPLNNPSETYQYYDLPFC  62



>ref|XP_008382598.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=583

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLXFC  307
            + ASDH Y  GD V L+ NKVGP +NPSETY Y+DL FC
Sbjct  20   ASASDHSYNVGDHVPLFVNKVGPLNNPSETYHYYDLPFC  58



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 558850726180