BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF009N01

Length=398
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD18102.1|  leucine-rich repeat receptor-like kinase             77.4    1e-13   Ipomoea batatas [batate]
ref|XP_009800027.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      75.5    5e-13   Nicotiana sylvestris
ref|XP_009626005.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      73.6    2e-12   
ref|XP_006366916.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  72.4    5e-12   Solanum tuberosum [potatoes]
gb|KDP26621.1|  hypothetical protein JCGZ_17779                       71.2    2e-11   Jatropha curcas
ref|XP_004237339.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  70.9    2e-11   Solanum lycopersicum
emb|CDP13189.1|  unnamed protein product                              68.9    1e-10   Coffea canephora [robusta coffee]
ref|XP_010940158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      68.2    2e-10   Elaeis guineensis
ref|XP_010319667.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  67.8    2e-10   Solanum lycopersicum
ref|XP_008812173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      66.6    5e-10   Phoenix dactylifera
ref|XP_009403877.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  66.6    6e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403878.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  66.6    6e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009797107.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  65.9    8e-10   Nicotiana sylvestris
ref|XP_010910388.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  65.5    2e-09   Elaeis guineensis
gb|KDO82335.1|  hypothetical protein CISIN_1g006968mg                 64.7    2e-09   Citrus sinensis [apfelsine]
gb|KDO82334.1|  hypothetical protein CISIN_1g006968mg                 64.7    2e-09   Citrus sinensis [apfelsine]
ref|XP_006483905.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  64.7    2e-09   Citrus sinensis [apfelsine]
ref|XP_006438322.1|  hypothetical protein CICLE_v10030967mg           64.7    2e-09   Citrus clementina [clementine]
ref|XP_007044708.1|  Nsp-interacting kinase 3 isoform 1               64.7    2e-09   Theobroma cacao [chocolate]
gb|KJB61045.1|  hypothetical protein B456_009G337000                  64.7    2e-09   Gossypium raimondii
gb|KJB61041.1|  hypothetical protein B456_009G337000                  64.7    2e-09   Gossypium raimondii
gb|KJB61043.1|  hypothetical protein B456_009G337000                  64.3    3e-09   Gossypium raimondii
gb|KJB61042.1|  hypothetical protein B456_009G337000                  63.5    3e-09   Gossypium raimondii
ref|XP_004238646.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      63.9    4e-09   Solanum lycopersicum
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg              63.9    4e-09   Erythranthe guttata [common monkey flower]
ref|XP_011086598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      63.5    6e-09   
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      63.2    8e-09   Nelumbo nucifera [Indian lotus]
gb|KDO82336.1|  hypothetical protein CISIN_1g006968mg                 62.8    8e-09   Citrus sinensis [apfelsine]
ref|XP_010023506.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      63.2    8e-09   Eucalyptus grandis [rose gum]
ref|XP_008813583.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.2    8e-09   Phoenix dactylifera
ref|XP_008813582.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.2    8e-09   Phoenix dactylifera
ref|XP_010100426.1|  Protein NSP-INTERACTING KINASE 3                 63.2    9e-09   Morus notabilis
ref|XP_011034116.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.2    9e-09   Populus euphratica
ref|XP_011034114.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.2    9e-09   Populus euphratica
ref|XP_006392114.1|  hypothetical protein EUTSA_v10023342mg           62.8    1e-08   Eutrema salsugineum [saltwater cress]
ref|XP_008654537.1|  PREDICTED: uncharacterized LOC100272802 isof...  62.0    2e-08   
dbj|BAD68255.1|  putative brassinosteroid insensitive 1-associate...  60.8    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009596637.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.8    5e-08   Nicotiana tomentosiformis
dbj|BAD68256.1|  putative brassinosteroid insensitive 1-associate...  60.5    5e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CDY61461.1|  BnaC01g43240D                                        60.8    6e-08   Brassica napus [oilseed rape]
ref|XP_010510907.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  60.5    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010510906.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  60.5    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004968347.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.5    6e-08   Setaria italica
ref|XP_006356418.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.5    6e-08   Solanum tuberosum [potatoes]
ref|XP_009104025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  60.5    7e-08   Brassica rapa
gb|AFO67891.1|  leucine-rich repeat receptor-like kinase              60.5    7e-08   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_009104018.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  60.5    7e-08   Brassica rapa
emb|CDY46185.1|  BnaA01g23070D                                        60.5    7e-08   Brassica napus [oilseed rape]
ref|XP_006841062.1|  hypothetical protein AMTR_s00085p00173590        60.5    7e-08   Amborella trichopoda
ref|XP_006378225.1|  hypothetical protein POPTR_0010s05300g           60.5    7e-08   
ref|XP_010682518.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      60.1    8e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008221852.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  60.1    8e-08   Prunus mume [ume]
ref|XP_008221850.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  60.1    8e-08   Prunus mume [ume]
ref|XP_002886588.1|  nsp-interacting kinase 3                         60.1    8e-08   
ref|XP_010533910.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      60.1    8e-08   Tarenaya hassleriana [spider flower]
ref|XP_009390158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.1    9e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390157.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.1    9e-08   
gb|AAB71968.1|  Putative Serine/Threonine protein kinase              59.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176279.1|  NSP-interacting kinase 3                            59.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008389688.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  59.7    1e-07   Malus domestica [apple tree]
ref|XP_008389687.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  59.7    1e-07   Malus domestica [apple tree]
ref|XP_008389685.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  59.7    1e-07   Malus domestica [apple tree]
ref|XP_002455108.1|  hypothetical protein SORBIDRAFT_03g004450        59.7    1e-07   
emb|CAN75190.1|  hypothetical protein VITISV_035381                   58.9    2e-07   Vitis vinifera
ref|XP_010651607.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      58.9    2e-07   Vitis vinifera
gb|KCW86694.1|  hypothetical protein EUGRSUZ_B03306                   58.2    3e-07   Eucalyptus grandis [rose gum]
ref|XP_010044599.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  58.2    3e-07   Eucalyptus grandis [rose gum]
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                   58.2    3e-07   Eucalyptus grandis [rose gum]
gb|KCW86690.1|  hypothetical protein EUGRSUZ_B03306                   58.2    3e-07   Eucalyptus grandis [rose gum]
gb|KCW86687.1|  hypothetical protein EUGRSUZ_B03306                   58.2    3e-07   Eucalyptus grandis [rose gum]
gb|KCW86693.1|  hypothetical protein EUGRSUZ_B03306                   58.2    3e-07   Eucalyptus grandis [rose gum]
gb|KCW86692.1|  hypothetical protein EUGRSUZ_B03306                   58.2    3e-07   Eucalyptus grandis [rose gum]
ref|XP_010044598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  58.2    3e-07   
ref|XP_010044597.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  58.2    3e-07   
gb|KCW86691.1|  hypothetical protein EUGRSUZ_B03306                   58.2    3e-07   Eucalyptus grandis [rose gum]
ref|XP_010044596.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  58.2    3e-07   
ref|XP_010044595.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  58.2    3e-07   
ref|XP_010044594.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  58.2    3e-07   Eucalyptus grandis [rose gum]
gb|EPS59440.1|  hypothetical protein M569_15369                       54.3    5e-07   Genlisea aurea
ref|XP_008340072.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  57.8    6e-07   
ref|XP_008340071.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  57.8    6e-07   
ref|XP_008340070.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  57.8    6e-07   
ref|NP_001169689.1|  LOC100383570 precursor                           57.4    7e-07   Zea mays [maize]
ref|XP_011463143.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  57.4    7e-07   Fragaria vesca subsp. vesca
ref|XP_004297396.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  57.4    7e-07   Fragaria vesca subsp. vesca
dbj|BAK02609.1|  predicted protein                                    57.0    9e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006301740.1|  hypothetical protein CARUB_v10022201mg           56.2    2e-06   
ref|XP_002315684.2|  hypothetical protein POPTR_0010s05300g           55.8    2e-06   
ref|XP_010418025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  55.8    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010418023.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  55.8    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009625494.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  55.5    3e-06   Nicotiana tomentosiformis
ref|XP_010473260.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  55.5    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010473259.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  55.5    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010248542.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  55.5    3e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  55.5    3e-06   Nelumbo nucifera [Indian lotus]
ref|XP_009765506.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  55.1    4e-06   Nicotiana sylvestris
ref|XP_007157369.1|  hypothetical protein PHAVU_002G064400g           54.3    6e-06   Phaseolus vulgaris [French bean]
ref|XP_003613191.1|  Leucine-rich repeat receptor-like kinase         53.9    8e-06   Medicago truncatula
gb|ACM89541.1|  leucine-rich repeat receptor-like kinase              53.9    9e-06   Glycine max [soybeans]
ref|XP_004489819.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  53.9    9e-06   Cicer arietinum [garbanzo]
ref|XP_010230511.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  53.9    9e-06   
ref|XP_010230510.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  53.9    9e-06   
ref|XP_003569325.2|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  53.9    9e-06   Brachypodium distachyon [annual false brome]
ref|XP_010230509.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  53.9    9e-06   Brachypodium distachyon [annual false brome]
gb|KHN00370.1|  Protein NSP-INTERACTING KINASE 3                      53.9    1e-05   Glycine soja [wild soybean]
ref|XP_003519642.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  53.9    1e-05   Glycine max [soybeans]
gb|KHN14560.1|  Protein NSP-INTERACTING KINASE 3                      53.9    1e-05   Glycine soja [wild soybean]
ref|XP_003517653.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  53.9    1e-05   Glycine max [soybeans]
gb|EPS73511.1|  hypothetical protein M569_01245                       53.1    2e-05   Genlisea aurea
ref|XP_006380012.1|  hypothetical protein POPTR_0008s19310g           52.8    2e-05   
ref|XP_002312685.1|  leucine-rich repeat family protein               52.8    2e-05   
ref|XP_004238998.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      52.4    3e-05   Solanum lycopersicum
ref|XP_004142972.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  52.0    3e-05   Cucumis sativus [cucumbers]
gb|KDP31451.1|  hypothetical protein JCGZ_11827                       51.2    6e-05   Jatropha curcas
ref|XP_006348615.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  51.2    7e-05   
ref|XP_010558548.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  50.8    9e-05   Tarenaya hassleriana [spider flower]
ref|XP_010558545.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  50.8    9e-05   Tarenaya hassleriana [spider flower]
ref|XP_010549936.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      50.8    9e-05   Tarenaya hassleriana [spider flower]
ref|XP_008444352.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  50.4    1e-04   Cucumis melo [Oriental melon]
ref|XP_010032589.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      50.4    1e-04   Eucalyptus grandis [rose gum]
ref|XP_008459453.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      50.4    1e-04   Cucumis melo [Oriental melon]
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  50.1    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  50.1    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN14464.1|  Protein NSP-INTERACTING KINASE 1                      50.1    2e-04   Glycine soja [wild soybean]
ref|XP_003531900.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  50.1    2e-04   Glycine max [soybeans]
ref|XP_009596697.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  50.1    2e-04   Nicotiana tomentosiformis
ref|XP_009596696.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  50.1    2e-04   Nicotiana tomentosiformis
ref|XP_011009019.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  50.1    2e-04   Populus euphratica
ref|XP_002314905.1|  hypothetical protein POPTR_0010s14410g           50.1    2e-04   
gb|KDO70179.1|  hypothetical protein CISIN_1g007025mg                 49.3    2e-04   Citrus sinensis [apfelsine]
ref|XP_002532890.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  49.3    3e-04   Ricinus communis
gb|KDO70178.1|  hypothetical protein CISIN_1g007025mg                 49.3    3e-04   Citrus sinensis [apfelsine]
ref|XP_006484307.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  49.3    3e-04   Citrus sinensis [apfelsine]
ref|XP_006437790.1|  hypothetical protein CICLE_v10030970mg           49.3    3e-04   Citrus clementina [clementine]
ref|XP_009803966.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  49.3    3e-04   Nicotiana sylvestris
ref|XP_009803965.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  49.3    3e-04   Nicotiana sylvestris
ref|XP_006603947.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  48.9    3e-04   
gb|KHN30771.1|  Protein NSP-INTERACTING KINASE 1                      48.9    3e-04   Glycine soja [wild soybean]
ref|XP_003555046.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  48.9    3e-04   Glycine max [soybeans]
ref|XP_007139356.1|  hypothetical protein PHAVU_008G022700g           48.9    4e-04   Phaseolus vulgaris [French bean]
ref|XP_009418103.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  48.9    4e-04   
gb|KJB43138.1|  hypothetical protein B456_007G186300                  48.9    4e-04   Gossypium raimondii
ref|XP_009418102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  48.9    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  48.5    5e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417563.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  48.5    5e-04   
ref|XP_006338306.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  48.5    6e-04   Solanum tuberosum [potatoes]
gb|KDP24340.1|  hypothetical protein JCGZ_25636                       48.1    6e-04   Jatropha curcas
ref|XP_007033440.1|  NSP-interacting kinase 1                         48.1    7e-04   
ref|XP_011012715.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  48.1    7e-04   Populus euphratica
ref|XP_006384231.1|  hypothetical protein POPTR_0004s10790g           48.1    7e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011012714.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  48.1    7e-04   Populus euphratica
ref|XP_002305306.2|  hypothetical protein POPTR_0004s10790g           48.1    7e-04   Populus trichocarpa [western balsam poplar]
gb|AAM65586.1|  receptor protein kinase-like protein                  48.1    7e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197104.1|  NSP-interacting kinase 1                            48.1    7e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KJB80538.1|  hypothetical protein B456_013G102600                  47.8    8e-04   Gossypium raimondii
gb|KHG05227.1|  nsp-interacting kinase 2 -like protein                47.8    8e-04   Gossypium arboreum [tree cotton]
ref|XP_004141483.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  47.8    9e-04   Cucumis sativus [cucumbers]



>dbj|BAD18102.1| leucine-rich repeat receptor-like kinase [Ipomoea batatas]
Length=627

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSF-ATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M R+W + ++VLG  +W+ I +S  ATLSP+GVNYEVVAL+AIKT LHDPYNVLE
Sbjct  1    MEREWFLPFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLE  55



>ref|XP_009800027.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana sylvestris]
Length=626

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M  KWC+L+ V G ++   +ESS+A+LSPTG+NYEVVAL  IK +LHDPYNVLE
Sbjct  1    MEGKWCMLWYV-GLLVLTLMESSYASLSPTGINYEVVALTEIKKALHDPYNVLE  53



>ref|XP_009626005.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana tomentosiformis]
Length=626

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M  KWC+L+ V G ++   +ES +A+LSPTG+NYEVVAL  IK +LHDPYNVLE
Sbjct  1    MEGKWCMLWYV-GLLVLTLMESCYASLSPTGINYEVVALTEIKKALHDPYNVLE  53



>ref|XP_006366916.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Solanum tuberosum]
Length=622

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 4/54 (7%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M RKWC+      +V+   +ES +A+LSPTG+NYEVVAL+ IK +LHDPYNVLE
Sbjct  1    MDRKWCMFL----YVVLTLMESCYASLSPTGINYEVVALIEIKKALHDPYNVLE  50



>gb|KDP26621.1| hypothetical protein JCGZ_17779 [Jatropha curcas]
Length=626

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +G V+W  +E S ATLSPTG+NYEVVAL+ IKT+LHDPYNVLE
Sbjct  11   VGLVVWALMEISSATLSPTGINYEVVALVNIKTALHDPYNVLE  53



>ref|XP_004237339.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319665.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319666.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
Length=623

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 5/54 (9%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M RKWC+   V+       +ES +A+LSPTG+NYEVVAL+ IK +LHDPYNVLE
Sbjct  1    MERKWCMFLYVVAL-----MESCYASLSPTGINYEVVALIEIKKALHDPYNVLE  49



>emb|CDP13189.1| unnamed protein product [Coffea canephora]
Length=624

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M  KW +L +V+  ++++ + SS A+LSPTG+NYEVVALMAIK  L DPYNVLE
Sbjct  1    MEMKWSVLGKVV-LLVFILVHSSSASLSPTGINYEVVALMAIKNDLKDPYNVLE  53



>ref|XP_010940158.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Elaeis guineensis]
Length=629

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +1

Query  235  MARKWC-ILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            MAR+     + +LG +LW + E + ATLSP+G+NYEVVALMAIK  L+DPYNVLE
Sbjct  1    MARRVLGFAFWMLGLLLWAWPEMAAATLSPSGINYEVVALMAIKMELNDPYNVLE  55



>ref|XP_010319667.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
lycopersicum]
Length=575

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 5/54 (9%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M RKWC+   V+       +ES +A+LSPTG+NYEVVAL+ IK +LHDPYNVLE
Sbjct  1    MERKWCMFLYVV-----ALMESCYASLSPTGINYEVVALIEIKKALHDPYNVLE  49



>ref|XP_008812173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Phoenix dactylifera]
Length=629

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  259  YEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            + +LG +LW + E   ATLSP+G+NYEVVALMAIK  L+DPYNVLE
Sbjct  10   FWMLGLLLWAWPELPAATLSPSGINYEVVALMAIKMELNDPYNVLE  55



>ref|XP_009403877.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=626

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M RK  +L+  L  V   F+ SS ATLSP+G+NYEVVALMAIK  LHDPYNVLE
Sbjct  1    MGRK-ALLFWTLCLVPIDFLCSSSATLSPSGINYEVVALMAIKMELHDPYNVLE  53



>ref|XP_009403878.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=607

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M RK  +L+  L  V   F+ SS ATLSP+G+NYEVVALMAIK  LHDPYNVLE
Sbjct  1    MGRK-ALLFWTLCLVPIDFLCSSSATLSPSGINYEVVALMAIKMELHDPYNVLE  53



>ref|XP_009797107.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana sylvestris]
Length=520

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M R   +L+ V   ++   +E+SFATLSPTG+NYEVVAL  IK +LHDPYNVL+
Sbjct  8    MGRMLHLLWNVGLLLICTLMENSFATLSPTGINYEVVALTEIKKALHDPYNVLD  61



>ref|XP_010910388.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Elaeis guineensis]
Length=629

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  259  YEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            + +LG +LW    +S ATLSP+G+NYEVVALMAIK  L+DPYNVLE
Sbjct  10   FWMLGLLLWAGPLASAATLSPSGINYEVVALMAIKMELNDPYNVLE  55



>gb|KDO82335.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=540

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +GF++   I+  +ATLSP G+NYEVVAL+A+K +LHDPYNVLE
Sbjct  11   VGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDPYNVLE  53



>gb|KDO82334.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=623

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +GF++   I+  +ATLSP G+NYEVVAL+A+K +LHDPYNVLE
Sbjct  11   VGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDPYNVLE  53



>ref|XP_006483905.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Citrus sinensis]
Length=623

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +GF++   I+  +ATLSP G+NYEVVAL+A+K +LHDPYNVLE
Sbjct  11   VGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDPYNVLE  53



>ref|XP_006438322.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
 gb|ESR51562.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
Length=623

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +GF++   I+  +ATLSP G+NYEVVAL+A+K +LHDPYNVLE
Sbjct  11   VGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDPYNVLE  53



>ref|XP_007044708.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY00540.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
Length=626

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 1/54 (2%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M R+  +L+  LG ++   +  S ATLSPTG+N+EVVALMAIK +LHDPYNVLE
Sbjct  1    MDRRSLMLFR-LGLLVLALMGISSATLSPTGINFEVVALMAIKYNLHDPYNVLE  53



>gb|KJB61045.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=625

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LG ++      S ATLSPTG+NYEVVALMAIK++LHDPYNVLE
Sbjct  11   LGLLILALNGVSSATLSPTGINYEVVALMAIKSNLHDPYNVLE  53



>gb|KJB61041.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=628

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LG ++      S ATLSPTG+NYEVVALMAIK++LHDPYNVLE
Sbjct  11   LGLLILALNGVSSATLSPTGINYEVVALMAIKSNLHDPYNVLE  53



>gb|KJB61043.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=536

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LG ++      S ATLSPTG+NYEVVALMAIK++LHDPYNVLE
Sbjct  11   LGLLILALNGVSSATLSPTGINYEVVALMAIKSNLHDPYNVLE  53



>gb|KJB61042.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
 gb|KJB61044.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=391

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LG ++      S ATLSPTG+NYEVVALMAIK++LHDPYNVLE
Sbjct  11   LGLLILALNGVSSATLSPTGINYEVVALMAIKSNLHDPYNVLE  53



>ref|XP_004238646.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Solanum lycopersicum]
Length=603

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M R   + + V+  +    IESS ATLSP GVNYEVVAL  IK +LHDPYNVL+
Sbjct  1    MERMLHLFWNVVLLLFCTLIESSSATLSPAGVNYEVVALTEIKKALHDPYNVLD  54



>gb|EYU28436.1| hypothetical protein MIMGU_mgv1a002888mg [Erythranthe guttata]
Length=628

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  253  ILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            + ++V+  VL   ++ S++TLSP+GVNYEVVAL+AIK+ LHDPYNVLE
Sbjct  7    LFWQVVLLVL-AMVKGSYSTLSPSGVNYEVVALIAIKSDLHDPYNVLE  53



>ref|XP_011086598.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Sesamum indicum]
Length=625

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  256  LYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            L+  +G ++   +E S++TLSP+GVNYEVVAL+AIK  L DPYNVLE
Sbjct  7    LFWKVGLLVLAMVECSYSTLSPSGVNYEVVALIAIKNDLRDPYNVLE  53



>ref|XP_010251173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
 ref|XP_010251174.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
Length=628

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 2/45 (4%)
 Frame = +1

Query  268  LGFVLWV--FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +G VL V  ++E S ATLSP+GVNYEVVALMAIK  L+DPYNVLE
Sbjct  10   VGLVLLVLAWMEGSAATLSPSGVNYEVVALMAIKNDLNDPYNVLE  54



>gb|KDO82336.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=391

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +GF++   I+  +ATLSP G+NYEVVAL+A+K +LHDPYNVLE
Sbjct  11   VGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDPYNVLE  53



>ref|XP_010023506.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Eucalyptus grandis]
 gb|KCW59799.1| hypothetical protein EUGRSUZ_H02547 [Eucalyptus grandis]
Length=621

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  259  YEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            + V  F++  ++ S  A+LSP GVNYEV+ALMAIKT+LHDPYNVLE
Sbjct  3    WRVSCFLVLAWLGSCSASLSPAGVNYEVMALMAIKTALHDPYNVLE  48



>ref|XP_008813583.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Phoenix 
dactylifera]
Length=643

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  259  YEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            + +LG +LW     S ATLSP+G+NYEVVALMAI+  L+DPYNVLE
Sbjct  24   FWMLGLLLWAGPLVSAATLSPSGINYEVVALMAIRMELNDPYNVLE  69



>ref|XP_008813582.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Phoenix 
dactylifera]
Length=649

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  259  YEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            + +LG +LW     S ATLSP+G+NYEVVALMAI+  L+DPYNVLE
Sbjct  24   FWMLGLLLWAGPLVSAATLSPSGINYEVVALMAIRMELNDPYNVLE  69



>ref|XP_010100426.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
 gb|EXB82560.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
Length=637

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +1

Query  235  MARKWCILYEVLG--FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M +    L+ ++G   V    +++S ATLSPTG+NYEVVAL+AIKT+L+DP+NVLE
Sbjct  9    MGKSGSFLWNLVGALLVFLALLQASSATLSPTGINYEVVALVAIKTALNDPHNVLE  64



>ref|XP_011034116.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Populus 
euphratica]
Length=624

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            F++   +E S ATLSPTG+N+EVVALMAIKT+L DPYNVLE
Sbjct  14   FLVLALMEISSATLSPTGINFEVVALMAIKTALLDPYNVLE  54



>ref|XP_011034114.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011034115.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
Length=627

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            F++   +E S ATLSPTG+N+EVVALMAIKT+L DPYNVLE
Sbjct  14   FLVLALMEISSATLSPTGINFEVVALMAIKTALLDPYNVLE  54



>ref|XP_006392114.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
 gb|ESQ29400.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
Length=634

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  268  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LGF++ V F++ S ATLSPTGVNYEV AL+AIK  L+DPYNVLE
Sbjct  11   LGFLVLVWFLDVSSATLSPTGVNYEVTALVAIKNELNDPYNVLE  54



>ref|XP_008654537.1| PREDICTED: uncharacterized LOC100272802 isoform X1 [Zea mays]
 gb|AFW80157.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=630

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +1

Query  247  WCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            WC+    L   L   + SS ATLSP G+NYEVVALMAIKT L DPYNVL+
Sbjct  6    WCLPVAAL---LAAILPSSDATLSPAGINYEVVALMAIKTELEDPYNVLD  52



>dbj|BAD68255.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
 dbj|BAE96298.1| SERK like protein kinase [Oryza sativa Japonica Group]
 gb|EAZ10713.1| hypothetical protein OsJ_00547 [Oryza sativa Japonica Group]
 dbj|BAG94399.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70017.1| hypothetical protein OsI_00578 [Oryza sativa Indica Group]
Length=628

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  286  VFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            + + SS ATLSP G+NYEVVALMAIKT L DPYNVL+
Sbjct  17   ILLPSSTATLSPAGINYEVVALMAIKTELQDPYNVLD  53



>ref|XP_009596637.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana tomentosiformis]
Length=601

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  286  VFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            + +ESS ATLSPTG+NYEVVAL  IK +LHDPYNVL+
Sbjct  16   LMMESSSATLSPTGINYEVVALTEIKKALHDPYNVLD  52



>dbj|BAD68256.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
Length=418

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  286  VFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            + + SS ATLSP G+NYEVVALMAIKT L DPYNVL+
Sbjct  17   ILLPSSTATLSPAGINYEVVALMAIKTELQDPYNVLD  53



>emb|CDY61461.1| BnaC01g43240D [Brassica napus]
Length=635

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  268  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LGF++ V F + + ATLSPTGVNYEV AL+AIK+ L+DPYNVLE
Sbjct  11   LGFLVLVWFPDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLE  54



>ref|XP_010510907.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Camelina 
sativa]
Length=633

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 37/45 (82%), Gaps = 3/45 (7%)
 Frame = +1

Query  268  LGFVL--WVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LGF++  W+F + S ATLSPTGVNYEV AL+A+K  L+DPYNVLE
Sbjct  13   LGFLVLVWLF-DVSTATLSPTGVNYEVTALVAVKNELNDPYNVLE  56



>ref|XP_010510906.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Camelina 
sativa]
Length=636

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 37/45 (82%), Gaps = 3/45 (7%)
 Frame = +1

Query  268  LGFVL--WVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LGF++  W+F + S ATLSPTGVNYEV AL+A+K  L+DPYNVLE
Sbjct  13   LGFLVLVWLF-DVSTATLSPTGVNYEVTALVAVKNELNDPYNVLE  56



>ref|XP_004968347.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Setaria italica]
Length=633

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +A  W   + V+  +L V +  S ATLSP G+NYEVVALMAIKT L DP+NVL+
Sbjct  5    VAPMWMRWWVVVAGLLAVILPPSTATLSPAGINYEVVALMAIKTELEDPHNVLD  58



>ref|XP_006356418.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356419.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006356420.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Solanum 
tuberosum]
Length=600

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +1

Query  256  LYEVLGFVLW-VFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            L+  +G +L+   +ESS ATLSP GVNYEVVAL  IK +LHDPYNVL+
Sbjct  4    LFWNVGLLLFCTLMESSSATLSPAGVNYEVVALTEIKKALHDPYNVLD  51



>ref|XP_009104025.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brassica 
rapa]
Length=635

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  268  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LGF++ V F + + ATLSPTGVNYEV AL+AIK+ L+DPYNVLE
Sbjct  11   LGFLVLVWFHDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLE  54



>gb|AFO67891.1| leucine-rich repeat receptor-like kinase (mitochondrion) [Brassica 
rapa subsp. oleifera]
Length=635

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  268  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LGF++ V F + + ATLSPTGVNYEV AL+AIK+ L+DPYNVLE
Sbjct  11   LGFLVLVWFHDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLE  54



>ref|XP_009104018.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brassica 
rapa]
Length=636

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  268  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LGF++ V F + + ATLSPTGVNYEV AL+AIK+ L+DPYNVLE
Sbjct  11   LGFLVLVWFHDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLE  54



>emb|CDY46185.1| BnaA01g23070D [Brassica napus]
Length=636

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  268  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LGF++ V F + + ATLSPTGVNYEV AL+AIK+ L+DPYNVLE
Sbjct  11   LGFLVLVWFHDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLE  54



>ref|XP_006841062.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
 gb|ERN02737.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
Length=629

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 8/53 (15%)
 Frame = +1

Query  262  EVLGFVLWVFI--------ESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            EV  F+ W  +        +SSFATLSP+G+NYEVVALMAIK  L DP+NVLE
Sbjct  2    EVRAFLYWQLLSLVLALLGDSSFATLSPSGINYEVVALMAIKNDLVDPHNVLE  54



>ref|XP_006378225.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|ERP56022.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=624

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            F++   +E S ATLSP G+NYEVVAL+AIKT+L DPYNVL+
Sbjct  14   FLVLALMEISTATLSPAGINYEVVALVAIKTALRDPYNVLD  54



>ref|XP_010682518.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Beta vulgaris subsp. 
vulgaris]
Length=621

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +G + ++ + ++ ATLSPTGVNYEVVALMAIK  L DPY+ LE
Sbjct  8    VGLLFFILVGAASATLSPTGVNYEVVALMAIKNELKDPYDALE  50



>ref|XP_008221852.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Prunus 
mume]
Length=655

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  229  EIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            E M     +L++V G +L   IE+S ATLSPTGVNYEV AL+AIK+ L DP+NVLE
Sbjct  29   EYMGTTSFMLWKV-GLLLLASIEASSATLSPTGVNYEVEALVAIKSDLIDPHNVLE  83



>ref|XP_008221850.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Prunus 
mume]
Length=656

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  229  EIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            E M     +L++V G +L   IE+S ATLSPTGVNYEV AL+AIK+ L DP+NVLE
Sbjct  29   EYMGTTSFMLWKV-GLLLLASIEASSATLSPTGVNYEVEALVAIKSDLIDPHNVLE  83



>ref|XP_002886588.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62847.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  268  LGFVLWVFI-ESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LGF++ V++ + S ATLSPTGVNYEV AL+A+K  L+DPYNVLE
Sbjct  6    LGFLVLVWLLDVSTATLSPTGVNYEVTALVAVKNELNDPYNVLE  49



>ref|XP_010533910.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Tarenaya hassleriana]
Length=640

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 8/53 (15%)
 Frame = +1

Query  262  EVLGFVLWVF--------IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            E + FVLW          ++ S ATLSP+G+NYEVVALMAIK+ L+DPYNVLE
Sbjct  2    EGVRFVLWRLGFLVLVLLLDVSAATLSPSGINYEVVALMAIKSELNDPYNVLE  54



>ref|XP_009390158.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=659

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +1

Query  244  KWCILY--EVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +W +++    L  VL  F+  S ATLSP+G+NYEVVAL+AIK  L+DPYNVLE
Sbjct  34   EWKVVFFCRTLCLVLLHFLYLSAATLSPSGINYEVVALVAIKMELNDPYNVLE  86



>ref|XP_009390157.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390159.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390160.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=665

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +1

Query  244  KWCILY--EVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +W +++    L  VL  F+  S ATLSP+G+NYEVVAL+AIK  L+DPYNVLE
Sbjct  34   EWKVVFFCRTLCLVLLHFLYLSAATLSPSGINYEVVALVAIKMELNDPYNVLE  86



>gb|AAB71968.1| Putative Serine/Threonine protein kinase [Arabidopsis thaliana]
Length=588

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  268  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LGF+++V F + S ATLSPTGVNYEV AL+A+K  L+DPY VLE
Sbjct  11   LGFLVFVWFFDISSATLSPTGVNYEVTALVAVKNELNDPYKVLE  54



>ref|NP_176279.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
 sp|Q93ZS4.1|NIK3_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 3; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL07143.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AAN12912.1| putative receptor kinase [Arabidopsis thaliana]
 gb|ACN59261.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE33734.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
Length=632

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  268  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LGF+++V F + S ATLSPTGVNYEV AL+A+K  L+DPY VLE
Sbjct  11   LGFLVFVWFFDISSATLSPTGVNYEVTALVAVKNELNDPYKVLE  54



>ref|XP_008389688.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=630

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M R    L++ LG ++   +E++ ATLSPTGVNYEV AL AIK+ L DP+NVLE
Sbjct  8    MGRSTFTLWK-LGLLVLALVEAASATLSPTGVNYEVEALAAIKSDLRDPHNVLE  60



>ref|XP_008389687.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=631

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M R    L++ LG ++   +E++ ATLSPTGVNYEV AL AIK+ L DP+NVLE
Sbjct  8    MGRSTFTLWK-LGLLVLALVEAASATLSPTGVNYEVEALAAIKSDLRDPHNVLE  60



>ref|XP_008389685.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
 ref|XP_008389686.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=632

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M R    L++ LG ++   +E++ ATLSPTGVNYEV AL AIK+ L DP+NVLE
Sbjct  8    MGRSTFTLWK-LGLLVLALVEAASATLSPTGVNYEVEALAAIKSDLRDPHNVLE  60



>ref|XP_002455108.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
 gb|EES00228.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
Length=615

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  277  VLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +L V +  S ATLSP G+NYEVVALMAIKT L DPYNVL+
Sbjct  20   LLAVILPPSNATLSPAGINYEVVALMAIKTELEDPYNVLD  59



>emb|CAN75190.1| hypothetical protein VITISV_035381 [Vitis vinifera]
Length=608

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  292  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +E S ATLSP+G+NYEVVALM IK +L+DPYNVLE
Sbjct  1    MEGSSATLSPSGINYEVVALMTIKNNLNDPYNVLE  35



>ref|XP_010651607.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Vitis vinifera]
 emb|CBI28568.3| unnamed protein product [Vitis vinifera]
Length=626

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  292  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +E S ATLSP+G+NYEVVALM IK +L+DPYNVLE
Sbjct  19   MEGSSATLSPSGINYEVVALMTIKNNLNDPYNVLE  53



>gb|KCW86694.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=479

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLE  53



>ref|XP_010044599.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X6 [Eucalyptus 
grandis]
Length=578

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLE  53



>gb|KCW86689.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=598

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLE  53



>gb|KCW86690.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=622

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLE  53



>gb|KCW86687.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
 gb|KCW86688.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=622

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLE  53



>gb|KCW86693.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=623

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLE  53



>gb|KCW86692.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=623

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLE  53



>ref|XP_010044598.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X5 [Eucalyptus 
grandis]
Length=624

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLE  53



>ref|XP_010044597.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X4 [Eucalyptus 
grandis]
Length=625

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLE  53



>gb|KCW86691.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=625

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLE  53



>ref|XP_010044596.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Eucalyptus 
grandis]
Length=626

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLE  53



>ref|XP_010044595.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Eucalyptus 
grandis]
Length=626

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLE  53



>ref|XP_010044594.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Eucalyptus 
grandis]
Length=627

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLE  53



>gb|EPS59440.1| hypothetical protein M569_15369 [Genlisea aurea]
Length=82

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  238  ARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +RK  +L      +L +F    ++ LSP+GVNYEVVAL+ +K  LHDPYN LE
Sbjct  4    SRKNSLLLRTGLVILALFTGCCYSYLSPSGVNYEVVALIMVKRELHDPYNALE  56



>ref|XP_008340072.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=628

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LG ++    E+S ATLSPTGVNYEV AL AIK+ L DP+NVLE
Sbjct  18   LGLLVLALAEASSATLSPTGVNYEVEALAAIKSDLIDPHNVLE  60



>ref|XP_008340071.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=629

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LG ++    E+S ATLSPTGVNYEV AL AIK+ L DP+NVLE
Sbjct  18   LGLLVLALAEASSATLSPTGVNYEVEALAAIKSDLIDPHNVLE  60



>ref|XP_008340070.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=630

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LG ++    E+S ATLSPTGVNYEV AL AIK+ L DP+NVLE
Sbjct  18   LGLLVLALAEASSATLSPTGVNYEVEALAAIKSDLIDPHNVLE  60



>ref|NP_001169689.1| LOC100383570 precursor [Zea mays]
 gb|ACN34528.1| unknown [Zea mays]
 tpg|DAA53256.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=634

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  301  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            S ATLSP G+NYEVVALMAIKT L DPYNVL+
Sbjct  28   SNATLSPAGINYEVVALMAIKTELEDPYNVLD  59



>ref|XP_011463143.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=626

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +G ++ V  ++S ATLSPTGVNYEV AL+AIK+ L DP+NVLE
Sbjct  14   VGLLVLVLADASSATLSPTGVNYEVEALVAIKSDLIDPHNVLE  56



>ref|XP_004297396.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=629

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +G ++ V  ++S ATLSPTGVNYEV AL+AIK+ L DP+NVLE
Sbjct  14   VGLLVLVLADASSATLSPTGVNYEVEALVAIKSDLIDPHNVLE  56



>dbj|BAK02609.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=632

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  277  VLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            VL + +  + ATLSPTG+NYEVVALMAIKT L D YNVL+
Sbjct  17   VLCLLLPPAAATLSPTGINYEVVALMAIKTDLQDHYNVLD  56



>ref|XP_006301740.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
 gb|EOA34638.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
Length=634

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +1

Query  268  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            LGF++ V F++ S ATLSPTGVNYEV AL+A+K  L+DP NVL
Sbjct  11   LGFLVLVWFLDVSSATLSPTGVNYEVTALVAVKNELNDPDNVL  53



>ref|XP_002315684.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|EEF01855.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=628

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYE-VVALMAIKTSLHDPYNVLE  396
            F++   +E S ATLSP G+NYE VVAL+AIKT+L DPYNVL+
Sbjct  14   FLVLALMEISTATLSPAGINYEAVVALVAIKTALRDPYNVLD  55



>ref|XP_010418025.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  301  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            S ATLSPTGVNYEV AL+A+K  L+DPYNVLE
Sbjct  25   STATLSPTGVNYEVTALVAVKNELNDPYNVLE  56



>ref|XP_010418023.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  301  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            S ATLSPTGVNYEV AL+A+K  L+DPYNVLE
Sbjct  25   STATLSPTGVNYEVTALVAVKNELNDPYNVLE  56



>ref|XP_009625494.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana tomentosiformis]
Length=624

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +1

Query  265  VLGF-VLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            V GF VL  F+  S A L+P GVNYEV ALM IK SLHDP+NVL
Sbjct  9    VFGFLVLLSFLVYSNAMLTPAGVNYEVQALMEIKNSLHDPHNVL  52



>ref|XP_010473260.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  301  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            S ATLSPTGVNYEV AL+A+K  L+DPYNVLE
Sbjct  25   SSATLSPTGVNYEVTALVAVKNELNDPYNVLE  56



>ref|XP_010473259.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  301  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            S ATLSPTGVNYEV AL+A+K  L+DPYNVLE
Sbjct  25   SSATLSPTGVNYEVTALVAVKNELNDPYNVLE  56



>ref|XP_010248542.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +G ++  +IE S ATLSP+G+NYEV AL+ IKT L DP+NVL+
Sbjct  10   VGLLVLSWIEESSATLSPSGINYEVEALVNIKTGLRDPHNVLD  52



>ref|XP_010248541.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Nelumbo 
nucifera]
Length=626

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +G ++  +IE S ATLSP+G+NYEV AL+ IKT L DP+NVL+
Sbjct  10   VGLLVLSWIEESSATLSPSGINYEVEALVNIKTGLRDPHNVLD  52



>ref|XP_009765506.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana sylvestris]
Length=624

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +1

Query  265  VLGF-VLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            VL F +L+ F+  S A L+P GVNYEV ALM IK SLHDP+NVL
Sbjct  9    VLAFLILFSFLFYSNAMLTPAGVNYEVQALMEIKNSLHDPHNVL  52



>ref|XP_007157369.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
 gb|ESW29363.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
Length=623

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  292  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +E S A LSP+G+NYEVVALMAIK +L DP+NVLE
Sbjct  19   MEISSAALSPSGINYEVVALMAIKGALTDPHNVLE  53



>ref|XP_003613191.1| Leucine-rich repeat receptor-like kinase [Medicago truncatula]
 gb|ADO15296.1| somatic embryogenesis receptor kinase-like protein 2 [Medicago 
truncatula]
 gb|AES96149.1| LRR receptor-like kinase [Medicago truncatula]
Length=625

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  292  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            ++ S A LSP+G+NYEVVALMAIK  L+DP+NVLE
Sbjct  19   MKVSSAALSPSGINYEVVALMAIKNDLNDPHNVLE  53



>gb|ACM89541.1| leucine-rich repeat receptor-like kinase [Glycine max]
Length=515

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  292  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +E S A LSP+G+NYEVVALMAIK  L DP+NVLE
Sbjct  1    MEISSAALSPSGINYEVVALMAIKNDLIDPHNVLE  35



>ref|XP_004489819.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cicer arietinum]
Length=625

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  301  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            S A LSP+G+NYEVVALMAIK  L+DP+NVLE
Sbjct  22   SSAALSPSGINYEVVALMAIKNELNDPHNVLE  53



>ref|XP_010230511.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X4 [Brachypodium 
distachyon]
Length=601

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  301  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            S ATLSP G+NYEVVALMAIKT L D YNVL+
Sbjct  24   SAATLSPAGINYEVVALMAIKTELQDHYNVLD  55



>ref|XP_010230510.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Brachypodium 
distachyon]
Length=603

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  301  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            S ATLSP G+NYEVVALMAIKT L D YNVL+
Sbjct  24   SAATLSPAGINYEVVALMAIKTELQDHYNVLD  55



>ref|XP_003569325.2| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brachypodium 
distachyon]
Length=631

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  301  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            S ATLSP G+NYEVVALMAIKT L D YNVL+
Sbjct  24   SAATLSPAGINYEVVALMAIKTELQDHYNVLD  55



>ref|XP_010230509.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brachypodium 
distachyon]
Length=633

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  301  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            S ATLSP G+NYEVVALMAIKT L D YNVL+
Sbjct  24   SAATLSPAGINYEVVALMAIKTELQDHYNVLD  55



>gb|KHN00370.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=624

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  292  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +E S A LSP+G+NYEVVALMAIK  L DP+NVLE
Sbjct  20   MEISSAALSPSGINYEVVALMAIKNDLIDPHNVLE  54



>ref|XP_003519642.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform 1 [Glycine 
max]
Length=624

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  292  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +E S A LSP+G+NYEVVALMAIK  L DP+NVLE
Sbjct  20   MEISSAALSPSGINYEVVALMAIKNDLIDPHNVLE  54



>gb|KHN14560.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=623

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  292  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +E S A LSP+G+NYEVVALMAIK  L DP+NVLE
Sbjct  19   MEISSAALSPSGINYEVVALMAIKNGLIDPHNVLE  53



>ref|XP_003517653.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Glycine max]
Length=623

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  292  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +E S A LSP+G+NYEVVALMAIK  L DP+NVLE
Sbjct  19   MEISSAALSPSGINYEVVALMAIKNGLIDPHNVLE  53



>gb|EPS73511.1| hypothetical protein M569_01245, partial [Genlisea aurea]
Length=636

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  307  ATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +TLSP+GVNYEVVAL++IK SL+DPYN LE
Sbjct  1    STLSPSGVNYEVVALISIKGSLNDPYNALE  30



>ref|XP_006380012.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
 gb|ERP57809.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
Length=622

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            F++   +E S ATLSPTG+N+E  AL+AIKT+L DPYNVLE
Sbjct  14   FLVLALMEISSATLSPTGINFE--ALVAIKTALLDPYNVLE  52



>ref|XP_002312685.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE90052.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=625

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +1

Query  274  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            F++   +E S ATLSPTG+N+E  AL+AIKT+L DPYNVLE
Sbjct  14   FLVLALMEISSATLSPTGINFE--ALVAIKTALLDPYNVLE  52



>ref|XP_004238998.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=621

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = +1

Query  265  VLGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            V GFV L+ F+  S A L+P GVNYEV ALM IK SLHDP  VL
Sbjct  6    VFGFVVLFSFLVYSNAMLTPGGVNYEVQALMEIKNSLHDPLGVL  49



>ref|XP_004142972.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cucumis sativus]
 gb|KGN62304.1| hypothetical protein Csa_2G348900 [Cucumis sativus]
Length=621

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  307  ATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            ATLSP+GVN+EVVALMAIK  L DP+NVLE
Sbjct  23   ATLSPSGVNFEVVALMAIKYDLLDPHNVLE  52



>gb|KDP31451.1| hypothetical protein JCGZ_11827 [Jatropha curcas]
Length=621

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  298  SSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            +++  LSP GVNYEVVALM+IK  LHDP+NVL
Sbjct  21   TAYGLLSPKGVNYEVVALMSIKGLLHDPHNVL  52



>ref|XP_006348615.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=621

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +1

Query  265  VLGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            V GFV L  F+  S A L+P GVNYEV ALM IK SLHDP  VL
Sbjct  6    VFGFVVLLSFLVYSNAMLTPGGVNYEVQALMEIKNSLHDPLGVL  49



>ref|XP_010558548.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Tarenaya 
hassleriana]
Length=636

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             GF+L   + S+ A LSP GVN+EV ALM IK SLHDP+ VLE
Sbjct  19   FGFLL--LLGSANALLSPQGVNFEVQALMDIKASLHDPHGVLE  59



>ref|XP_010558545.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558546.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
Length=637

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
             GF+L   + S+ A LSP GVN+EV ALM IK SLHDP+ VLE
Sbjct  19   FGFLL--LLGSANALLSPQGVNFEVQALMDIKASLHDPHGVLE  59



>ref|XP_010549936.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Tarenaya hassleriana]
 gb|ABD96874.1| hypothetical protein [Cleome spinosa]
Length=634

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 39/55 (71%), Gaps = 4/55 (7%)
 Frame = +1

Query  232  IMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +M R++ + +   GF LW+ + S+ A LSP GVN+EV ALM IK SL+DP+ VLE
Sbjct  10   VMIRRFSVCF--FGF-LWL-LGSASALLSPQGVNFEVRALMDIKASLNDPHGVLE  60



>ref|XP_008444352.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Cucumis 
melo]
Length=621

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  310  TLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            TLSP+GVN+EVVALMAIK  L DP+NVLE
Sbjct  24   TLSPSGVNFEVVALMAIKYDLLDPHNVLE  52



>ref|XP_010032589.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Eucalyptus grandis]
 gb|KCW52001.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
 gb|KCW52002.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
Length=629

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  280  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LW++  S+   LSP GVN+EV ALM IK  LHDP+NVLE
Sbjct  22   LWIW-NSANGLLSPKGVNFEVQALMRIKDCLHDPHNVLE  59



>ref|XP_008459453.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Cucumis melo]
Length=626

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  280  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            L +++ S  A LSP GVNYEV ALM IK SL DP+ VLE
Sbjct  17   LLIWVSSINALLSPKGVNYEVQALMGIKASLQDPHGVLE  55



>ref|XP_009391273.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 1/53 (2%)
 Frame = +1

Query  238  ARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            A++ C  YE+   V      S+   LSP GVNYEV ALM +K SL DP++VLE
Sbjct  23   AKRSC-EYELFALVFLFSWVSAAGVLSPKGVNYEVQALMGVKASLKDPHSVLE  74



>ref|XP_009391272.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=646

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 1/53 (2%)
 Frame = +1

Query  238  ARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            A++ C  YE+   V      S+   LSP GVNYEV ALM +K SL DP++VLE
Sbjct  23   AKRSC-EYELFALVFLFSWVSAAGVLSPKGVNYEVQALMGVKASLKDPHSVLE  74



>gb|KHN14464.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=623

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  265  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +L F  ++F  S+ A LSP GVN+EV ALM IK SL DP+ VL+
Sbjct  9    LLSFTSFLFWSSANALLSPKGVNFEVQALMGIKYSLEDPHGVLD  52



>ref|XP_003531900.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Glycine max]
Length=623

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  265  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +L F  ++F  S+ A LSP GVN+EV ALM IK SL DP+ VL+
Sbjct  9    LLSFTSFLFWSSANALLSPKGVNFEVQALMGIKYSLEDPHGVLD  52



>ref|XP_009596697.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=603

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +1

Query  265  VLGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            VLG++ L+ F+  + A L+P GVNYEV ALM IK  L+DP+NVL
Sbjct  4    VLGYLTLFCFLAYANAMLTPAGVNYEVQALMEIKKVLNDPHNVL  47



>ref|XP_009596696.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=621

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +1

Query  265  VLGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            VLG++ L+ F+  + A L+P GVNYEV ALM IK  L+DP+NVL
Sbjct  4    VLGYLTLFCFLAYANAMLTPAGVNYEVQALMEIKKVLNDPHNVL  47



>ref|XP_011009019.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +1

Query  232  IMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            ++ARK   L+  +G ++ ++  +++  L+ TGVN+EV ALM IK SLHDP++VL+
Sbjct  1    MVARKKNALFCCVGLLICLW-NTAYGELTATGVNFEVEALMGIKASLHDPHDVLK  54



>ref|XP_002314905.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
 gb|EEF01076.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
Length=627

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +1

Query  232  IMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            ++ARK   L+  +G ++ ++  +++  L+ TGVN+EV ALM IK SLHDP++VL+
Sbjct  1    MVARKKNALFCCVGLLICLW-NTAYGELTATGVNFEVEALMGIKASLHDPHDVLK  54



>gb|KDO70179.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=400

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 3/53 (6%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            M R+  +   V  F LW     +   LSP GVNYEV ALM IK SLHDP++VL
Sbjct  1    MRREEAVFCFVALFGLWT---CACGLLSPKGVNYEVQALMGIKDSLHDPHDVL  50



>ref|XP_002532890.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF29495.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=624

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +1

Query  277  VLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +LW F  ++   LSP GVN+EV ALM IK SLHDP+ VL+
Sbjct  15   LLW-FCSTANGLLSPKGVNFEVQALMGIKASLHDPHGVLD  53



>gb|KDO70178.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=517

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 3/53 (6%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            M R+  +   V  F LW     +   LSP GVNYEV ALM IK SLHDP++VL
Sbjct  1    MRREEAVFCFVALFGLWT---CACGLLSPKGVNYEVQALMGIKDSLHDPHDVL  50



>ref|XP_006484307.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Citrus sinensis]
 gb|KDO70177.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=621

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 3/53 (6%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            M R+  +   V  F LW     +   LSP GVNYEV ALM IK SLHDP++VL
Sbjct  1    MRREEAVFCFVALFGLWT---CACGLLSPKGVNYEVQALMGIKDSLHDPHDVL  50



>ref|XP_006437790.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
 gb|ESR51030.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
Length=621

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 3/53 (6%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            M R+  +   V  F LW     +   LSP GVNYEV ALM IK SLHDP++VL
Sbjct  1    MRREEAVFCFVALFGLWT---CACGLLSPKGVNYEVQALMGIKDSLHDPHDVL  50



>ref|XP_009803966.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
sylvestris]
Length=602

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +1

Query  265  VLGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            +LG++ L+ F+  + A L+P GVNYEV ALM IK +L DP+NVL
Sbjct  4    ILGYLTLFSFLAYANAMLTPAGVNYEVQALMEIKKALTDPHNVL  47



>ref|XP_009803965.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
sylvestris]
Length=620

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +1

Query  265  VLGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVL  393
            +LG++ L+ F+  + A L+P GVNYEV ALM IK +L DP+NVL
Sbjct  4    ILGYLTLFSFLAYANAMLTPAGVNYEVQALMEIKKALTDPHNVL  47



>ref|XP_006603947.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Glycine 
max]
Length=510

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +1

Query  262  EVLGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +VL FVL+  F   S A LSP GVN+EV+ALM IK SL DP+ +L+
Sbjct  8    DVLCFVLFFWFCSFSNALLSPKGVNFEVLALMGIKASLVDPHGILD  53



>gb|KHN30771.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=619

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +1

Query  262  EVLGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +VL FVL+  F   S A LSP GVN+EV+ALM IK SL DP+ +L+
Sbjct  8    DVLCFVLFFWFCSFSNALLSPKGVNFEVLALMGIKASLVDPHGILD  53



>ref|XP_003555046.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoformX1 [Glycine 
max]
Length=624

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +1

Query  262  EVLGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +VL FVL+  F   S A LSP GVN+EV+ALM IK SL DP+ +L+
Sbjct  8    DVLCFVLFFWFCSFSNALLSPKGVNFEVLALMGIKASLVDPHGILD  53



>ref|XP_007139356.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 ref|XP_007139357.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11350.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11351.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
Length=623

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  265  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +L + L+ F  S+ A LSP GVN+EV ALM+IK SL DP+ VL+
Sbjct  9    LLFYTLFFFWCSADAVLSPKGVNFEVQALMSIKQSLEDPHGVLD  52



>ref|XP_009418103.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=573

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 3/44 (7%)
 Frame = +1

Query  265  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            VL F  WV   ++ A LSP GVN+EV ALM IK SL DP+ VLE
Sbjct  13   VLFFWPWV---TATAMLSPKGVNFEVQALMGIKASLEDPHGVLE  53



>gb|KJB43138.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=625

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 3/54 (6%)
 Frame = +1

Query  235  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            M R+    Y +     WV I      LSP GVNYEV ALMAIK +LHDP+ VL+
Sbjct  3    MRRREMGFYFLAFLWFWVPIN---GLLSPKGVNYEVQALMAIKDALHDPHGVLD  53



>ref|XP_009418102.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=623

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 3/44 (7%)
 Frame = +1

Query  265  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            VL F  WV   ++ A LSP GVN+EV ALM IK SL DP+ VLE
Sbjct  13   VLFFWPWV---TATAMLSPKGVNFEVQALMGIKASLEDPHGVLE  53



>ref|XP_009417562.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=638

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  280  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LW +  ++ A LSP GVNYEV ALM +K SL DP++VLE
Sbjct  27   LWTWSPAA-AVLSPKGVNYEVQALMGVKASLKDPHSVLE  64



>ref|XP_009417563.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=542

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  280  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LW +  ++ A LSP GVNYEV ALM +K SL DP++VLE
Sbjct  27   LWTWSPAA-AVLSPKGVNYEVQALMGVKASLKDPHSVLE  64



>ref|XP_006338306.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=626

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 31/51 (61%), Gaps = 3/51 (6%)
 Frame = +1

Query  244  KWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            K   LY     VLW    S+   LSP GVN+EV ALMAIK +L DP+ VL+
Sbjct  8    KVAFLYVATFLVLW---SSAAGLLSPKGVNFEVQALMAIKVALKDPHGVLD  55



>gb|KDP24340.1| hypothetical protein JCGZ_25636 [Jatropha curcas]
Length=624

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  298  SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            +++  LSP GVN+EV ALM IK SLHDP+ VL+
Sbjct  21   TAYGLLSPKGVNFEVQALMGIKASLHDPHGVLD  53



>ref|XP_007033440.1| NSP-interacting kinase 1 [Theobroma cacao]
 gb|EOY04366.1| NSP-interacting kinase 1 [Theobroma cacao]
Length=649

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  280  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LW F   +   LSP GVNYEV +LMAIK +LHDP+ VL+
Sbjct  21   LW-FWAPTNGLLSPKGVNYEVQSLMAIKAALHDPHGVLD  58



>ref|XP_011012715.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  280  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LW F  ++   LSP GVNYEV AL+ IK SLHDP+ VL+
Sbjct  19   LW-FSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLD  56



>ref|XP_006384231.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|ERP62028.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=626

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  280  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LW F  ++   LSP GVNYEV AL+ IK SLHDP+ VL+
Sbjct  19   LW-FSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLD  56



>ref|XP_011012714.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  280  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LW F  ++   LSP GVNYEV AL+ IK SLHDP+ VL+
Sbjct  19   LW-FSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLD  56



>ref|XP_002305306.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|EEE85817.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=627

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  280  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LW F  ++   LSP GVNYEV AL+ IK SLHDP+ VL+
Sbjct  19   LW-FSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLD  56



>gb|AAM65586.1| receptor protein kinase-like protein [Arabidopsis thaliana]
Length=629

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 1/43 (2%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LGF L +   S    LSP GVN+EV ALM IK SLHDP+ VL+
Sbjct  10   LGF-LCLLCSSVHGLLSPKGVNFEVQALMDIKASLHDPHGVLD  51



>ref|NP_197104.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
 sp|Q9LFS4.1|NIK1_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 1; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK1; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC01799.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAL66960.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAN86199.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59368.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED92233.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
Length=638

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 1/43 (2%)
 Frame = +1

Query  268  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            LGF L +   S    LSP GVN+EV ALM IK SLHDP+ VL+
Sbjct  19   LGF-LCLLCSSVHGLLSPKGVNFEVQALMDIKASLHDPHGVLD  60



>gb|KJB80538.1| hypothetical protein B456_013G102600 [Gossypium raimondii]
Length=624

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 6/50 (12%)
 Frame = +1

Query  247  WCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            WC +      VL++F  S+ A LSP GVN+EV ALM IK  L DP+ VL+
Sbjct  10   WCWV------VLFLFCSSATALLSPKGVNFEVQALMGIKELLVDPHGVLD  53



>gb|KHG05227.1| nsp-interacting kinase 2 -like protein [Gossypium arboreum]
Length=624

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 6/50 (12%)
 Frame = +1

Query  247  WCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            WC +      VL++F  S+ A LSP GVN+EV ALM IK  L DP+ VL+
Sbjct  10   WCWV------VLFLFCSSATALLSPKGVNFEVQALMGIKELLVDPHGVLD  53



>ref|XP_004141483.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 gb|KGN52542.1| hypothetical protein Csa_5G642730 [Cucumis sativus]
Length=626

 Score = 47.8 bits (112),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 27/44 (61%), Gaps = 2/44 (5%)
 Frame = +1

Query  265  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  396
            V   + WV   S    LSP GVNYEV ALM IK SL DP+ VLE
Sbjct  14   VASLLFWV--SSINGLLSPKGVNYEVQALMGIKASLQDPHGVLE  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556972490900