BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF009I18

Length=368
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009604694.1|  PREDICTED: transcription factor MYC3-like        94.4    6e-20   Nicotiana tomentosiformis
ref|XP_009776117.1|  PREDICTED: transcription factor MYC2-like        94.0    7e-20   Nicotiana sylvestris
ref|XP_007051457.1|  Basic helix-loop-helix DNA-binding family pr...  90.9    1e-18   
ref|XP_010100678.1|  hypothetical protein L484_023447                 88.2    1e-17   Morus notabilis
gb|KJB24531.1|  hypothetical protein B456_004G149500                  86.7    3e-17   Gossypium raimondii
ref|XP_002301432.1|  basic helix-loop-helix family protein            86.3    4e-17   Populus trichocarpa [western balsam poplar]
gb|ABK94979.1|  unknown                                               86.3    5e-17   Populus trichocarpa [western balsam poplar]
ref|XP_006362125.1|  PREDICTED: transcription factor MYC2-like        85.9    6e-17   Solanum tuberosum [potatoes]
ref|XP_011023113.1|  PREDICTED: transcription factor MYC2-like        85.1    1e-16   Populus euphratica
ref|XP_004248092.1|  PREDICTED: transcription factor MYC3-like        84.3    2e-16   Solanum lycopersicum
ref|XP_008370350.1|  PREDICTED: transcription factor MYC2             84.3    2e-16   
gb|KJB09595.1|  hypothetical protein B456_001G151700                  84.0    3e-16   Gossypium raimondii
ref|XP_009375455.1|  PREDICTED: transcription factor MYC2-like        83.6    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_002529965.1|  DNA binding protein, putative                    83.2    5e-16   Ricinus communis
ref|XP_011039030.1|  PREDICTED: transcription factor MYC2 isoform X2  82.4    1e-15   Populus euphratica
ref|XP_011039024.1|  PREDICTED: transcription factor MYC2 isoform X1  82.4    1e-15   Populus euphratica
ref|XP_002266775.1|  PREDICTED: transcription factor MYC2-like        82.4    1e-15   Vitis vinifera
emb|CBI38690.3|  unnamed protein product                              80.9    1e-15   Vitis vinifera
gb|KDO86574.1|  hypothetical protein CISIN_1g046178mg                 81.6    2e-15   Citrus sinensis [apfelsine]
ref|XP_006444764.1|  hypothetical protein CICLE_v10019749mg           81.6    3e-15   Citrus clementina [clementine]
ref|XP_008345582.1|  PREDICTED: transcription factor bHLH14-like      80.9    3e-15   
ref|XP_002320222.1|  basic helix-loop-helix family protein            80.5    4e-15   
ref|XP_009623539.1|  PREDICTED: transcription factor MYC3-like is...  80.1    6e-15   Nicotiana tomentosiformis
gb|KJB49615.1|  hypothetical protein B456_008G128800                  79.0    2e-14   Gossypium raimondii
ref|XP_008233076.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  79.0    2e-14   Prunus mume [ume]
ref|XP_007219048.1|  hypothetical protein PRUPE_ppa004680mg           79.0    2e-14   Prunus persica
ref|XP_009592442.1|  PREDICTED: transcription factor MYC2-like        78.2    3e-14   Nicotiana tomentosiformis
gb|KJB41602.1|  hypothetical protein B456_007G111800                  78.2    3e-14   Gossypium raimondii
ref|XP_009623534.1|  PREDICTED: transcription factor MYC2-like is...  78.2    4e-14   
ref|XP_004230022.1|  PREDICTED: transcription factor MYC2-like is...  76.3    1e-13   Solanum lycopersicum
ref|XP_004230021.1|  PREDICTED: transcription factor MYC2-like is...  76.3    1e-13   Solanum lycopersicum
ref|XP_010031905.1|  PREDICTED: transcription factor MYC2-like        75.5    3e-13   Eucalyptus grandis [rose gum]
gb|KCW83845.1|  hypothetical protein EUGRSUZ_B00713                   75.5    3e-13   Eucalyptus grandis [rose gum]
ref|XP_006357552.1|  PREDICTED: transcription factor MYC2-like        75.5    3e-13   Solanum tuberosum [potatoes]
gb|KJB24138.1|  hypothetical protein B456_004G129600                  75.1    4e-13   Gossypium raimondii
ref|XP_010054972.1|  PREDICTED: transcription factor MYC2             74.7    6e-13   Eucalyptus grandis [rose gum]
ref|XP_011094312.1|  PREDICTED: transcription factor MYC2             73.9    8e-13   Sesamum indicum [beniseed]
ref|XP_011081344.1|  PREDICTED: transcription factor MYC2-like        73.9    1e-12   Sesamum indicum [beniseed]
gb|KEH18600.1|  basic helix loop helix (bHLH) family transcriptio...  73.9    1e-12   Medicago truncatula
gb|ACF19982.1|  MYC2                                                  72.8    3e-12   Hevea brasiliensis [jebe]
gb|ADK91082.1|  LMYC2                                                 72.8    3e-12   Hevea brasiliensis [jebe]
ref|XP_009766909.1|  PREDICTED: transcription factor MYC2             72.4    3e-12   Nicotiana sylvestris
ref|XP_004306627.1|  PREDICTED: transcription factor MYC2             72.4    3e-12   Fragaria vesca subsp. vesca
gb|KJB52372.1|  hypothetical protein B456_008G259000                  72.4    3e-12   Gossypium raimondii
gb|AEG74014.1|  lMYC4                                                 72.0    4e-12   Hevea brasiliensis [jebe]
gb|ACF05947.1|  MYC1                                                  71.6    5e-12   Hevea brasiliensis [jebe]
ref|XP_009775258.1|  PREDICTED: transcription factor MYC2-like        71.2    6e-12   Nicotiana sylvestris
gb|ADK56287.1|  LMYC1                                                 71.2    8e-12   Hevea brasiliensis [jebe]
gb|AEG74013.1|  lMYC3                                                 70.9    1e-11   Hevea brasiliensis [jebe]
ref|XP_007039384.1|  Basic helix-loop-helix DNA-binding family pr...  69.7    2e-11   
ref|XP_006476285.1|  PREDICTED: transcription factor MYC2-like        69.3    4e-11   Citrus sinensis [apfelsine]
gb|KDO76730.1|  hypothetical protein CISIN_1g010053mg                 69.3    4e-11   Citrus sinensis [apfelsine]
ref|XP_006439218.1|  hypothetical protein CICLE_v10019730mg           69.3    4e-11   
ref|XP_010267440.1|  PREDICTED: transcription factor MYC2             69.3    4e-11   Nelumbo nucifera [Indian lotus]
ref|XP_002303693.2|  hypothetical protein POPTR_0003s14710g           68.6    6e-11   Populus trichocarpa [western balsam poplar]
ref|XP_007151965.1|  hypothetical protein PHAVU_004G090300g           68.2    8e-11   Phaseolus vulgaris [French bean]
ref|XP_009796881.1|  PREDICTED: transcription factor MYC2-like        67.8    1e-10   Nicotiana sylvestris
ref|XP_009590627.1|  PREDICTED: transcription factor bHLH14-like      67.4    2e-10   Nicotiana tomentosiformis
ref|XP_011022409.1|  PREDICTED: transcription factor MYC2-like        66.6    3e-10   Populus euphratica
ref|XP_004244656.1|  PREDICTED: transcription factor bHLH14-like      66.6    3e-10   Solanum lycopersicum
gb|KDP25207.1|  hypothetical protein JCGZ_20363                       66.6    4e-10   Jatropha curcas
emb|CDP12229.1|  unnamed protein product                              66.2    4e-10   Coffea canephora [robusta coffee]
ref|XP_002299425.1|  hypothetical protein POPTR_0001s11400g           66.2    4e-10   Populus trichocarpa [western balsam poplar]
ref|XP_011026782.1|  PREDICTED: transcription factor MYC2-like        66.2    5e-10   Populus euphratica
ref|XP_006352213.1|  PREDICTED: transcription factor ATR2-like        65.9    6e-10   Solanum tuberosum [potatoes]
ref|XP_010058370.1|  PREDICTED: transcription factor MYC2-like        65.5    8e-10   Eucalyptus grandis [rose gum]
gb|KDP28433.1|  hypothetical protein JCGZ_14204                       65.5    9e-10   Jatropha curcas
ref|XP_002518914.1|  DNA binding protein, putative                    64.7    1e-09   Ricinus communis
ref|XP_010058366.1|  PREDICTED: transcription factor MYC4-like        64.3    2e-09   Eucalyptus grandis [rose gum]
ref|XP_003520013.2|  PREDICTED: transcription factor MYC2-like        63.9    2e-09   Glycine max [soybeans]
gb|KHN47226.1|  Transcription factor bHLH14-like protein              63.2    3e-09   Glycine soja [wild soybean]
ref|XP_010058369.1|  PREDICTED: transcription factor MYC2-like        63.5    3e-09   Eucalyptus grandis [rose gum]
ref|XP_011028179.1|  PREDICTED: transcription factor MYC2-like        63.5    5e-09   Populus euphratica
gb|KJB37703.1|  hypothetical protein B456_006G216700                  63.5    6e-09   Gossypium raimondii
ref|XP_007209110.1|  hypothetical protein PRUPE_ppa005343mg           62.8    6e-09   
ref|XP_008245836.1|  PREDICTED: transcription factor bHLH14-like ...  62.8    8e-09   
ref|XP_010104300.1|  hypothetical protein L484_023250                 62.8    8e-09   Morus notabilis
ref|XP_008245834.1|  PREDICTED: transcription factor bHLH14-like ...  62.4    8e-09   Prunus mume [ume]
ref|XP_010556617.1|  PREDICTED: transcription factor bHLH14           62.4    9e-09   Tarenaya hassleriana [spider flower]
gb|ACM48567.1|  JAMYC                                                 62.4    1e-08   Taxus cuspidata [ichii]
gb|EYU32289.1|  hypothetical protein MIMGU_mgv1a007575mg              61.6    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_002280253.1|  PREDICTED: transcription factor MYC2-like        61.6    2e-08   
ref|XP_004510627.1|  PREDICTED: transcription factor bHLH14-like      61.2    2e-08   Cicer arietinum [garbanzo]
ref|XP_010275210.1|  PREDICTED: transcription factor MYC2-like        61.6    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010273162.1|  PREDICTED: transcription factor MYC2-like        61.6    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_006368399.1|  phaseolin G-box binding protein PG2              61.6    3e-08   
ref|XP_007039493.1|  Basic helix-loop-helix DNA-binding family pr...  61.2    3e-08   
ref|XP_004148739.1|  PREDICTED: transcription factor MYC2-like        61.2    3e-08   Cucumis sativus [cucumbers]
ref|XP_008448683.1|  PREDICTED: transcription factor MYC2-like        61.2    3e-08   Cucumis melo [Oriental melon]
ref|XP_002519814.1|  Transcription factor AtMYC2, putative            61.2    3e-08   Ricinus communis
gb|KDP22548.1|  hypothetical protein JCGZ_26379                       60.5    4e-08   Jatropha curcas
ref|XP_010056012.1|  PREDICTED: transcription factor MYC2-like        60.5    4e-08   
ref|XP_010058368.1|  PREDICTED: transcription factor MYC2-like        60.5    5e-08   Eucalyptus grandis [rose gum]
gb|KCW72573.1|  hypothetical protein EUGRSUZ_E01042                   60.1    6e-08   Eucalyptus grandis [rose gum]
gb|AEJ88337.1|  putative MYC protein                                  60.1    6e-08   Tamarix hispida
ref|XP_006343781.1|  PREDICTED: transcription factor MYC2-like        59.7    6e-08   
ref|XP_010058362.1|  PREDICTED: transcription factor MYC2-like        60.1    6e-08   
ref|XP_010058361.1|  PREDICTED: transcription factor MYC2-like        60.1    6e-08   Eucalyptus grandis [rose gum]
ref|XP_006385657.1|  phaseolin G-box binding protein PG2              60.1    8e-08   
ref|XP_002279973.1|  PREDICTED: transcription factor MYC4             59.7    9e-08   Vitis vinifera
gb|ABR16623.1|  unknown                                               59.7    9e-08   Picea sitchensis
ref|XP_010540785.1|  PREDICTED: transcription factor MYC2-like is...  59.7    9e-08   Tarenaya hassleriana [spider flower]
dbj|BAJ91022.1|  predicted protein                                    59.7    9e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91674.1|  predicted protein                                    59.7    1e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006428423.1|  hypothetical protein CICLE_v10011214mg           59.7    1e-07   Citrus clementina [clementine]
gb|KDO44754.1|  hypothetical protein CISIN_1g005651mg                 59.7    1e-07   Citrus sinensis [apfelsine]
ref|XP_011018569.1|  PREDICTED: transcription factor MYC2-like        59.7    1e-07   Populus euphratica
dbj|BAJ86015.1|  predicted protein                                    59.7    1e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010461111.1|  PREDICTED: transcription factor MYC2-like        59.3    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_003516794.1|  PREDICTED: transcription factor MYC2-like        59.3    1e-07   Glycine max [soybeans]
emb|CDX73261.1|  BnaC05g28450D                                        58.9    1e-07   
gb|KJB51639.1|  hypothetical protein B456_008G226300                  59.3    1e-07   Gossypium raimondii
ref|XP_003531962.1|  PREDICTED: transcription factor MYC2             59.3    1e-07   Glycine max [soybeans]
ref|XP_008245388.1|  PREDICTED: transcription factor MYC2-like        58.9    1e-07   
gb|EEC67493.1|  hypothetical protein OsI_34761                        58.9    2e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_003612908.1|  Transcription factor MYC2                        57.0    2e-07   Medicago truncatula
gb|ABS11038.1|  MYC                                                   58.9    2e-07   Brassica oleracea var. gemmifera
emb|CDY26910.1|  BnaA05g18020D                                        58.5    2e-07   Brassica napus [oilseed rape]
ref|XP_006303928.1|  hypothetical protein CARUB_v10008586mg           58.9    2e-07   Capsella rubella
ref|XP_009151447.1|  PREDICTED: transcription factor MYC2             58.9    2e-07   Brassica rapa
ref|XP_009765330.1|  PREDICTED: transcription factor MYC2-like        58.5    2e-07   Nicotiana sylvestris
ref|XP_002893732.1|  ATMYC2                                           58.9    2e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_006662628.1|  PREDICTED: transcription factor MYC2-like        58.5    2e-07   
ref|XP_003574381.1|  PREDICTED: transcription factor MYC4-like        58.9    2e-07   Brachypodium distachyon [annual false brome]
ref|XP_009384126.1|  PREDICTED: transcription factor MYC4-like        58.9    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010463090.1|  PREDICTED: transcription factor MYC2-like        58.5    2e-07   
gb|AAL55713.1|AF251691_1  putative transcription factor BHLH6         58.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174541.1|  transcription factor MYC2                           58.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA25078.1|  RD22BP1                                              58.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478689.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  58.5    2e-07   
ref|XP_004246085.1|  PREDICTED: transcription factor bHLH14-like      58.2    2e-07   
gb|KEH27718.1|  basic helix loop helix (BHLH) family transcriptio...  57.0    2e-07   Medicago truncatula
gb|AAK00453.1|AC060755_23  putative MYC transcription factor          58.5    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|AEG74015.1|  lMYC5                                                 58.2    2e-07   Hevea brasiliensis [jebe]
gb|KCW72574.1|  hypothetical protein EUGRSUZ_E01043                   58.2    2e-07   Eucalyptus grandis [rose gum]
ref|XP_007210224.1|  hypothetical protein PRUPE_ppa015634mg           58.2    2e-07   
gb|KJB25303.1|  hypothetical protein B456_004G184800                  58.5    2e-07   Gossypium raimondii
gb|KJB21076.1|  hypothetical protein B456_003G182100                  58.5    2e-07   Gossypium raimondii
dbj|BAJ33793.1|  unnamed protein product                              58.5    2e-07   Eutrema halophilum
ref|XP_006398371.1|  hypothetical protein EUTSA_v10000808mg           58.5    2e-07   
ref|NP_001065478.1|  Os10g0575000                                     58.5    3e-07   
gb|ABR16436.1|  unknown                                               58.5    3e-07   Picea sitchensis
gb|EEE51454.1|  hypothetical protein OsJ_32566                        58.5    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009384727.1|  PREDICTED: transcription factor MYC3-like        58.2    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003612909.1|  BHLH transcription factor                        58.2    3e-07   Medicago truncatula
gb|ACN21638.1|  putative basic helix-loop-helix protein BHLH22        58.2    3e-07   Lotus japonicus
ref|XP_004166734.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  57.8    4e-07   
ref|XP_004148475.1|  PREDICTED: transcription factor MYC2-like        57.8    4e-07   
ref|XP_010100202.1|  hypothetical protein L484_015347                 57.8    4e-07   Morus notabilis
ref|XP_008245386.1|  PREDICTED: transcription factor bHLH14-like      57.8    4e-07   Prunus mume [ume]
gb|KGN60384.1|  Transcription factor AtMYC2                           57.8    4e-07   Cucumis sativus [cucumbers]
ref|XP_008238769.1|  PREDICTED: transcription factor MYC2-like        57.4    4e-07   Prunus mume [ume]
ref|XP_004509726.1|  PREDICTED: transcription factor MYC2-like        57.8    4e-07   Cicer arietinum [garbanzo]
ref|XP_008465979.1|  PREDICTED: transcription factor MYC2-like        57.8    4e-07   Cucumis melo [Oriental melon]
ref|XP_007210117.1|  hypothetical protein PRUPE_ppa022165mg           57.4    4e-07   
ref|XP_009347383.1|  PREDICTED: transcription factor MYC2             57.8    5e-07   
gb|ABD59338.1|  G-box element binding protein                         57.8    5e-07   Pisum sativum [garden pea]
emb|CDX84081.1|  BnaC08g07580D                                        57.4    5e-07   
ref|XP_007158304.1|  hypothetical protein PHAVU_002G141500g           57.4    6e-07   Phaseolus vulgaris [French bean]
gb|KFK30669.1|  hypothetical protein AALP_AA6G012400                  57.0    6e-07   Arabis alpina [alpine rockcress]
ref|XP_006601141.1|  PREDICTED: transcription factor MYC2-like        56.2    6e-07   Glycine max [soybeans]
ref|XP_008659898.1|  PREDICTED: transcription factor MYC4-like        57.4    6e-07   Zea mays [maize]
gb|AAY90122.1|  basic helix-loop-helix transcription factor protein   57.4    6e-07   Rheum australe [Himalayan rhubarb]
gb|AAD15818.1|  transcription factor MYC7E                            57.4    6e-07   Zea mays [maize]
ref|XP_002467448.1|  hypothetical protein SORBIDRAFT_01g028230        57.4    6e-07   Sorghum bicolor [broomcorn]
ref|XP_008374122.1|  PREDICTED: transcription factor MYC2-like        57.0    6e-07   
ref|XP_008658563.1|  PREDICTED: transcription factor MYC4             57.4    7e-07   
gb|AAC28907.1|  phaseolin G-box binding protein PG2                   57.0    7e-07   Phaseolus vulgaris [French bean]
ref|XP_010538501.1|  PREDICTED: transcription factor MYC4-like        57.0    8e-07   Tarenaya hassleriana [spider flower]
ref|XP_009401251.1|  PREDICTED: transcription factor MYC4-like        57.0    9e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007210924.1|  hypothetical protein PRUPE_ppa027182mg           56.6    9e-07   
gb|KDP34321.1|  hypothetical protein JCGZ_12669                       56.6    1e-06   Jatropha curcas
gb|AGL98101.1|  transcription factor MYC2-like protein                56.6    1e-06   Nicotiana attenuata
gb|ACO53628.1|  bHLH domain protein                                   56.6    1e-06   Gossypium hirsutum [American cotton]
ref|XP_009388411.1|  PREDICTED: transcription factor MYC2             56.6    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006415166.1|  hypothetical protein EUTSA_v10007075mg           56.6    1e-06   Eutrema salsugineum [saltwater cress]
ref|XP_004140617.1|  PREDICTED: transcription factor ATR2-like        56.2    1e-06   Cucumis sativus [cucumbers]
ref|XP_008341963.1|  PREDICTED: transcription factor MYC2-like        56.6    1e-06   
ref|XP_007208833.1|  hypothetical protein PRUPE_ppa025417mg           56.2    1e-06   
ref|XP_008238247.1|  PREDICTED: transcription factor MYC2             56.2    1e-06   Prunus mume [ume]
ref|XP_004166899.1|  PREDICTED: transcription factor ATR2-like        55.8    1e-06   
emb|CDY35179.1|  BnaA09g18160D                                        56.2    1e-06   Brassica napus [oilseed rape]
ref|XP_004300239.1|  PREDICTED: transcription factor MYC2-like        56.2    1e-06   Fragaria vesca subsp. vesca
ref|XP_006283348.1|  hypothetical protein CARUB_v10004392mg           56.2    1e-06   Capsella rubella
ref|XP_008245385.1|  PREDICTED: transcription factor bHLH14-like ...  55.8    1e-06   Prunus mume [ume]
ref|XP_008245384.1|  PREDICTED: transcription factor bHLH14-like ...  55.8    1e-06   Prunus mume [ume]
ref|XP_009114329.1|  PREDICTED: transcription factor MYC3-like        56.2    1e-06   Brassica rapa
ref|XP_010530031.1|  PREDICTED: transcription factor MYC4             56.2    2e-06   Tarenaya hassleriana [spider flower]
gb|AIT39751.1|  transcription factor MYC2                             56.2    2e-06   Chrysanthemum boreale
emb|CDY03195.1|  BnaC09g19610D                                        55.8    2e-06   
ref|XP_008245390.1|  PREDICTED: transcription factor MYC2-like        55.5    2e-06   Prunus mume [ume]
gb|AAL55711.1|AF251689_1  putative transcription factor BHLH4         55.5    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193522.1|  transcription factor MYC4                           55.5    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010531704.1|  PREDICTED: transcription factor MYC2-like        55.5    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_006287856.1|  hypothetical protein CARUB_v10001082mg           55.1    2e-06   Capsella rubella
ref|NP_567195.1|  transcription factor bHLH14                         55.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004159750.1|  PREDICTED: transcription factor MYC4-like        55.1    2e-06   
ref|XP_004146202.1|  PREDICTED: transcription factor MYC4-like        55.1    2e-06   
gb|KGN55667.1|  hypothetical protein Csa_3G002860                     55.1    2e-06   Cucumis sativus [cucumbers]
ref|XP_006366244.1|  PREDICTED: transcription factor MYC2-like        55.5    3e-06   Solanum tuberosum [potatoes]
emb|CAF74711.1|  MYC transcription factor                             55.5    3e-06   Solanum tuberosum [potatoes]
ref|NP_001288107.1|  uncharacterized protein LOC101261048             55.5    3e-06   Solanum lycopersicum
gb|KFK31432.1|  hypothetical protein AALP_AA6G111200                  55.1    3e-06   Arabis alpina [alpine rockcress]
gb|ADH04262.1|  bHLH1 transcription factor                            55.5    3e-06   Nicotiana benthamiana
ref|XP_002865164.1|  hypothetical protein ARALYDRAFT_916752           55.1    3e-06   Arabidopsis lyrata subsp. lyrata
gb|KCW72577.1|  hypothetical protein EUGRSUZ_E01046                   54.3    3e-06   Eucalyptus grandis [rose gum]
ref|XP_010538366.1|  PREDICTED: transcription factor MYC2-like        55.1    4e-06   Tarenaya hassleriana [spider flower]
ref|XP_009413229.1|  PREDICTED: transcription factor MYC2-like        55.1    4e-06   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX77688.1|  BnaC07g19420D                                        54.7    4e-06   
ref|XP_003534274.2|  PREDICTED: transcription factor MYC2-like        55.1    4e-06   Glycine max [soybeans]
emb|CDY58502.1|  BnaA06g40330D                                        54.7    4e-06   Brassica napus [oilseed rape]
ref|XP_010481417.1|  PREDICTED: transcription factor MYC3             54.7    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010441550.1|  PREDICTED: transcription factor MYC3-like        54.7    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010494857.1|  PREDICTED: transcription factor MYC3-like        54.7    4e-06   
ref|XP_002868032.1|  basic helix-loop-helix family protein            54.7    4e-06   
ref|XP_010559309.1|  PREDICTED: transcription factor MYC4-like        54.7    5e-06   Tarenaya hassleriana [spider flower]
ref|XP_009412473.1|  PREDICTED: transcription factor MYC3-like        54.3    5e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_199488.1|  JAZ-interacting transcription factor MYC3           54.7    5e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAL55712.1|AF251690_1  putative transcription factor BHLH5         54.7    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001754025.1|  predicted protein                                54.7    5e-06   
ref|XP_008786336.1|  PREDICTED: transcription factor MYC2-like        54.7    5e-06   Phoenix dactylifera
ref|XP_003528771.1|  PREDICTED: transcription factor MYC2-like        54.3    5e-06   Glycine max [soybeans]
ref|XP_009101493.1|  PREDICTED: transcription factor MYC3             54.3    5e-06   Brassica rapa
ref|XP_007135301.1|  hypothetical protein PHAVU_010G117900g           54.3    5e-06   Phaseolus vulgaris [French bean]
ref|XP_008238755.1|  PREDICTED: transcription factor bHLH14-like ...  53.9    6e-06   Prunus mume [ume]
ref|XP_008238754.1|  PREDICTED: transcription factor MYC4-like is...  53.9    6e-06   Prunus mume [ume]
ref|XP_009415334.1|  PREDICTED: transcription factor bHLH13-like      54.3    6e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803328.1|  PREDICTED: transcription factor MYC3-like        53.9    6e-06   Phoenix dactylifera
ref|XP_006279855.1|  hypothetical protein CARUB_v10028441mg           54.3    6e-06   Capsella rubella
gb|ADH04267.1|  MYC1a transcription factor                            53.9    7e-06   Nicotiana tabacum [American tobacco]
ref|XP_001765161.1|  predicted protein                                54.3    7e-06   
ref|XP_009609942.1|  PREDICTED: transcription factor MYC2-like        53.9    7e-06   Nicotiana tomentosiformis
gb|ADH04268.1|  MYC1b transcription factor                            53.9    7e-06   Nicotiana tabacum [American tobacco]
gb|KEH18599.1|  basic helix loop helix (bHLH) family transcriptio...  53.5    8e-06   Medicago truncatula
ref|XP_004512525.1|  PREDICTED: transcription factor MYC2-like        53.9    8e-06   Cicer arietinum [garbanzo]
ref|XP_009780487.1|  PREDICTED: transcription factor MYC2-like        53.9    8e-06   Nicotiana sylvestris
gb|AIO09733.1|  transcription factor MYC2                             53.5    9e-06   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007156435.1|  hypothetical protein PHAVU_003G285700g           53.5    1e-05   Phaseolus vulgaris [French bean]
gb|AAB00686.1|  phaseolin G-box binding protein PG1                   53.5    1e-05   Phaseolus vulgaris [French bean]
ref|XP_010919958.1|  PREDICTED: transcription factor MYC4-like        53.5    1e-05   Elaeis guineensis
ref|XP_006294316.1|  hypothetical protein CARUB_v10023324mg           53.1    1e-05   
ref|XP_003548195.1|  PREDICTED: transcription factor MYC2-like        53.1    1e-05   Glycine max [soybeans]
gb|KHN15898.1|  Transcription factor bHLH14                           53.1    1e-05   Glycine soja [wild soybean]
ref|XP_008350027.1|  PREDICTED: transcription factor MYC2-like        53.1    1e-05   
ref|XP_007210206.1|  hypothetical protein PRUPE_ppa016220mg           53.1    1e-05   
ref|XP_001752627.1|  predicted protein                                53.5    1e-05   
gb|ACU18071.1|  unknown                                               52.0    1e-05   Glycine max [soybeans]
ref|XP_007210118.1|  hypothetical protein PRUPE_ppa022201mg           52.8    2e-05   Prunus persica
emb|CDX78808.1|  BnaA01g08750D                                        52.8    2e-05   
emb|CDY44507.1|  BnaC01g10420D                                        52.8    2e-05   Brassica napus [oilseed rape]
gb|KFK45000.1|  hypothetical protein AALP_AA1G331100                  52.8    2e-05   Arabis alpina [alpine rockcress]
gb|AET03296.2|  basic helix loop helix (bHLH) family transcriptio...  52.8    2e-05   Medicago truncatula
ref|XP_003628820.1|  Transcription factor MYC2                        52.8    2e-05   
ref|XP_010941241.1|  PREDICTED: transcription factor MYC2-like        52.8    2e-05   Elaeis guineensis
ref|XP_010933462.1|  PREDICTED: transcription factor MYC4-like        52.8    2e-05   Elaeis guineensis
ref|XP_008796257.1|  PREDICTED: transcription factor MYC4             52.8    2e-05   Phoenix dactylifera
ref|XP_001765254.1|  predicted protein                                52.8    2e-05   
emb|CDP13028.1|  unnamed protein product                              52.8    2e-05   Coffea canephora [robusta coffee]
ref|XP_011082365.1|  PREDICTED: transcription factor MYC4-like        52.8    2e-05   Sesamum indicum [beniseed]
emb|CAF74710.1|  MYC transcription factor                             52.8    2e-05   Solanum tuberosum [potatoes]
gb|ABD65632.1|  basic helix-loop-helix (bHLH) family transcriptio...  52.4    2e-05   Brassica oleracea
ref|XP_008373574.1|  PREDICTED: transcription factor MYC2             52.4    2e-05   
ref|XP_006352856.1|  PREDICTED: transcription factor MYC2-like        52.4    3e-05   Solanum tuberosum [potatoes]
gb|AGZ94899.1|  MYC transcription factor 2                            52.4    3e-05   Solanum lycopersicum
ref|XP_010909816.1|  PREDICTED: transcription factor MYC4-like        52.0    3e-05   Elaeis guineensis
gb|ADL36595.1|  BHLH domain class transcription factor                52.4    3e-05   Malus domestica [apple tree]
ref|XP_004245895.2|  PREDICTED: transcription factor MYC2             52.4    3e-05   
ref|XP_009420803.1|  PREDICTED: transcription factor MYC3-like        52.0    3e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010449546.1|  PREDICTED: transcription factor MYC4-like        52.0    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010434608.1|  PREDICTED: transcription factor MYC4-like        52.0    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006361006.1|  PREDICTED: transcription factor MYC4-like        51.6    4e-05   Solanum tuberosum [potatoes]
ref|XP_006362123.1|  PREDICTED: transcription factor MYC4-like        51.6    4e-05   Solanum tuberosum [potatoes]
ref|XP_010422737.1|  PREDICTED: transcription factor bHLH14-like      51.6    4e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002872924.1|  predicted protein                                51.6    4e-05   Arabidopsis lyrata subsp. lyrata
gb|EYU44086.1|  hypothetical protein MIMGU_mgv1a002808mg              51.6    5e-05   Erythranthe guttata [common monkey flower]
ref|XP_010428091.1|  PREDICTED: transcription factor bHLH14-like      51.2    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008799392.1|  PREDICTED: transcription factor MYC2-like        51.6    5e-05   Phoenix dactylifera
emb|CDP08631.1|  unnamed protein product                              51.2    5e-05   Coffea canephora [robusta coffee]
ref|XP_009359541.1|  PREDICTED: transcription factor MYC2-like        51.2    6e-05   Pyrus x bretschneideri [bai li]
ref|XP_009139989.1|  PREDICTED: transcription factor MYC4-like        50.4    6e-05   
ref|XP_009385748.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  51.2    6e-05   
gb|AAQ14332.1|AF283507_1  MYC2                                        51.2    6e-05   
ref|XP_009418327.1|  PREDICTED: transcription factor MYC4-like        50.8    7e-05   
ref|XP_008342523.1|  PREDICTED: transcription factor MYC3-like is...  50.8    7e-05   
ref|XP_008342518.1|  PREDICTED: transcription factor MYC3-like is...  50.8    7e-05   
ref|XP_010691764.1|  PREDICTED: transcription factor MYC2-like        50.8    7e-05   
ref|XP_010935028.1|  PREDICTED: transcription factor MYC4-like        50.8    7e-05   
ref|XP_008370020.1|  PREDICTED: transcription factor MYC2-like        50.8    8e-05   
ref|XP_009360191.1|  PREDICTED: transcription factor MYC2-like        50.4    8e-05   
gb|ADH04263.1|  bHLH2 transcription factor                            50.8    9e-05   
emb|CDY35183.1|  BnaA09g18200D                                        50.4    1e-04   
ref|XP_008374121.1|  PREDICTED: transcription factor MYC3-like        50.4    1e-04   
ref|XP_010445298.1|  PREDICTED: transcription factor MYC4-like        50.4    1e-04   
ref|XP_009408104.1|  PREDICTED: transcription factor MYC4-like        50.4    1e-04   
gb|AGL98100.1|  transcription factor MYC2                             50.4    1e-04   
ref|XP_009114324.1|  PREDICTED: transcription factor bHLH28-like      50.1    1e-04   
ref|XP_004248095.1|  PREDICTED: transcription factor MYC2-like        50.1    1e-04   
emb|CDY59973.1|  BnaA09g53560D                                        50.1    1e-04   
gb|EPS60924.1|  hypothetical protein M569_13876                       50.1    1e-04   
ref|XP_010523833.1|  PREDICTED: transcription factor MYC3-like        49.7    1e-04   
emb|CDY03183.1|  BnaC09g19730D                                        50.1    1e-04   
ref|XP_006361064.1|  PREDICTED: transcription factor MYC4-like        48.5    2e-04   
gb|AGQ80897.1|  MYC1                                                  49.7    2e-04   
ref|XP_008346662.1|  PREDICTED: transcription factor MYC2-like        49.7    2e-04   
ref|XP_009587276.1|  PREDICTED: transcription factor MYC2-like        49.7    2e-04   
ref|XP_009800420.1|  PREDICTED: transcription factor MYC2-like        49.7    2e-04   
ref|XP_008385225.1|  PREDICTED: transcription factor MYC2-like        49.7    2e-04   
ref|XP_006830285.1|  hypothetical protein AMTR_s00121p00026620        49.7    2e-04   
ref|XP_010412880.1|  PREDICTED: transcription factor MYC2-like        49.3    2e-04   
ref|XP_010677236.1|  PREDICTED: transcription factor MYC2-like        49.7    2e-04   
gb|AHN63211.1|  transcription factor MYC2                             49.7    2e-04   
ref|XP_008356558.1|  PREDICTED: transcription factor MYC2-like        49.7    2e-04   
ref|XP_009391048.1|  PREDICTED: transcription factor MYC2-like        49.7    2e-04   
ref|XP_010456175.1|  PREDICTED: transcription factor bHLH14-like ...  49.3    2e-04   
ref|XP_009360190.1|  PREDICTED: transcription factor MYC2-like        49.3    2e-04   
ref|XP_007210309.1|  hypothetical protein PRUPE_ppa002404mg           49.3    3e-04   
ref|NP_199495.1|  calcium-binding transcription factor NIG1           49.3    3e-04   
gb|KFK28472.1|  hypothetical protein AALP_AA7G000700                  48.9    3e-04   
ref|XP_006838603.1|  hypothetical protein AMTR_s00002p00225810        48.9    3e-04   
ref|XP_009358714.1|  PREDICTED: transcription factor MYC4-like        48.9    3e-04   
gb|ADH04269.1|  MYC2a transcription factor                            48.9    3e-04   
gb|KCW72571.1|  hypothetical protein EUGRSUZ_E01039                   48.5    4e-04   
ref|XP_009101673.1|  PREDICTED: transcription factor bHLH28-like      48.1    4e-04   
ref|XP_009393178.1|  PREDICTED: transcription factor MYC3-like        48.5    4e-04   
ref|XP_010441529.1|  PREDICTED: transcription factor bHLH28-like      48.1    5e-04   
ref|XP_008448555.1|  PREDICTED: transcription factor MYC3-like        48.1    5e-04   
emb|CDY03185.1|  BnaC09g19710D                                        48.1    5e-04   
ref|XP_010924915.1|  PREDICTED: transcription factor bHLH13-like      48.1    5e-04   
ref|XP_009354516.1|  PREDICTED: transcription factor MYC3-like        48.1    5e-04   
ref|XP_008385247.1|  PREDICTED: transcription factor MYC3-like        47.8    6e-04   
ref|XP_009114323.1|  PREDICTED: transcription factor bHLH28-like      47.8    7e-04   
ref|XP_008806486.1|  PREDICTED: transcription factor bHLH13-like      47.8    8e-04   



>ref|XP_009604694.1| PREDICTED: transcription factor MYC3-like [Nicotiana tomentosiformis]
Length=489

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRG  321
            STLQQ LQ+ILK QTDSW+YAIFWQTSN+DDGRLFLAWGDG F GTK  +G
Sbjct  29   STLQQMLQYILKNQTDSWSYAIFWQTSNEDDGRLFLAWGDGHFHGTKVKKG  79



>ref|XP_009776117.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=496

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRG  321
            STLQQ LQ +LK QTDSW+YAIFWQTSNDDDGRLFLAWGDG F GTK  +G
Sbjct  29   STLQQMLQHVLKNQTDSWSYAIFWQTSNDDDGRLFLAWGDGHFHGTKVKKG  79



>ref|XP_007051457.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOX95614.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=497

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  279
            M+ELI++ SSSSS+ +   +   STLQQRLQF++++Q D WAYAIFWQTSND+ GRLFL 
Sbjct  1    MEELIISPSSSSSLVSFSQETPPSTLQQRLQFVIQSQQDWWAYAIFWQTSNDEHGRLFLT  60

Query  280  WGDGFFQGTK  309
            WGDG FQGTK
Sbjct  61   WGDGHFQGTK  70



>ref|XP_010100678.1| hypothetical protein L484_023447 [Morus notabilis]
 gb|EXB83840.1| hypothetical protein L484_023447 [Morus notabilis]
Length=525

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            TLQQRLQFI+K+Q D WAYAIFWQTSNDD+GRLFLAWGDG FQG K
Sbjct  26   TLQQRLQFIVKSQPDWWAYAIFWQTSNDDNGRLFLAWGDGHFQGVK  71



>gb|KJB24531.1| hypothetical protein B456_004G149500 [Gossypium raimondii]
Length=476

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  279
            M+ELI++ SSSSS+ +   +   STLQQRLQ +L++Q D WAYAIFWQTSNDD GRL LA
Sbjct  1    MEELIISPSSSSSLVSFSHETPPSTLQQRLQHVLESQKDWWAYAIFWQTSNDDLGRLLLA  60

Query  280  WGDGFFQGT  306
            WGDG FQGT
Sbjct  61   WGDGHFQGT  69



>ref|XP_002301432.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE80705.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=491

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q    TLQQRLQFI++ Q D W+YAIFWQTSNDD GR+FL WGDG FQG+K
Sbjct  19   QETPPTLQQRLQFIVQNQPDWWSYAIFWQTSNDDSGRIFLGWGDGHFQGSK  69



>gb|ABK94979.1| unknown [Populus trichocarpa]
Length=491

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q    TLQQRLQFI++ Q D W+YAIFWQTSNDD GR+FL WGDG FQG+K
Sbjct  19   QETPPTLQQRLQFIVQNQPDWWSYAIFWQTSNDDSGRIFLGWGDGHFQGSK  69



>ref|XP_006362125.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=457

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +1

Query  100  MDELIVTssss-ssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLF  273
            MDELIV+SSS       S      S LQQ+LQ ILK QTDSW+YAIFWQTSN DDDG LF
Sbjct  1    MDELIVSSSSFFIPSLLSQGTQTSSNLQQKLQNILKIQTDSWSYAIFWQTSNDDDDGHLF  60

Query  274  LAWGDGFFQGTKAGRG  321
            LAWGDG F GTK+  G
Sbjct  61   LAWGDGHFHGTKSKTG  76



>ref|XP_011023113.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=491

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q    TLQQRLQF+++ Q D W+YAIFWQTSNDD GR+FL WGDG FQG+K
Sbjct  19   QETPPTLQQRLQFMVQNQPDWWSYAIFWQTSNDDSGRIFLGWGDGHFQGSK  69



>ref|XP_004248092.1| PREDICTED: transcription factor MYC3-like [Solanum lycopersicum]
Length=451

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 49/67 (73%), Gaps = 7/67 (10%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQ  345
            S LQQ+LQ ILK QTDSW+YAIFWQT+N DDDG LFLAWGDG F GTK+  G      VQ
Sbjct  26   SNLQQKLQNILKIQTDSWSYAIFWQTTNDDDDGHLFLAWGDGHFHGTKSKTG------VQ  79

Query  346  TSHSTQQ  366
            +S  + +
Sbjct  80   SSEQSTE  86



>ref|XP_008370350.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=496

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 57/73 (78%), Gaps = 4/73 (5%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND---DDGRL  270
            M+ELI++ SSSSS  +   Q NH +LQQRLQFIL++Q D W+YAIFWQTSND   D+GRL
Sbjct  1    MEELIISPSSSSSXVSLP-QENHPSLQQRLQFILQSQPDWWSYAIFWQTSNDHQVDNGRL  59

Query  271  FLAWGDGFFQGTK  309
            FL WGDG FQG K
Sbjct  60   FLTWGDGHFQGPK  72



>gb|KJB09595.1| hypothetical protein B456_001G151700 [Gossypium raimondii]
Length=502

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  279
            M+ELI++ SSSSS+     + + STLQQRLQF++++Q   W YAIFWQTSND+ GRL+L 
Sbjct  1    MEELIISPSSSSSLVYMTQETSPSTLQQRLQFVVQSQQIWWTYAIFWQTSNDEHGRLYLC  60

Query  280  WGDGFFQGTKAG  315
            WGDG+FQGT  G
Sbjct  61   WGDGYFQGTTKG  72



>ref|XP_009375455.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=496

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 3/54 (6%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND---DDGRLFLAWGDGFFQGTK  309
            Q NH +LQQRLQFIL++Q D W+YAIFWQTSND   D+G LFL WGDG FQG K
Sbjct  19   QENHPSLQQRLQFILQSQPDWWSYAIFWQTSNDRQVDNGCLFLTWGDGHFQGPK  72



>ref|XP_002529965.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF32408.1| DNA binding protein, putative [Ricinus communis]
Length=486

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  279
            MDELI++ SSSSS+ +   Q    TLQQRLQFIL++Q D WAYAIFWQT N D+GR+FLA
Sbjct  1    MDELIISPSSSSSLVSFS-QGTPPTLQQRLQFILQSQPDWWAYAIFWQTLNADNGRIFLA  59

Query  280  WGDGFFQGTK  309
            WGDG FQGT+
Sbjct  60   WGDGHFQGTR  69



>ref|XP_011039030.1| PREDICTED: transcription factor MYC2 isoform X2 [Populus euphratica]
Length=500

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            TLQQRLQFI+++Q D W+YAIFWQ S DD G++FLAWGDG FQG+K
Sbjct  24   TLQQRLQFIVQSQPDRWSYAIFWQASQDDSGQIFLAWGDGHFQGSK  69



>ref|XP_011039024.1| PREDICTED: transcription factor MYC2 isoform X1 [Populus euphratica]
Length=525

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            TLQQRLQFI+++Q D W+YAIFWQ S DD G++FLAWGDG FQG+K
Sbjct  24   TLQQRLQFIVQSQPDRWSYAIFWQASQDDSGQIFLAWGDGHFQGSK  69



>ref|XP_002266775.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera]
Length=497

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKA  312
            +LQ+RLQFI+++Q + WAYAIFWQT NDD+GR+FLAWGDG FQG K 
Sbjct  34   SLQERLQFIVQSQAEWWAYAIFWQTCNDDNGRIFLAWGDGHFQGGKG  80



>emb|CBI38690.3| unnamed protein product [Vitis vinifera]
Length=333

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 3/57 (5%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            +LQ+RLQFI+++Q + WAYAIFWQT NDD+GR+FLAWGDG FQG   G+G G+  ++
Sbjct  17   SLQERLQFIVQSQAEWWAYAIFWQTCNDDNGRIFLAWGDGHFQG---GKGMGIQALI  70



>gb|KDO86574.1| hypothetical protein CISIN_1g046178mg [Citrus sinensis]
Length=515

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQT-SNDDDGRLFLAWGDGFFQGTK  309
            TLQQRLQFI+++Q + WAYAIFWQT SNDD+G+LFLAWGDG +QGTK
Sbjct  25   TLQQRLQFIVQSQPEWWAYAIFWQTISNDDNGQLFLAWGDGHYQGTK  71



>ref|XP_006444764.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
 gb|ESR58004.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
Length=515

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQT-SNDDDGRLFLAWGDGFFQGTK  309
            TLQQRLQFI+++Q + WAYAIFWQT SNDD+G+LFLAWGDG +QGTK
Sbjct  25   TLQQRLQFIVQSQPEWWAYAIFWQTISNDDNGQLFLAWGDGHYQGTK  71



>ref|XP_008345582.1| PREDICTED: transcription factor bHLH14-like [Malus domestica]
Length=492

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 3/54 (6%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND---DDGRLFLAWGDGFFQGTK  309
            Q NH +LQQRLQFIL++Q D W+YAIFWQTSND   D+G LFL WGDG FQ  K
Sbjct  19   QENHPSLQQRLQFILQSQPDWWSYAIFWQTSNDHLVDNGCLFLTWGDGHFQRPK  72



>ref|XP_002320222.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE98537.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=430

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            TLQQRLQFI+++Q D W+Y+IFWQ S DD G++FLAWGDG FQG+K
Sbjct  24   TLQQRLQFIVQSQPDRWSYSIFWQASKDDSGQIFLAWGDGHFQGSK  69



>ref|XP_009623539.1| PREDICTED: transcription factor MYC3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=448

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAG  315
            LQ  LQ+++K+Q D WAYAIFWQTS DD+G+ FLAWGDG+FQG K G
Sbjct  71   LQHMLQYVIKSQPDWWAYAIFWQTSTDDEGKPFLAWGDGYFQGAKGG  117



>gb|KJB49615.1| hypothetical protein B456_008G128800 [Gossypium raimondii]
Length=487

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  279
            M+ELI++ SSSSS+ +   +   STLQQRLQFI+++  +   YAIFWQTSNDD GRLFLA
Sbjct  1    MEELIISPSSSSSLVSFSQETPPSTLQQRLQFIVQSHQEWCTYAIFWQTSNDDHGRLFLA  60

Query  280  WGDGFFQGTKAGRGGGVP  333
            W DG FQGTK       P
Sbjct  61   WEDGHFQGTKDTSPKSTP  78



>ref|XP_008233076.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC2 [Prunus 
mume]
Length=483

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 2/53 (4%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND--DDGRLFLAWGDGFFQGTK  309
            Q    +LQQRLQFI+++Q D W+YAIFWQ SND  D+GRLFL WGDG FQG+K
Sbjct  19   QETSPSLQQRLQFIVQSQPDWWSYAIFWQPSNDHQDNGRLFLTWGDGHFQGSK  71



>ref|XP_007219048.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
 gb|EMJ20247.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
Length=496

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 2/53 (4%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND--DDGRLFLAWGDGFFQGTK  309
            Q    +LQQRLQFI+++Q D W+YAIFWQ SND  D+GRLFL WGDG FQG+K
Sbjct  19   QETSPSLQQRLQFIVQSQPDWWSYAIFWQPSNDHQDNGRLFLTWGDGHFQGSK  71



>ref|XP_009592442.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
Length=439

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNH-STLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLF  273
            M+E+I  ++SS S  A +SQ N  STLQQ+L++IL +QTDSWAY IFWQTSN+D +G L 
Sbjct  1    MNEVIFPATSSFSTPALISQENQPSTLQQKLKYILNSQTDSWAYTIFWQTSNEDNNGSLL  60

Query  274  LAWGDGFFQGT  306
            L WGDG FQGT
Sbjct  61   LTWGDGHFQGT  71



>gb|KJB41602.1| hypothetical protein B456_007G111800 [Gossypium raimondii]
Length=495

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            STLQQRLQF++++Q D WAYAIFWQT NDD G LFLAWGDG  Q TK
Sbjct  24   STLQQRLQFVIQSQQDLWAYAIFWQTLNDDLGNLFLAWGDGHLQCTK  70



>ref|XP_009623534.1| PREDICTED: transcription factor MYC2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=487

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAG  315
            LQ  LQ+++K+Q D WAYAIFWQTS DD+G+ FLAWGDG+FQG K G
Sbjct  71   LQHMLQYVIKSQPDWWAYAIFWQTSTDDEGKPFLAWGDGYFQGAKGG  117



>ref|XP_004230022.1| PREDICTED: transcription factor MYC2-like isoform X2 [Solanum 
lycopersicum]
Length=450

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            LQQ LQ+++K+Q + WAYAIFWQTSNDD+G+ FLAWGDG+FQG
Sbjct  27   LQQMLQYVVKSQPEWWAYAIFWQTSNDDEGKNFLAWGDGYFQG  69



>ref|XP_004230021.1| PREDICTED: transcription factor MYC2-like isoform X1 [Solanum 
lycopersicum]
Length=451

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            LQQ LQ+++K+Q + WAYAIFWQTSNDD+G+ FLAWGDG+FQG
Sbjct  27   LQQMLQYVVKSQPEWWAYAIFWQTSNDDEGKNFLAWGDGYFQG  69



>ref|XP_010031905.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=490

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            TLQQRLQ ++++Q   WAYAIFWQ  N DDGRL LAWGDG FQG+
Sbjct  32   TLQQRLQLVVQSQPQWWAYAIFWQLLNHDDGRLLLAWGDGHFQGS  76



>gb|KCW83845.1| hypothetical protein EUGRSUZ_B00713 [Eucalyptus grandis]
Length=490

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            TLQQRLQ ++++Q   WAYAIFWQ  N DDGRL LAWGDG FQG+
Sbjct  32   TLQQRLQLVVQSQPQWWAYAIFWQLLNHDDGRLLLAWGDGHFQGS  76



>ref|XP_006357552.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=452

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            LQQ LQ+++K+Q + WAYAIFWQTS DDDG+ FLAWGDG+FQG
Sbjct  30   LQQMLQYVVKSQPEWWAYAIFWQTSTDDDGKNFLAWGDGYFQG  72



>gb|KJB24138.1| hypothetical protein B456_004G129600 [Gossypium raimondii]
Length=463

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK--AGRGG  324
            TLQQRLQFI++++ + W Y+IFWQ S D  GRL  +WGDG+FQGTK  AG+ G
Sbjct  20   TLQQRLQFIVQSRPEWWVYSIFWQASRDAHGRLVFSWGDGYFQGTKGFAGKSG  72



>ref|XP_010054972.1| PREDICTED: transcription factor MYC2 [Eucalyptus grandis]
 gb|KCW71457.1| hypothetical protein EUGRSUZ_E00019 [Eucalyptus grandis]
Length=495

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            TLQQRLQ ++++Q   WAYAIFWQ  N DDGRL LAWGDG FQG+
Sbjct  32   TLQQRLQLMVQSQPQWWAYAIFWQLLNHDDGRLLLAWGDGHFQGS  76



>ref|XP_011094312.1| PREDICTED: transcription factor MYC2 [Sesamum indicum]
Length=473

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            TLQ+RLQ+IL+ Q D WAYAI WQTS DD+GR+ L+W DG FQGTK
Sbjct  27   TLQKRLQYILQHQPDWWAYAILWQTSKDDNGRISLSWADGHFQGTK  72



>ref|XP_011081344.1| PREDICTED: transcription factor MYC2-like [Sesamum indicum]
Length=469

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAG  315
            +P  STLQ RLQFIL+++ + W YAIFWQ + D DGR  L+WGDG +QGTK+ 
Sbjct  17   EPPPSTLQNRLQFILQSRREWWNYAIFWQATKDADGRFVLSWGDGHYQGTKSA  69



>gb|KEH18600.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=464

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  160  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            P   TLQQ+LQF+++TQ+++W YAI WQT+ D+ G+  L+WG+G+FQGTK
Sbjct  21   PQTLTLQQKLQFLVQTQSENWVYAILWQTTKDEKGKPLLSWGEGYFQGTK  70



>gb|ACF19982.1| MYC2 [Hevea brasiliensis]
Length=476

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q +   LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F+GTK
Sbjct  23   QDSSPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLSWGDGHFRGTK  73



>gb|ADK91082.1| LMYC2 [Hevea brasiliensis]
Length=475

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q +   LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F+GTK
Sbjct  23   QDSSPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLSWGDGHFRGTK  73



>ref|XP_009766909.1| PREDICTED: transcription factor MYC2 [Nicotiana sylvestris]
 ref|XP_009766910.1| PREDICTED: transcription factor MYC2 [Nicotiana sylvestris]
Length=444

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            LQ  LQ+++K+Q D WAYAIFWQ+S+DD+G+ FLAWGDG+FQ
Sbjct  27   LQHMLQYVIKSQPDWWAYAIFWQSSSDDEGKAFLAWGDGYFQ  68



>ref|XP_004306627.1| PREDICTED: transcription factor MYC2 [Fragaria vesca subsp. vesca]
Length=491

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 55/71 (77%), Gaps = 3/71 (4%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFL  276
            MD+LI++ +SSSS+ +   +P  +TLQQRLQFIL++Q + W+YAIFW  SND ++GRL L
Sbjct  1    MDDLIISPTSSSSLVSLPHEP--ATLQQRLQFILQSQPELWSYAIFWLASNDVENGRLLL  58

Query  277  AWGDGFFQGTK  309
             WGDG FQG +
Sbjct  59   GWGDGHFQGPE  69



>gb|KJB52372.1| hypothetical protein B456_008G259000 [Gossypium raimondii]
Length=475

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGV  330
            Q    TLQQRL FI++++ + W Y+IFWQ S D DGR+ L+WGDG+F+GT+ G G  +
Sbjct  14   QDASPTLQQRLHFIVQSRPEWWVYSIFWQASRDVDGRVVLSWGDGYFRGTRDGTGKSI  71



>gb|AEG74014.1| lMYC4 [Hevea brasiliensis]
Length=470

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F+GTK
Sbjct  24   LQQRLQFILQSRPEWWVYAIFWQASKDSTGRLVLSWGDGHFRGTK  68



>gb|ACF05947.1| MYC1 [Hevea brasiliensis]
Length=476

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q ++  LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F+GT+
Sbjct  23   QDSYPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLSWGDGHFRGTE  73



>ref|XP_009775258.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=425

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 5/71 (7%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSN--DDDGRLF  273
            MDELI  SS S+SI+    QP  ST QQRLQ+ILK+QT+ WAYAIFWQT++  D++G  F
Sbjct  1    MDELIFPSSFSASISQEN-QP--STFQQRLQYILKSQTNCWAYAIFWQTTSNKDNNGSFF  57

Query  274  LAWGDGFFQGT  306
            L  GDG FQG+
Sbjct  58   LTCGDGHFQGS  68



>gb|ADK56287.1| LMYC1 [Hevea brasiliensis]
Length=476

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q ++  LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F+GT+
Sbjct  23   QDSYPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLSWGDGHFRGTE  73



>gb|AEG74013.1| lMYC3 [Hevea brasiliensis]
Length=475

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q     LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F GTK
Sbjct  18   QETSPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLSWGDGHFCGTK  68



>ref|XP_007039384.1| Basic helix-loop-helix DNA-binding family protein, putative [Theobroma 
cacao]
 gb|EOY23885.1| Basic helix-loop-helix DNA-binding family protein, putative [Theobroma 
cacao]
Length=473

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRG  321
            Q    TLQQRLQFI++++ + W Y+IFWQ S D  G L L+WGDG+F+GT+   G
Sbjct  14   QDASPTLQQRLQFIVQSRPEWWVYSIFWQASRDAHGHLVLSWGDGYFRGTRNFSG  68



>ref|XP_006476285.1| PREDICTED: transcription factor MYC2-like [Citrus sinensis]
Length=519

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q    TLQQRLQFI++ + + W Y+IFWQ   D +GRL L+WGDG+F+G+K
Sbjct  18   QETSPTLQQRLQFIVQNRPEWWVYSIFWQPLKDVNGRLVLSWGDGYFRGSK  68



>gb|KDO76730.1| hypothetical protein CISIN_1g010053mg [Citrus sinensis]
Length=519

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q    TLQQRLQFI++ + + W Y+IFWQ   D +GRL L+WGDG+F+G+K
Sbjct  18   QETSPTLQQRLQFIVQNRPEWWVYSIFWQPLKDVNGRLVLSWGDGYFRGSK  68



>ref|XP_006439218.1| hypothetical protein CICLE_v10019730mg [Citrus clementina]
 gb|ESR52458.1| hypothetical protein CICLE_v10019730mg [Citrus clementina]
Length=519

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q    TLQQRLQFI++ + + W Y+IFWQ   D +GRL L+WGDG+F+G+K
Sbjct  18   QETSPTLQQRLQFIVQNRPEWWVYSIFWQPLKDVNGRLVLSWGDGYFRGSK  68



>ref|XP_010267440.1| PREDICTED: transcription factor MYC2 [Nelumbo nucifera]
Length=522

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  HSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
              TLQ+RL+F+++++ + W YAIFW+TSND++G L LAW DG F+GT+
Sbjct  26   QKTLQERLRFLVQSRPEWWVYAIFWRTSNDNNGHLVLAWADGLFRGTR  73



>ref|XP_002303693.2| hypothetical protein POPTR_0003s14710g [Populus trichocarpa]
 gb|EEE78672.2| hypothetical protein POPTR_0003s14710g [Populus trichocarpa]
Length=465

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q   STLQQRLQF L ++ + W Y+IFWQ S D  GR  L+WGDG F+G K
Sbjct  18   QETSSTLQQRLQFFLHSRPEWWVYSIFWQASKDASGRPVLSWGDGHFRGNK  68



>ref|XP_007151965.1| hypothetical protein PHAVU_004G090300g [Phaseolus vulgaris]
 gb|ESW23959.1| hypothetical protein PHAVU_004G090300g [Phaseolus vulgaris]
Length=404

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGV  330
            + LQQRLQFIL+T+ + W YAIFWQ + + D RL L +GDGF+ G+K   G  V
Sbjct  19   NALQQRLQFILQTRPEWWVYAIFWQATKESDSRLTLEYGDGFYMGSKGREGTEV  72



>ref|XP_009796881.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=424

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            +TLQ+ LQ+I+ ++ + W YAIFWQ S D +GRL  +WGDG F+GTK
Sbjct  8    NTLQKHLQYIIHSRQEWWVYAIFWQASKDANGRLIFSWGDGHFRGTK  54



>ref|XP_009590627.1| PREDICTED: transcription factor bHLH14-like [Nicotiana tomentosiformis]
Length=425

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            +TLQ+ LQ+I+ +  + W YAIFWQ S D +GRL  +WGDG F+GTK
Sbjct  8    NTLQKHLQYIIHSSQEWWVYAIFWQASKDANGRLIFSWGDGHFRGTK  54



>ref|XP_011022409.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=463

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q   STLQ+RLQF L ++ + W Y+IFWQ S D  GR  L+WGDG F+G K
Sbjct  18   QETSSTLQKRLQFFLYSRPEWWVYSIFWQASKDASGRPVLSWGDGHFRGNK  68



>ref|XP_004244656.1| PREDICTED: transcription factor bHLH14-like [Solanum lycopersicum]
Length=452

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRG  321
            QPN  TLQ+ LQ+I+  + + W YAIFWQ S D + RL L+WGDG F+GTK   G
Sbjct  14   QPN--TLQKTLQYIIHNRQEWWVYAIFWQASKDVNNRLILSWGDGHFRGTKDTTG  66



>gb|KDP25207.1| hypothetical protein JCGZ_20363 [Jatropha curcas]
Length=482

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  160  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            P+   +QQRLQ+IL+   + W YAIFWQ S D  GRL L+WGDG F+G+
Sbjct  17   PHPLPIQQRLQYILQNHPEWWLYAIFWQASKDASGRLVLSWGDGSFRGS  65



>emb|CDP12229.1| unnamed protein product [Coffea canephora]
Length=437

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  178  QQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            +QRLQFI++ Q + W Y+IFWQ S D DGRL L+WGDG F+G K
Sbjct  25   KQRLQFIMQNQREWWVYSIFWQASRDRDGRLVLSWGDGHFRGPK  68



>ref|XP_002299425.1| hypothetical protein POPTR_0001s11400g [Populus trichocarpa]
 gb|EEE84230.1| hypothetical protein POPTR_0001s11400g [Populus trichocarpa]
Length=471

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q   STLQQRLQF L ++ + W Y+IFWQ S D  GRL L+ GDG F+G K
Sbjct  18   QETSSTLQQRLQFFLHSRPEWWVYSIFWQASKDASGRLVLSLGDGHFRGNK  68



>ref|XP_011026782.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=471

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q   STLQQRLQF L ++ + W Y+IFWQ S D  GRL L+ GDG F+G K
Sbjct  18   QETSSTLQQRLQFFLHSRPEWWVYSIFWQASKDASGRLVLSLGDGHFRGNK  68



>ref|XP_006352213.1| PREDICTED: transcription factor ATR2-like [Solanum tuberosum]
Length=456

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            QPN  TLQ+ LQ+I+  + + W YAIFWQ S D + RL L+WGDG F+GTK
Sbjct  13   QPN--TLQKILQYIIHNRQEWWVYAIFWQASKDVNNRLILSWGDGHFRGTK  61



>ref|XP_010058370.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
 gb|KCW72579.1| hypothetical protein EUGRSUZ_E01049 [Eucalyptus grandis]
Length=450

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            TLQQ +  IL+T+T+ W Y+IFWQ S D+ G L L WGDG F+GT
Sbjct  23   TLQQLVHLILQTRTEGWVYSIFWQPSRDEHGGLVLTWGDGHFRGT  67



>gb|KDP28433.1| hypothetical protein JCGZ_14204 [Jatropha curcas]
Length=482

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  211  TDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            +D W+YAIFWQTSNDD+GR+FLAWGDG FQ ++
Sbjct  38   SDRWSYAIFWQTSNDDNGRIFLAWGDGHFQSSR  70



>ref|XP_002518914.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF43447.1| DNA binding protein, putative [Ricinus communis]
Length=479

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKA  312
            Q +   LQQRLQ+IL+++ + W YAIFWQ S + +GRL L+WGDG F+ +K 
Sbjct  19   QESLPPLQQRLQYILQSRPEWWVYAIFWQASKEPNGRLVLSWGDGDFRDSKG  70



>ref|XP_010058366.1| PREDICTED: transcription factor MYC4-like [Eucalyptus grandis]
 gb|KCW72576.1| hypothetical protein EUGRSUZ_E01045 [Eucalyptus grandis]
Length=453

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            TLQQ +  IL+T+ + W Y+IFW+ S DD GRL L WGDG F+GT
Sbjct  23   TLQQLVPLILQTRPEDWVYSIFWRPSIDDHGRLVLTWGDGHFRGT  67



>ref|XP_003520013.2| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=379

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            + +QQRLQFIL+++ + W YAIFWQ + D D RL L +GDG+F+G +
Sbjct  24   NAVQQRLQFILQSRPEWWVYAIFWQATKDSDSRLKLEYGDGYFRGKE  70



>gb|KHN47226.1| Transcription factor bHLH14-like protein [Glycine soja]
Length=355

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            + +QQRLQFIL+++ + W YAIFWQ + D D RL L +GDG+F+G +
Sbjct  24   NAVQQRLQFILQSRPEWWVYAIFWQATKDSDSRLKLEYGDGYFRGKE  70



>ref|XP_010058369.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=449

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            TLQQ +  IL+ + + W Y+IFW+ S DD GRLFL WG G F+GT
Sbjct  23   TLQQLVHLILQARPEHWVYSIFWRPSRDDHGRLFLTWGHGHFRGT  67



>ref|XP_011028179.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=659

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRG  321
            N  TLQQRLQ +++   +SW YAIFWQ+S D+ G   L WGDG+++G +  G+G
Sbjct  65   NQETLQQRLQALIEGARESWTYAIFWQSSYDNSGASVLGWGDGYYKGEEDKGKG  118



>gb|KJB37703.1| hypothetical protein B456_006G216700 [Gossypium raimondii]
Length=656

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   D W YAIFWQ+S D  G   L WGDG+++G +  +G G     
Sbjct  75   NQETLQQRLQALIEGARDCWTYAIFWQSSYDYSGATVLGWGDGYYKG-EEDKGKGESKAC  133

Query  343  QTSHSTQQ  366
             +S + Q+
Sbjct  134  SSSVAEQE  141



>ref|XP_007209110.1| hypothetical protein PRUPE_ppa005343mg [Prunus persica]
 gb|EMJ10309.1| hypothetical protein PRUPE_ppa005343mg [Prunus persica]
Length=466

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q N +TLQQRLQFI++ + + W Y+IFWQ S D +G++ L+W  G F+ ++
Sbjct  14   QENSATLQQRLQFIVQNRPEWWVYSIFWQASKDSNGQVALSWAGGHFRSSR  64



>ref|XP_008245836.1| PREDICTED: transcription factor bHLH14-like isoform X2 [Prunus 
mume]
Length=492

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q N +TLQQRLQFI++ + + W Y+IFWQ S D +G++ L+W  G F+ ++
Sbjct  14   QENSATLQQRLQFIVQNRPEWWVYSIFWQASKDSNGQVALSWAGGHFRSSR  64



>ref|XP_010104300.1| hypothetical protein L484_023250 [Morus notabilis]
 gb|EXB99720.1| hypothetical protein L484_023250 [Morus notabilis]
Length=683

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG-TKAGRG  321
            N  TLQQRLQ +++   +SW YAIFWQ+S D  G   L WGDG+++G  + GRG
Sbjct  79   NQETLQQRLQALIEGARESWTYAIFWQSSYDYSGASVLGWGDGYYKGDEEKGRG  132



>ref|XP_008245834.1| PREDICTED: transcription factor bHLH14-like isoform X1 [Prunus 
mume]
Length=493

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q N +TLQQRLQFI++ + + W Y+IFWQ S D +G++ L+W  G F+ ++
Sbjct  14   QENSATLQQRLQFIVQNRPEWWVYSIFWQASKDSNGQVALSWAGGHFRSSR  64



>ref|XP_010556617.1| PREDICTED: transcription factor bHLH14 [Tarenaya hassleriana]
Length=439

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 50/71 (70%), Gaps = 3/71 (4%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHS-TLQQRLQFILKTQT-DSWAYAIFWQT-SNDDDGRL  270
            MDEL V+ SSS+S+     +P  + +LQQ+L+ +++T + D WAY IFWQ  S+D  GR 
Sbjct  1    MDELRVSPSSSTSLVTVTEEPPATGSLQQKLRSVIETSSPDRWAYVIFWQKLSDDQSGRC  60

Query  271  FLAWGDGFFQG  303
            FLAWGDG F+G
Sbjct  61   FLAWGDGHFRG  71



>gb|ACM48567.1| JAMYC [Taxus cuspidata]
Length=660

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            N  TLQQRLQ +++  + SW YAIFWQ S+D +  + L WGDG+++G +
Sbjct  63   NQDTLQQRLQALVEGASASWTYAIFWQISSDPENAMVLGWGDGYYKGPR  111



>gb|EYU32289.1| hypothetical protein MIMGU_mgv1a007575mg [Erythranthe guttata]
Length=403

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +1

Query  160  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            P  S LQ++L+ +L+TQTD W+YAIFWQ+ +     + L WGDG+FQGT
Sbjct  30   PTISVLQKKLKHLLQTQTDFWSYAIFWQSCSSSTSNV-LNWGDGYFQGT  77



>ref|XP_002280253.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera]
Length=663

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   +SW YAIFWQ+S D  G   L WGDG+++G
Sbjct  63   NQETLQQRLQALIEGARESWTYAIFWQSSVDFSGASLLGWGDGYYKG  109



>ref|XP_004510627.1| PREDICTED: transcription factor bHLH14-like [Cicer arietinum]
Length=472

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            TL+Q+LQF+L+ Q + W YAIFWQT+ D+   +FL WG+G F 
Sbjct  34   TLEQKLQFLLQAQPNHWVYAIFWQTTKDERDNIFLTWGEGHFH  76



>ref|XP_010275210.1| PREDICTED: transcription factor MYC2-like [Nelumbo nucifera]
Length=666

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   +SW YAIFWQ+S D  G   L WGDG+++G
Sbjct  62   NQDTLQQRLQTLIEGARESWTYAIFWQSSVDMSGASLLGWGDGYYKG  108



>ref|XP_010273162.1| PREDICTED: transcription factor MYC2-like [Nelumbo nucifera]
 ref|XP_010273163.1| PREDICTED: transcription factor MYC2-like [Nelumbo nucifera]
Length=658

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   +SW YAIFWQ+S D  G   L WGDG+++G
Sbjct  62   NQETLQQRLQTLIEGARESWTYAIFWQSSVDISGASLLGWGDGYYKG  108



>ref|XP_006368399.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
 gb|ERP64968.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
Length=647

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + WAYAIFWQ+S D  G   L WGDG+++G
Sbjct  60   NQETLQQRLQTLIEGACEGWAYAIFWQSSYDYSGASVLGWGDGYYKG  106



>ref|XP_007039493.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOY23994.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=669

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRG  321
            N  TLQQRLQ +++   ++W YAIFWQ+S D  G   L WGDG+++G +  G+G
Sbjct  69   NQETLQQRLQALIEGARENWTYAIFWQSSYDYSGTAVLGWGDGYYKGEEDKGKG  122



>ref|XP_004148739.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
 ref|XP_004164415.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
 gb|KGN55759.1| Transcription factor AtMYC2 [Cucumis sativus]
Length=661

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRG  321
            N  TLQQRLQ ++    +SW YAIFWQ+S D  G   L WGDG+++G +  G+G
Sbjct  69   NQETLQQRLQALIDGARESWTYAIFWQSSYDYSGGSVLGWGDGYYKGEEDKGKG  122



>ref|XP_008448683.1| PREDICTED: transcription factor MYC2-like [Cucumis melo]
Length=662

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRG  321
            N  TLQQRLQ ++    +SW YAIFWQ+S D  G   L WGDG+++G +  G+G
Sbjct  69   NQETLQQRLQALIDGARESWTYAIFWQSSYDYSGGSVLGWGDGYYKGEEDKGKG  122



>ref|XP_002519814.1| Transcription factor AtMYC2, putative [Ricinus communis]
 gb|EEF42418.1| Transcription factor AtMYC2, putative [Ricinus communis]
Length=663

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +1

Query  157  QP--NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            QP  N  TLQQRLQ +++   +SW YAIFWQ+S D  G   L WGDG+++G
Sbjct  65   QPLFNQETLQQRLQALIEGARESWTYAIFWQSSYDYSGASVLGWGDGYYKG  115



>gb|KDP22548.1| hypothetical protein JCGZ_26379 [Jatropha curcas]
Length=469

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            S L  RLQFIL+++ + W YA+FWQ + D  G L L+W DG F G K
Sbjct  22   SPLHHRLQFILQSRPECWLYAVFWQATKDATGSLVLSWADGSFHGAK  68



>ref|XP_010056012.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=472

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKA  312
            LQQ L F+L+ + D W Y+IFW+ + DD G L L WGDG F+G K 
Sbjct  24   LQQYLHFLLQIRPDDWVYSIFWRPTRDDRGCLVLTWGDGQFRGMKG  69



>ref|XP_010058368.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
 gb|KCW72578.1| hypothetical protein EUGRSUZ_E01047 [Eucalyptus grandis]
Length=447

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            LQQ +  IL+ + + W Y+IFWQ S DD GRL L WG G F+GT
Sbjct  24   LQQLVHLILQARPEDWVYSIFWQPSRDDHGRLVLTWGYGHFRGT  67



>gb|KCW72573.1| hypothetical protein EUGRSUZ_E01042 [Eucalyptus grandis]
Length=436

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            TLQQ +  IL+T+T+ W Y IFW+ S D  G L L W DG FQGT
Sbjct  23   TLQQLVHLILQTRTEEWIYFIFWRPSRDKHGCLVLTWADGHFQGT  67



>gb|AEJ88337.1| putative MYC protein, partial [Tamarix hispida]
Length=521

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  +LQQRLQ ++    +SW YAIFWQ++ D D    L WGDG+++G
Sbjct  5    NQDSLQQRLQALIDGARESWTYAIFWQSNPDPDADSMLVWGDGYYKG  51



>ref|XP_006343781.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=388

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  QQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            Q+RL +I+  + + W YAIFWQ S D +GRL  +WGDG F+ T
Sbjct  17   QKRLHYIIHNRQEWWVYAIFWQASKDTNGRLIFSWGDGHFRDT  59



>ref|XP_010058362.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=476

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            TLQQ +  IL+T+T+ W Y IFW+ S D  G L L W DG FQGT
Sbjct  52   TLQQLVHLILQTRTEEWIYFIFWRPSRDKHGCLVLTWADGHFQGT  96



>ref|XP_010058361.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=476

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            TLQQ +  IL+T+T+ W Y IFW+ S D  G L L W DG FQGT
Sbjct  52   TLQQLVHLILQTRTEEWIYFIFWRPSRDKHGCLVLTWADGHFQGT  96



>ref|XP_006385657.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
 gb|ERP63454.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
Length=630

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRG  321
            N  TLQQRLQ +++   +SW YAIFWQ+S D  G   L WGDG++ G +  G+G
Sbjct  64   NQETLQQRLQALIEGARESWTYAIFWQSSYDCSGASVLGWGDGYYIGEEDKGKG  117



>ref|XP_002279973.1| PREDICTED: transcription factor MYC4 [Vitis vinifera]
Length=468

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGF  294
            Q N  +LQQRL FI++ + + WAYAIFWQ + D +G   L+W DG+
Sbjct  18   QENTPSLQQRLHFIIQNRPEWWAYAIFWQPAKDPNGNHVLSWADGY  63



>gb|ABR16623.1| unknown [Picea sitchensis]
Length=582

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            +  TLQQRLQ +++T +  W YAIFWQ S +  G + L WGDG+++G++
Sbjct  15   SQETLQQRLQTLVETASIVWTYAIFWQVSYESSGAIQLCWGDGYYKGSR  63



>ref|XP_010540785.1| PREDICTED: transcription factor MYC2-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540787.1| PREDICTED: transcription factor MYC2-like isoform X2 [Tarenaya 
hassleriana]
Length=603

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++    SW YAIFWQ S D  G   L WGDG+++G
Sbjct  51   NQETLQQRLQALIEGAPKSWTYAIFWQLSYDFSGAAVLGWGDGYYKG  97



>dbj|BAJ91022.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ I++   ++W YAIFWQ+S  D G   L WGDG+++G
Sbjct  42   NQDTLQQRLQAIIEGSRETWTYAIFWQSST-DAGASLLGWGDGYYKG  87



>dbj|BAJ91674.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ I++   ++W YAIFWQ+S  D G   L WGDG+++G
Sbjct  42   NQDTLQQRLQAIIEGSRETWTYAIFWQSST-DAGASLLGWGDGYYKG  87



>ref|XP_006428423.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
 ref|XP_006491734.1| PREDICTED: transcription factor MYC2-like [Citrus sinensis]
 gb|ESR41663.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
Length=685

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   + W YAIFWQ+S D  G   L WGDG+++G   G  G    + 
Sbjct  65   NQETLQQRLQQLIEGSREGWTYAIFWQSSCDYSGSSMLGWGDGYYKG--EGEKGKSSKIK  122

Query  343  QTSHSTQQ  366
             +S + Q+
Sbjct  123  TSSAAEQE  130



>gb|KDO44754.1| hypothetical protein CISIN_1g005651mg [Citrus sinensis]
Length=685

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   + W YAIFWQ+S D  G   L WGDG+++G   G  G    + 
Sbjct  65   NQETLQQRLQQLIEGSREGWTYAIFWQSSCDYSGSSMLGWGDGYYKG--EGEKGKSSKIK  122

Query  343  QTSHSTQQ  366
             +S + Q+
Sbjct  123  TSSAAEQE  130



>ref|XP_011018569.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=647

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ+S D  G   L WGDG+++G
Sbjct  60   NQETLQQRLQTLIEGACEGWTYAIFWQSSYDYSGASVLGWGDGYYKG  106



>dbj|BAJ86015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ I++   ++W YAIFWQ+S  D G   L WGDG+++G
Sbjct  42   NQDTLQQRLQAIIEGSRETWTYAIFWQSST-DAGASLLGWGDGYYKG  87



>ref|XP_010461111.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=623

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  65   NQETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKG  111



>ref|XP_003516794.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=637

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 6/71 (8%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGT--KAGRGGGVP  333
            N  TLQQRLQ +++   +SW YAIFWQ+S D   G   L WGDG+++G   K    G  P
Sbjct  60   NQETLQQRLQTLIEGARESWTYAIFWQSSYDYSSGTSLLGWGDGYYKGEEDKVKAKGKTP  119

Query  334  VVVQTSHSTQQ  366
               +T+ S +Q
Sbjct  120  ---KTTSSAEQ  127



>emb|CDX73261.1| BnaC05g28450D [Brassica napus]
Length=443

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  52   NEETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKG  98



>gb|KJB51639.1| hypothetical protein B456_008G226300 [Gossypium raimondii]
Length=646

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ+S D  G   L WGDG+++G
Sbjct  80   NQETLQQRLQALIEGAHECWTYAIFWQSSYDYSGPAVLGWGDGYYKG  126



>ref|XP_003531962.1| PREDICTED: transcription factor MYC2 [Glycine max]
Length=654

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   +SW YAIFWQ+S D   G   L WGDG+++G
Sbjct  67   NQETLQQRLQTLIEGACESWTYAIFWQSSYDYSSGTSLLGWGDGYYKG  114



>ref|XP_008245388.1| PREDICTED: transcription factor MYC2-like [Prunus mume]
Length=493

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            N +T QQRLQFI++ + + WAY+IFWQ S D + ++ L+W  G F+ ++
Sbjct  17   NSATFQQRLQFIVQNRPEWWAYSIFWQASKDSNDQVVLSWAGGHFKSSR  65



>gb|EEC67493.1| hypothetical protein OsI_34761 [Oryza sativa Indica Group]
Length=664

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            N  TLQQRLQ I++   ++W YAIFWQ+S D   G   L WGDG+++G
Sbjct  54   NQDTLQQRLQSIIEGSRETWTYAIFWQSSIDVSTGASLLGWGDGYYKG  101



>ref|XP_003612908.1| Transcription factor MYC2 [Medicago truncatula]
 gb|AES95866.1| basic helix loop helix (BHLH) family transcription factor [Medicago 
truncatula]
Length=236

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +
Sbjct  24   NQDTLQQRLQALIEGVKEIWTYAIFWQPSYDYSGSSLLGWGDGYYKGEE  72



>gb|ABS11038.1| MYC [Brassica oleracea var. gemmifera]
Length=610

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  52   NEETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKG  98



>emb|CDY26910.1| BnaA05g18020D [Brassica napus]
Length=443

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  52   NEETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKG  98



>ref|XP_006303928.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
 gb|EOA36826.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
Length=624

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  64   NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKG  110



>ref|XP_009151447.1| PREDICTED: transcription factor MYC2 [Brassica rapa]
Length=605

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  52   NEETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKG  98



>ref|XP_009765330.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=423

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            QPN   LQ+ LQ+I+ ++ + W Y+IFWQ + D + R  L+WGD  F+GTK
Sbjct  13   QPN--ALQKILQYIVHSRQEWWVYSIFWQATKDVNNRFILSWGDAHFRGTK  61



>ref|XP_002893732.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69991.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  66   NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKG  112



>ref|XP_006662628.1| PREDICTED: transcription factor MYC2-like [Oryza brachyantha]
Length=481

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND--DDGRLFLAWGDGFFQG  303
            N  TLQQRLQ I++   D+W YAIFWQ+S D    G   L WGDG+++G
Sbjct  59   NQDTLQQRLQSIIEGSRDTWTYAIFWQSSLDVVPPGASLLGWGDGYYKG  107



>ref|XP_003574381.1| PREDICTED: transcription factor MYC4-like [Brachypodium distachyon]
Length=706

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = +1

Query  157  QP--NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            QP  N  TLQQRLQ I++   ++W YAIFWQ+S D   G   L WGDG+++G
Sbjct  44   QPAFNQDTLQQRLQAIIEGSRETWTYAIFWQSSTDAGAGASLLGWGDGYYKG  95



>ref|XP_009384126.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=676

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQG  303
            +  TLQQRLQ +++   +SW Y IFWQTS D   G  FL WGDG+++G
Sbjct  58   SQETLQQRLQALIEGARESWTYGIFWQTSVDGATGAYFLGWGDGYYKG  105



>ref|XP_010463090.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=462

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  65   NQETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKG  111



>gb|AAL55713.1|AF251691_1 putative transcription factor BHLH6 [Arabidopsis thaliana]
Length=623

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  64   NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKG  110



>ref|NP_174541.1| transcription factor MYC2 [Arabidopsis thaliana]
 sp|Q39204.2|MYC2_ARATH RecName: Full=Transcription factor MYC2; Short=AtMYC2; AltName: 
Full=Basic helix-loop-helix protein 6; Short=AtbHLH6; Short=bHLH 
6; AltName: Full=Protein JASMONATE INSENSITIVE 1; AltName: 
Full=R-homologous Arabidopsis protein 1; Short=RAP-1; 
AltName: Full=Transcription factor EN 38; AltName: Full=Z-box 
binding factor 1 protein; AltName: Full=bHLH transcription 
factor bHLH006; AltName: Full=rd22BP1 [Arabidopsis thaliana]
 gb|AAF25980.1|AC017118_17 F6N18.4 [Arabidopsis thaliana]
 gb|AAK59788.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 gb|AAO23607.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 emb|CAH58735.1| Z-box binding factor 1 protein [Arabidopsis thaliana]
 emb|CAA67885.2| bHLH protein [Arabidopsis thaliana]
 gb|AEE31513.1| transcription factor MYC2 [Arabidopsis thaliana]
Length=623

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  64   NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKG  110



>dbj|BAA25078.1| RD22BP1 [Arabidopsis thaliana]
Length=623

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  64   NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKG  110



>ref|XP_010478689.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC2-like 
[Camelina sativa]
Length=626

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  68   NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKG  114



>ref|XP_004246085.1| PREDICTED: transcription factor bHLH14-like [Solanum lycopersicum]
Length=387

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            LQ+RL +I+  + + W Y IFWQ S D +GRL  +WGDG F+
Sbjct  17   LQKRLHYIIHNRQEWWVYGIFWQASKDANGRLIFSWGDGHFR  58



>gb|KEH27718.1| basic helix loop helix (BHLH) family transcription factor [Medicago 
truncatula]
Length=258

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +
Sbjct  24   NQDTLQQRLQALIEGVKEIWTYAIFWQPSYDYSGSSLLGWGDGYYKGEE  72



>gb|AAK00453.1|AC060755_23 putative MYC transcription factor [Oryza sativa Japonica Group]
Length=688

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            N  TLQQRLQ I++   ++W YAIFWQ+S D   G   L WGDG+++G
Sbjct  53   NQDTLQQRLQSIIEGSRETWTYAIFWQSSIDVSTGASLLGWGDGYYKG  100



>gb|AEG74015.1| lMYC5 [Hevea brasiliensis]
Length=475

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q +  +LQQRL  IL++    W YAIFWQ S +  G L  +WGDG F+G+K
Sbjct  18   QESSPSLQQRLHVILQSCPGWWIYAIFWQVSKNASGHLVFSWGDGNFRGSK  68



>gb|KCW72574.1| hypothetical protein EUGRSUZ_E01043 [Eucalyptus grandis]
Length=472

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            LQQ   F+L+ + D W Y+IFWQ S DD G   L WGDG F+G K
Sbjct  24   LQQYFHFLLQIRPDDWVYSIFWQPSRDDRGCPVLIWGDGQFRGMK  68



>ref|XP_007210224.1| hypothetical protein PRUPE_ppa015634mg [Prunus persica]
 gb|EMJ11423.1| hypothetical protein PRUPE_ppa015634mg [Prunus persica]
Length=425

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            Q N ST Q+RLQFI + + + W Y+IFWQ SND + ++ L+W  G F+
Sbjct  15   QENSSTFQKRLQFIFRNRPEWWLYSIFWQASNDSNDQVSLSWAGGDFR  62



>gb|KJB25303.1| hypothetical protein B456_004G184800 [Gossypium raimondii]
Length=676

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  +LQQRLQ +++   +SW YAIFWQ+S D      L WGDG+++G
Sbjct  78   NQESLQQRLQALIEGARESWTYAIFWQSSYDCSATTVLGWGDGYYKG  124



>gb|KJB21076.1| hypothetical protein B456_003G182100 [Gossypium raimondii]
Length=549

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 4/68 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG----TKAGRGGGV  330
            N  +LQQRLQ +L+   + W YAIFWQ+S D  G   L WGDG+++G     KA     +
Sbjct  43   NQDSLQQRLQALLEGVRNCWTYAIFWQSSYDYAGAAVLGWGDGYYKGEEDKEKAKSKASL  102

Query  331  PVVVQTSH  354
              + +  H
Sbjct  103  STIAEQQH  110



>dbj|BAJ33793.1| unnamed protein product [Thellungiella halophila]
Length=606

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 5/52 (10%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQG  303
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  L L WGDG+++G
Sbjct  47   NEDTLQQRLQALIESAEENWTYAIFWQISHDFDSPTGDNTLILGWGDGYYRG  98



>ref|XP_006398371.1| hypothetical protein EUTSA_v10000808mg [Eutrema salsugineum]
 gb|ESQ39824.1| hypothetical protein EUTSA_v10000808mg [Eutrema salsugineum]
Length=665

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 5/52 (10%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQG  303
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  L L WGDG+++G
Sbjct  106  NEDTLQQRLQALIESAEENWTYAIFWQISHDFDSPTGDNTLILGWGDGYYRG  157



>ref|NP_001065478.1| Os10g0575000 [Oryza sativa Japonica Group]
 gb|AAS66204.1| MYC protein [Oryza sativa]
 gb|ABB48017.1| transcription factor MYC7E, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27315.1| Os10g0575000 [Oryza sativa Japonica Group]
Length=699

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            N  TLQQRLQ I++   ++W YAIFWQ+S D   G   L WGDG+++G
Sbjct  64   NQDTLQQRLQSIIEGSRETWTYAIFWQSSIDVSTGASLLGWGDGYYKG  111



>gb|ABR16436.1| unknown [Picea sitchensis]
Length=590

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGR  318
            N   LQQ+LQ ++++ + +W YAIFWQ S   +G + L WGDG F+G + G+
Sbjct  47   NDCALQQKLQNLVESSSFNWTYAIFWQLSRSKNGDVVLGWGDGSFKGPREGQ  98



>gb|EEE51454.1| hypothetical protein OsJ_32566 [Oryza sativa Japonica Group]
Length=732

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            N  TLQQRLQ I++   ++W YAIFWQ+S D   G   L WGDG+++G
Sbjct  119  NQDTLQQRLQSIIEGSRETWTYAIFWQSSIDVSTGASLLGWGDGYYKG  166



>ref|XP_009384727.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=696

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   +SW Y IFWQ+S D   G  FL WGDG+++G
Sbjct  65   NQETLQQRLQALIEGARESWTYGIFWQSSVDAATGTSFLGWGDGYYKG  112



>ref|XP_003612909.1| BHLH transcription factor [Medicago truncatula]
 gb|AES95867.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=677

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  41   NQDTLQQRLQALIEGAKEIWTYAIFWQPSYDYSGSSLLGWGDGYYKG  87



>gb|ACN21638.1| putative basic helix-loop-helix protein BHLH22 [Lotus japonicus]
Length=641

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   ++W YAIFWQ S D  G   L WGDG+++G
Sbjct  30   NQDTLQQRLQALIEGARETWTYAIFWQPSYDYSGTSLLGWGDGYYKG  76



>ref|XP_004166734.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC4-like 
[Cucumis sativus]
Length=686

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TL QRLQ +++   ++W YAIFWQ+S D  G   L WGDG+++G
Sbjct  72   NQETLMQRLQTLIEGAQENWTYAIFWQSSYDYSGGTVLGWGDGYYKG  118



>ref|XP_004148475.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
Length=688

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TL QRLQ +++   ++W YAIFWQ+S D  G   L WGDG+++G
Sbjct  73   NQETLMQRLQTLIEGAQENWTYAIFWQSSYDYSGGTVLGWGDGYYKG  119



>ref|XP_010100202.1| hypothetical protein L484_015347 [Morus notabilis]
 gb|EXB81873.1| hypothetical protein L484_015347 [Morus notabilis]
Length=506

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 4/50 (8%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSND----DDGRLFLAWGDGFFQGTK  309
            T+QQRLQFIL+T+ + W Y+IFWQ   D      G + L+W  G+F+GTK
Sbjct  27   TIQQRLQFILQTRPEWWVYSIFWQAYKDVTIGSKGDVSLSWNGGYFRGTK  76



>ref|XP_008245386.1| PREDICTED: transcription factor bHLH14-like [Prunus mume]
Length=495

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q   +T QQRLQFI++ + + W YAIFWQ S D + ++ L+W  G F+ +K
Sbjct  15   QETAATCQQRLQFIVQNRPEWWVYAIFWQASKDSNDQISLSWAGGHFKSSK  65



>gb|KGN60384.1| Transcription factor AtMYC2 [Cucumis sativus]
Length=679

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TL QRLQ +++   ++W YAIFWQ+S D  G   L WGDG+++G
Sbjct  64   NQETLMQRLQTLIEGAQENWTYAIFWQSSYDYSGGTVLGWGDGYYKG  110



>ref|XP_008238769.1| PREDICTED: transcription factor MYC2-like [Prunus mume]
Length=485

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            N +  QQRLQF+++++ + W Y+IFW+ S D +G++ L+WG G FQ
Sbjct  17   NPAIFQQRLQFLVQSRPECWVYSIFWRASKDSNGQVALSWGAGDFQ  62



>ref|XP_004509726.1| PREDICTED: transcription factor MYC2-like [Cicer arietinum]
Length=657

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 5/73 (7%)
 Frame = +1

Query  157  QP--NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGTKAGRGGG  327
            QP  N  TLQ RLQ +++   +SW YAIFWQ S+D   G   L WGDG+++G      G 
Sbjct  57   QPLFNQETLQHRLQSLIEGSRESWTYAIFWQPSHDYSSGAPLLGWGDGYYKGEDEKEKG-  115

Query  328  VPVVVQTSHSTQQ  366
               V++T+   +Q
Sbjct  116  -KKVIKTTSPEEQ  127



>ref|XP_008465979.1| PREDICTED: transcription factor MYC2-like [Cucumis melo]
Length=689

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TL QRLQ +++   ++W YAIFWQ+S D  G   L WGDG+++G
Sbjct  75   NQETLMQRLQTLIEGAQENWTYAIFWQSSYDYSGGTVLGWGDGYYKG  121



>ref|XP_007210117.1| hypothetical protein PRUPE_ppa022165mg [Prunus persica]
 gb|EMJ11316.1| hypothetical protein PRUPE_ppa022165mg [Prunus persica]
Length=442

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            N +  QQRLQF+++ + + W Y+IFW+ S D +G++ L+WG G FQ
Sbjct  17   NPAIFQQRLQFLVQNRPECWVYSIFWRASKDSNGQVALSWGAGDFQ  62



>ref|XP_009347383.1| PREDICTED: transcription factor MYC2 [Pyrus x bretschneideri]
Length=687

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            N  TL QRLQ +++   +SW YAIFWQ+S D  G   L WG+GF++
Sbjct  78   NQETLMQRLQALIEGARESWTYAIFWQSSYDYSGSAILGWGEGFYK  123



>gb|ABD59338.1| G-box element binding protein [Pisum sativum]
Length=646

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 3/52 (6%)
 Frame = +1

Query  157  QP--NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            QP  N  TLQ RLQ +++   ++W YAIFWQTS D    R  L WGDG+++G
Sbjct  62   QPLFNQETLQHRLQALIEDAKENWTYAIFWQTSYDYSTSRQLLGWGDGYYKG  113



>emb|CDX84081.1| BnaC08g07580D [Brassica napus]
Length=529

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   + W YAIFWQ S D      L WGDG+++G
Sbjct  45   NQETLQQRLQALIEGTNEGWTYAIFWQPSYDFSSASVLGWGDGYYKG  91



>ref|XP_007158304.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
 gb|ESW30298.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
Length=728

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  TLQ RLQ +++   +SW YAIFWQ S D  G   L WGDG+++G
Sbjct  114  NQDTLQHRLQALIEGARESWTYAIFWQHSYDYSGSALLGWGDGYYKG  160



>gb|KFK30669.1| hypothetical protein AALP_AA6G012400 [Arabis alpina]
Length=393

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGR  318
            LQQ+L+F+++T  D WAY IFWQ   D   R +L W DG F G K  +
Sbjct  10   LQQKLRFVVETSPDQWAYVIFWQKMTDQSDRSYLVWVDGHFGGNKNNK  57



>ref|XP_006601141.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=293

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            LQ+RLQ +L+   +SW YAIFW++S+D+  G   L WGDG++QG +  +  G      TS
Sbjct  38   LQRRLQTLLEGARESWTYAIFWESSHDNFSGATLLRWGDGYYQGEEEDKAKGKAPKTTTS  97



>ref|XP_008659898.1| PREDICTED: transcription factor MYC4-like [Zea mays]
 gb|AFW87749.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=703

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  TLQQRLQ +++   ++W YAIFWQ+S D   G   L WGDG+++G    +    P +
Sbjct  51   NQDTLQQRLQAMIEGSRETWTYAIFWQSSLDAATGASLLGWGDGYYKGCDDDKRRHRPPL  110

Query  340  VQTSHSTQQ  366
               + + Q+
Sbjct  111  TPAAQAEQE  119



>gb|AAY90122.1| basic helix-loop-helix transcription factor protein [Rheum australe]
Length=720

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            N  +LQQRLQ ++    +SW YAIFWQ + +  G+  L WGDG+++G
Sbjct  87   NQDSLQQRLQALIDDARESWTYAIFWQCNVEPTGQSLLGWGDGYYKG  133



>gb|AAD15818.1| transcription factor MYC7E [Zea mays]
Length=702

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   ++W YAIFWQ+S D   G   L WGDG+++G
Sbjct  53   NQDTLQQRLQAMIEGSRETWTYAIFWQSSLDSATGASLLGWGDGYYKG  100



>ref|XP_002467448.1| hypothetical protein SORBIDRAFT_01g028230 [Sorghum bicolor]
 gb|EER94446.1| hypothetical protein SORBIDRAFT_01g028230 [Sorghum bicolor]
Length=709

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++  +++W YAIFWQ+S D   G   L WGDG+++G
Sbjct  58   NQDTLQQRLQAMIEGSSETWTYAIFWQSSLDAATGASLLGWGDGYYKG  105



>ref|XP_008374122.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=467

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q N  TLQ RLQFI++ + + W Y+IFWQ S D +G ++L+W  G F+ T+
Sbjct  15   QENSLTLQ-RLQFIIQNRPEWWVYSIFWQASKDSNGLVYLSWAGGHFRSTR  64



>ref|XP_008658563.1| PREDICTED: transcription factor MYC4 [Zea mays]
 tpg|DAA46409.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=705

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   ++W YAIFWQ+S D   G   L WGDG+++G
Sbjct  56   NQDTLQQRLQAMIEGSRETWTYAIFWQSSLDSATGASLLGWGDGYYKG  103



>gb|AAC28907.1| phaseolin G-box binding protein PG2, partial [Phaseolus vulgaris]
Length=614

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            TLQ RLQ +++   +SW YAIFWQ S D  G   L WGDG+++G
Sbjct  2    TLQHRLQALIEGARESWTYAIFWQHSYDYSGSALLGWGDGYYKG  45



>ref|XP_010538501.1| PREDICTED: transcription factor MYC4-like [Tarenaya hassleriana]
Length=646

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 3/52 (6%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND---DDGRLFLAWGDGFFQG  303
            Q N  TLQQRLQ +++   + W YAIFWQ S D    DG   L WGDG+++G
Sbjct  65   QFNEDTLQQRLQSLIEGAREPWTYAIFWQLSYDFPGGDGTALLGWGDGYYKG  116



>ref|XP_009401251.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=690

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            N  TLQQRLQ ++    ++W Y IFWQ+S D   G  FL WGDG+++G
Sbjct  59   NQETLQQRLQTLIDGAGENWTYGIFWQSSVDAASGASFLGWGDGYYKG  106



>ref|XP_007210924.1| hypothetical protein PRUPE_ppa027182mg [Prunus persica]
 gb|EMJ12123.1| hypothetical protein PRUPE_ppa027182mg [Prunus persica]
Length=478

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGTK  309
            Q N +T  QRLQFI++ + + WAY+IFWQ S D +D ++ L+W  G F+ ++
Sbjct  15   QENSATFHQRLQFIVQNRPEWWAYSIFWQASKDNNDDQVVLSWAGGHFKSSR  66



>gb|KDP34321.1| hypothetical protein JCGZ_12669 [Jatropha curcas]
Length=674

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = +1

Query  157  QP--NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            QP  N  TLQQRL  +++   +SW YAIFWQ+S D +G + L WGDG+++G
Sbjct  61   QPIFNQETLQQRLLTLIEGARESWTYAIFWQSSYDYNGSV-LGWGDGYYKG  110



>gb|AGL98101.1| transcription factor MYC2-like protein [Nicotiana attenuata]
Length=666

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQGT--KAGR  318
            N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KAGR
Sbjct  78   NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLTSPFVLGWGDGYYKGEEDKAGR  132



>gb|ACO53628.1| bHLH domain protein [Gossypium hirsutum]
Length=674

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            +  +LQQRLQ +++   +SW YAIFWQ+S D      L WGDG+++G
Sbjct  78   SQESLQQRLQALIEGARESWTYAIFWQSSYDYSATTVLGWGDGYYKG  124



>ref|XP_009388411.1| PREDICTED: transcription factor MYC2 [Musa acuminata subsp. malaccensis]
Length=705

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            +  TLQQRLQ +++   +SW Y IFWQ+S D   G  FL WGDG+++G
Sbjct  73   SQETLQQRLQALIEGARESWTYGIFWQSSVDAATGASFLGWGDGYYKG  120



>ref|XP_006415166.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
 gb|ESQ33519.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
Length=624

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            +  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  60   SQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKG  106



>ref|XP_004140617.1| PREDICTED: transcription factor ATR2-like [Cucumis sativus]
 gb|KGN46541.1| hypothetical protein Csa_6G107910 [Cucumis sativus]
Length=431

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            L  RL+F+L +Q   W+YAIFWQT+ DD+G + L+W DG FQ
Sbjct  17   LHHRLRFLLHSQPLPWSYAIFWQTTTDDNGSVSLSWRDGHFQ  58



>ref|XP_008341963.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=688

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            N  TL QRLQ ++    +SW YAIFWQ+S D  G   L WG+GF++
Sbjct  78   NQETLMQRLQALIDGARESWTYAIFWQSSYDYSGAAVLGWGEGFYK  123



>ref|XP_007208833.1| hypothetical protein PRUPE_ppa025417mg [Prunus persica]
 gb|EMJ10032.1| hypothetical protein PRUPE_ppa025417mg [Prunus persica]
Length=474

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q   +T QQRLQFI++ + + W YA FWQ S D + ++ L+W  G F+ +K
Sbjct  15   QETSATCQQRLQFIVQNRPEWWVYATFWQASKDSNDQISLSWAGGHFKSSK  65



>ref|XP_008238247.1| PREDICTED: transcription factor MYC2 [Prunus mume]
Length=685

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            N  TL QRLQ +++   +SW YAIFWQ+S D  G   L WG+GF++
Sbjct  78   NQETLMQRLQALIEGARESWTYAIFWQSSYDYSGGTVLGWGEGFYK  123



>ref|XP_004166899.1| PREDICTED: transcription factor ATR2-like [Cucumis sativus]
Length=431

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            L  RL+F+L +Q   W+YAIFWQT+ DD+G + L+W DG FQ
Sbjct  17   LHHRLRFLLHSQPLPWSYAIFWQTTTDDNGSVSLSWRDGHFQ  58



>emb|CDY35179.1| BnaA09g18160D [Brassica napus]
Length=562

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 5/52 (10%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDG-----RLFLAWGDGFFQG  303
            N  TLQQRLQ ++++  + W YAIFWQ S+D D       + L WGDG+++G
Sbjct  63   NEDTLQQRLQTLIESAGERWTYAIFWQISHDFDSPAGENTVILGWGDGYYRG  114



>ref|XP_004300239.1| PREDICTED: transcription factor MYC2-like [Fragaria vesca subsp. 
vesca]
Length=682

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            N  TL QRLQ +++   +SW YAIFWQ+S D  G   L WG+GF++
Sbjct  74   NQETLMQRLQALIEGARESWTYAIFWQSSYDMSGASVLGWGEGFYK  119



>ref|XP_006283348.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
 gb|EOA16246.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
Length=614

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 10/59 (17%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND----DDG------RLFLAWGDGFFQG  303
            Q N  TLQQRLQ +++   +SW YA+FWQ+S D    DDG         L WGDG+++G
Sbjct  60   QFNEDTLQQRLQALIEGANESWTYAVFWQSSYDFAGEDDGGGESRNTAVLGWGDGYYKG  118



>ref|XP_008245385.1| PREDICTED: transcription factor bHLH14-like isoform X2 [Prunus 
mume]
Length=475

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q N  + QQRLQFI++ + + W Y+IFWQ S D + ++ L+W  G F+  +
Sbjct  15   QENSVSFQQRLQFIVQNRPEWWVYSIFWQASKDSNDQVALSWAGGHFESPR  65



>ref|XP_008245384.1| PREDICTED: transcription factor bHLH14-like isoform X1 [Prunus 
mume]
Length=476

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            Q N  + QQRLQFI++ + + W Y+IFWQ S D + ++ L+W  G F+  +
Sbjct  15   QENSVSFQQRLQFIVQNRPEWWVYSIFWQASKDSNDQVALSWAGGHFESPR  65



>ref|XP_009114329.1| PREDICTED: transcription factor MYC3-like [Brassica rapa]
Length=563

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 5/52 (10%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDG-----RLFLAWGDGFFQG  303
            N  TLQQRLQ ++++  + W YAIFWQ S+D D       + L WGDG+++G
Sbjct  64   NEDTLQQRLQTLIESAGERWTYAIFWQISHDFDSPAGENTVILGWGDGYYRG  115



>ref|XP_010530031.1| PREDICTED: transcription factor MYC4 [Tarenaya hassleriana]
Length=653

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 7/54 (13%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTS-------NDDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ +++   ++W YAI+WQ S        D +G  FL WGDG+++G
Sbjct  68   NEDTLQQRLQALIEGARETWTYAIYWQLSYDSIAGGGDGEGTAFLGWGDGYYKG  121



>gb|AIT39751.1| transcription factor MYC2, partial [Chrysanthemum boreale]
Length=648

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQG  303
            N  TLQQRLQ ++ T  +SW YAIFWQ+S  +  G   L WGDG+++G
Sbjct  56   NQDTLQQRLQGLIDTAHESWTYAIFWQSSVLEYSGPPILGWGDGYYKG  103



>emb|CDY03195.1| BnaC09g19610D [Brassica napus]
Length=545

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 5/52 (10%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD-----GRLFLAWGDGFFQG  303
            N  TLQQRLQ ++++  + W YAIFWQ S+D D       + L WGDG+++G
Sbjct  62   NEDTLQQRLQTLIESAGERWTYAIFWQISHDFDSPAGESTVILGWGDGYYRG  113



>ref|XP_008245390.1| PREDICTED: transcription factor MYC2-like [Prunus mume]
Length=483

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            Q N S  Q+RLQFI + + + W Y+IFWQ SND + ++ L+W  G F+
Sbjct  15   QENSSIFQKRLQFIFQNRPEWWLYSIFWQASNDSNDQVSLSWAGGDFR  62



>gb|AAL55711.1|AF251689_1 putative transcription factor BHLH4 [Arabidopsis thaliana]
Length=589

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 7/56 (13%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTS-------NDDDGRLFLAWGDGFFQG  303
            Q N   LQQRLQ +++   ++W YA+FWQ+S       N+++  + L WGDG+++G
Sbjct  57   QVNEDNLQQRLQALIEGANENWTYAVFWQSSHGFAGEDNNNNNTVLLGWGDGYYKG  112



>ref|NP_193522.1| transcription factor MYC4 [Arabidopsis thaliana]
 sp|O49687.1|MYC4_ARATH RecName: Full=Transcription factor MYC4; Short=AtMYC4; AltName: 
Full=Basic helix-loop-helix protein 4; Short=AtbHLH4; Short=bHLH 
4; AltName: Full=Transcription factor EN 37; AltName: 
Full=bHLH transcription factor bHLH004 [Arabidopsis thaliana]
 emb|CAA17131.1| bHLH protein-like [Arabidopsis thaliana]
 emb|CAB78790.1| bHLH protein-like [Arabidopsis thaliana]
 dbj|BAD94748.1| putative transcription factor BHLH4 [Arabidopsis thaliana]
 gb|AEE83960.1| transcription factor MYC4 [Arabidopsis thaliana]
Length=589

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 7/56 (13%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTS-------NDDDGRLFLAWGDGFFQG  303
            Q N   LQQRLQ +++   ++W YA+FWQ+S       N+++  + L WGDG+++G
Sbjct  57   QVNEDNLQQRLQALIEGANENWTYAVFWQSSHGFAGEDNNNNNTVLLGWGDGYYKG  112



>ref|XP_010531704.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=615

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            +  +LQQRLQ +++   +SW YA+FWQ S D  G   L WGDG+++G
Sbjct  48   SQESLQQRLQALIEGAHESWTYAMFWQLSCDFSGAAVLGWGDGYYKG  94



>ref|XP_006287856.1| hypothetical protein CARUB_v10001082mg [Capsella rubella]
 gb|EOA20754.1| hypothetical protein CARUB_v10001082mg [Capsella rubella]
Length=411

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDD-GRLFLAWGDGFFQGTK  309
            LQQ+L+FI++T  D WAY IFWQ   DD   R +L W DG F+G K
Sbjct  31   LQQKLRFIVETSPDQWAYIIFWQKMIDDQLDRSYLVWVDGHFRGNK  76



>ref|NP_567195.1| transcription factor bHLH14 [Arabidopsis thaliana]
 sp|O23090.1|BH014_ARATH RecName: Full=Transcription factor bHLH14; AltName: Full=Basic 
helix-loop-helix protein 14; Short=AtbHLH14; Short=bHLH 14; 
AltName: Full=Transcription factor EN 33; AltName: Full=bHLH 
transcription factor bHLH014 [Arabidopsis thaliana]
 gb|AAB62853.1| similar to the myc family of helix-loop-helix transcription factors 
[Arabidopsis thaliana]
 emb|CAB80896.1| AT4g00870 [Arabidopsis thaliana]
 emb|CAD58596.1| putative bHLH transcription factor [Arabidopsis thaliana]
 gb|AEE81947.1| transcription factor bHLH14 [Arabidopsis thaliana]
Length=423

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +1

Query  160  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDG-RLFLAWGDGFFQGTK  309
            P    LQQ+L+F+++T  D WAY IFWQ   DD   R +L W DG F G K
Sbjct  30   PPDLVLQQKLRFVVETSPDRWAYVIFWQKMFDDQSDRSYLVWVDGHFCGNK  80



>ref|XP_004159750.1| PREDICTED: transcription factor MYC4-like [Cucumis sativus]
Length=443

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            +TLQQRLQFIL  + + WAY+IFW  S D +G L   WGDG  +
Sbjct  16   TTLQQRLQFILHNRHEWWAYSIFWLASKDINGNLVFTWGDGHLR  59



>ref|XP_004146202.1| PREDICTED: transcription factor MYC4-like [Cucumis sativus]
Length=443

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            +TLQQRLQFIL  + + WAY+IFW  S D +G L   WGDG  +
Sbjct  16   TTLQQRLQFILHNRHEWWAYSIFWLASKDINGNLVFTWGDGHLR  59



>gb|KGN55667.1| hypothetical protein Csa_3G002860 [Cucumis sativus]
Length=447

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            +TLQQRLQFIL  + + WAY+IFW  S D +G L   WGDG  +
Sbjct  19   TTLQQRLQFILHNRHEWWAYSIFWLASKDINGNLVFTWGDGHLR  62



>ref|XP_006366244.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=650

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRL--FLAWGDGFFQG  303
            N  +LQQRLQ ++    +SWAYAIFWQ+S+  D      L WGDG+++G
Sbjct  57   NQESLQQRLQALIDGARESWAYAIFWQSSSTSDFATPSVLGWGDGYYKG  105



>emb|CAF74711.1| MYC transcription factor [Solanum tuberosum]
Length=646

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRL--FLAWGDGFFQG  303
            N  +LQQRLQ ++    +SWAYAIFWQ+S+  D      L WGDG+++G
Sbjct  57   NQESLQQRLQALIDGARESWAYAIFWQSSSTSDFATPSVLGWGDGYYKG  105



>ref|NP_001288107.1| uncharacterized protein LOC101261048 [Solanum lycopersicum]
 gb|AIC63945.1| MYC1 [Solanum lycopersicum]
Length=630

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQG  303
            N  +LQQRLQ ++    +SWAYAIFWQ+S  D   +  L WGDG+++G
Sbjct  56   NQESLQQRLQALIDGARESWAYAIFWQSSVVDFASQTVLGWGDGYYKG  103



>gb|KFK31432.1| hypothetical protein AALP_AA6G111200 [Arabis alpina]
Length=585

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 5/50 (10%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFF  297
            N  TLQQRLQ ++++ +++W YAIFWQ S+D      D  + L WGDG++
Sbjct  48   NEDTLQQRLQALIESASENWLYAIFWQISHDFNSSTGDNTVILGWGDGYY  97



>gb|ADH04262.1| bHLH1 transcription factor [Nicotiana benthamiana]
Length=680

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGT--KAGR  318
            N  TLQQRLQ ++    ++W YAIFWQ+S  D    + L WGDG+++G   KA R
Sbjct  86   NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLTSPILLVWGDGYYKGEEDKANR  140



>ref|XP_002865164.1| hypothetical protein ARALYDRAFT_916752 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41423.1| hypothetical protein ARALYDRAFT_916752 [Arabidopsis lyrata subsp. 
lyrata]
Length=610

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 5/52 (10%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFF  297
            Q N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG++
Sbjct  50   QFNEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYY  101



>gb|KCW72577.1| hypothetical protein EUGRSUZ_E01046 [Eucalyptus grandis]
Length=354

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  187  LQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            +  IL+ + + W Y+IFWQ S DD GRL L WG G F+GT
Sbjct  19   VHLILRARPEDWVYSIFWQPSRDDHGRLVLTWGYGHFRGT  58



>ref|XP_010538366.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=613

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +1

Query  166  HSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
              TLQQRL  +++   + W YAIFWQ S D  G   L WGDG+++G
Sbjct  59   QETLQQRLHALIEGAHEGWTYAIFWQLSYDFSGAAVLGWGDGYYKG  104



>ref|XP_009413229.1| PREDICTED: transcription factor MYC2-like [Musa acuminata subsp. 
malaccensis]
Length=707

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            +  TLQQRLQ +++   +SW Y IFWQ+S D   G  +L WGDG+++G
Sbjct  68   SQETLQQRLQTLIEGARESWTYGIFWQSSVDAATGASYLGWGDGYYKG  115



>emb|CDX77688.1| BnaC07g19420D [Brassica napus]
Length=452

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 5/52 (10%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFF  297
            Q N  TLQQRLQ ++++  + W YAIFWQ S+D      D  + L WGDG++
Sbjct  47   QFNEDTLQQRLQALIESAGEKWTYAIFWQISHDFESPTGDNAVVLGWGDGYY  98



>ref|XP_003534274.2| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=731

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFF  297
            N  TLQ RLQ +++   ++W YAIFWQ+S D  G   L WGDG++
Sbjct  113  NQDTLQHRLQALIEGARETWTYAIFWQSSYDYSGSTLLGWGDGYY  157



>emb|CDY58502.1| BnaA06g40330D [Brassica napus]
Length=449

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 5/52 (10%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFF  297
            Q N  TLQQRLQ ++++  + W YAIFWQ S+D      D  + L WGDG++
Sbjct  44   QFNEDTLQQRLQALIESAGEKWTYAIFWQISHDFESPAGDNAVVLGWGDGYY  95



>ref|XP_010481417.1| PREDICTED: transcription factor MYC3 [Camelina sativa]
Length=610

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFF  297
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG++
Sbjct  56   NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYY  105



>ref|XP_010441550.1| PREDICTED: transcription factor MYC3-like [Camelina sativa]
Length=607

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFF  297
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG++
Sbjct  56   NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYY  105



>ref|XP_010494857.1| PREDICTED: transcription factor MYC3-like [Camelina sativa]
Length=607

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFF  297
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG++
Sbjct  55   NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYY  104



>ref|XP_002868032.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44291.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=598

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 11/58 (19%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND----DDG-------RLFLAWGDGFFQG  303
            N   LQQRLQ +++   +SW YA+FWQ+S+D    DDG          L WGDG+++G
Sbjct  58   NEDNLQQRLQALIEGANESWTYAVFWQSSHDFAGEDDGVRTNNNNTTLLGWGDGYYKG  115



>ref|XP_010559309.1| PREDICTED: transcription factor MYC4-like [Tarenaya hassleriana]
Length=635

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = +1

Query  166  HSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD---GRLFLAWGDGFFQG  303
            + TLQQRLQ +++   ++W YAIFWQ S D D   G   L WGDG+++G
Sbjct  70   NETLQQRLQALIEGAPETWTYAIFWQLSYDFDAAGGTALLGWGDGYYKG  118



>ref|XP_009412473.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=467

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT----------  306
            +P  S LQ RLQ +L ++ + W YAIFW+ S D      LA+GDG F+G           
Sbjct  55   RPATSALQHRLQCLLGSRPEWWTYAIFWRASPDHH---LLAFGDGHFRGNRELDGRRVPP  111

Query  307  KAGRGGGVPVVV  342
            ++G GGGV  V+
Sbjct  112  RSGSGGGVHAVL  123



>ref|NP_199488.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
 sp|Q9FIP9.1|MYC3_ARATH RecName: Full=Transcription factor MYC3; AltName: Full=Basic 
helix-loop-helix protein 5; Short=AtbHLH5; Short=bHLH 5; AltName: 
Full=Protein ALTERED TRYPTOPHAN REGULATION 2; AltName: 
Full=Transcription factor ATR2; AltName: Full=Transcription 
factor EN 36; AltName: Full=bHLH transcription factor bHLH005 
[Arabidopsis thaliana]
 dbj|BAB08920.1| bHLH protein-like [Arabidopsis thaliana]
 gb|AED95422.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
Length=592

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFF  297
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG++
Sbjct  48   NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYY  97



>gb|AAL55712.1|AF251690_1 putative transcription factor BHLH5 [Arabidopsis thaliana]
Length=592

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFF  297
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG++
Sbjct  48   NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYY  97



>ref|XP_001754025.1| predicted protein [Physcomitrella patens]
 gb|EDQ81347.1| predicted protein [Physcomitrella patens]
Length=576

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            N S L +RL  +++  T  W YAIFWQ S   +G + L WGDG+F+  K
Sbjct  43   NESVLLRRLHSLVEESTVDWTYAIFWQLSALREGEMMLGWGDGYFRSAK  91



>ref|XP_008786336.1| PREDICTED: transcription factor MYC2-like [Phoenix dactylifera]
Length=680

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            N  TLQQRL  +++   ++W YAIFWQ+S D   G   L WGDGF++G
Sbjct  61   NQETLQQRLLTLIEGARETWTYAIFWQSSVDVASGASLLGWGDGFYKG  108



>ref|XP_003528771.1| PREDICTED: transcription factor MYC2-like [Glycine max]
 gb|KHN06348.1| Transcription factor bHLH14 [Glycine soja]
Length=464

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  214  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            D W YAIFWQ S+DD+G L+L++G+G FQGTK
Sbjct  41   DWWVYAIFWQASHDDNGNLYLSFGEGHFQGTK  72



>ref|XP_009101493.1| PREDICTED: transcription factor MYC3 [Brassica rapa]
Length=580

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 5/52 (10%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFF  297
            Q N  TLQQRLQ ++++  + W YAIFWQ S+D      D  + L WGDG++
Sbjct  44   QFNEDTLQQRLQALIESAGEKWTYAIFWQISHDFESPAGDNAVVLGWGDGYY  95



>ref|XP_007135301.1| hypothetical protein PHAVU_010G117900g [Phaseolus vulgaris]
 gb|ESW07295.1| hypothetical protein PHAVU_010G117900g [Phaseolus vulgaris]
Length=464

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  214  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            D W YAIFWQ S+DD+G L+L++G+G FQGTK
Sbjct  41   DWWVYAIFWQASHDDNGNLYLSFGEGHFQGTK  72



>ref|XP_008238755.1| PREDICTED: transcription factor bHLH14-like isoform X2 [Prunus 
mume]
Length=483

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            Q N  T QQRLQFI + + + W Y+IFWQ S D + ++ L+W  G F+
Sbjct  15   QENLGTFQQRLQFIFQNRPEWWVYSIFWQPSKDSNDQVSLSWAAGDFR  62



>ref|XP_008238754.1| PREDICTED: transcription factor MYC4-like isoform X1 [Prunus 
mume]
Length=484

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            Q N  T QQRLQFI + + + W Y+IFWQ S D + ++ L+W  G F+
Sbjct  15   QENLGTFQQRLQFIFQNRPEWWVYSIFWQPSKDSNDQVSLSWAAGDFR  62



>ref|XP_009415334.1| PREDICTED: transcription factor bHLH13-like [Musa acuminata subsp. 
malaccensis]
Length=609

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGF  294
            + LQ  LQ +++ QT +WAYAIFWQ S  + G   L WGDG+
Sbjct  47   ADLQNNLQDVVEGQTSTWAYAIFWQISRSESGDFVLGWGDGY  88



>ref|XP_008803328.1| PREDICTED: transcription factor MYC3-like [Phoenix dactylifera]
Length=438

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            TLQ RLQ +L ++ + WAYAI W+ S  +D    L+WGDG+F+G +
Sbjct  32   TLQLRLQCLLHSRPEWWAYAILWRPSAAEDRPAVLSWGDGYFRGPR  77



>ref|XP_006279855.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
 gb|EOA12753.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
Length=602

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR-----LFLAWGDGFF  297
            N  TLQQRLQ ++++  ++W YAIFWQ S+D D       + L WGDG++
Sbjct  50   NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGENTVILGWGDGYY  99



>gb|ADH04267.1| MYC1a transcription factor [Nicotiana tabacum]
 gb|ADU60101.1| MYC2b transcription factor [Nicotiana tabacum]
 gb|ADU60102.1| MYC2c transcription factor [Nicotiana tabacum]
Length=681

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQGT--KAGR  318
            N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KA R
Sbjct  87   NQETLQQRLQTLIDGARETWTYAIFWQSSAVDLTSPFVLGWGDGYYKGEEDKANR  141



>ref|XP_001765161.1| predicted protein [Physcomitrella patens]
 gb|EDQ69889.1| predicted protein [Physcomitrella patens]
Length=829

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            N S LQ+RL  +++  ++ W Y IFWQ S    G   L WGDG+++G K
Sbjct  105  NDSVLQRRLHRLVEESSEDWTYGIFWQLSLSPSGESMLGWGDGYYKGPK  153



>ref|XP_009609942.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
Length=679

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQGT--KAGR  318
            N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KA R
Sbjct  86   NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLSSPFVLGWGDGYYKGEEDKANR  140



>gb|ADH04268.1| MYC1b transcription factor [Nicotiana tabacum]
 gb|ADU60100.1| MYC2a transcription factor [Nicotiana tabacum]
Length=679

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQGT--KAGR  318
            N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KA R
Sbjct  86   NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLSSPFVLGWGDGYYKGEEDKANR  140



>gb|KEH18599.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=454

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  211  TDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            +++W Y I WQT+ D+ G+ FL+WG+G+FQGTK
Sbjct  35   SENWIYGILWQTTKDEKGKPFLSWGEGYFQGTK  67



>ref|XP_004512525.1| PREDICTED: transcription factor MYC2-like [Cicer arietinum]
Length=664

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            TLQQRLQ +++  T++W YAIFWQ S D  G   L WGDG+++G
Sbjct  44   TLQQRLQALIEGATETWTYAIFWQPSYDYSG-TSLGWGDGYYKG  86



>ref|XP_009780487.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=681

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQGT--KAGR  318
            N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KA R
Sbjct  87   NQETLQQRLQTLIDGARETWTYAIFWQSSAVDLTSPFVLGWGDGYYKGEEDKANR  141



>gb|AIO09733.1| transcription factor MYC2 [Salvia miltiorrhiza]
Length=602

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTS-NDDDGRLFLAWGDGFFQG  303
            N  TLQQRL  +++   +SW YAIFWQ+S  D  G   L WGDG+++G
Sbjct  68   NQETLQQRLLALIEGARESWTYAIFWQSSVVDYGGPSVLGWGDGYYKG  115



>ref|XP_007156435.1| hypothetical protein PHAVU_003G285700g [Phaseolus vulgaris]
 gb|ESW28429.1| hypothetical protein PHAVU_003G285700g [Phaseolus vulgaris]
Length=642

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQ-TSNDDDGRLFLAWGDGFFQGTKAGRGGGVP  333
            N  TLQQRLQ +++   +SW YAIFWQ + +       L WGDG+++G +    G  P
Sbjct  68   NQETLQQRLQTLIEGAEESWTYAIFWQSSYDYSSSTSLLGWGDGYYKGEEDKGKGKAP  125



>gb|AAB00686.1| phaseolin G-box binding protein PG1 [Phaseolus vulgaris]
Length=642

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQ-TSNDDDGRLFLAWGDGFFQGTKAGRGGGVP  333
            N  TLQQRLQ +++   +SW YAIFWQ + +       L WGDG+++G +    G  P
Sbjct  68   NQETLQQRLQTLIEGAEESWTYAIFWQSSYDYSSSTSLLGWGDGYYKGEEDKGKGKAP  125



>ref|XP_010919958.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=691

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQG  303
            N  TLQQRL  +++   ++W YAIFWQ+S D   G   L WGDG+++G
Sbjct  64   NQETLQQRLLTLIEGARETWTYAIFWQSSVDVASGVSLLGWGDGYYKG  111



>ref|XP_006294316.1| hypothetical protein CARUB_v10023324mg [Capsella rubella]
 gb|EOA27214.1| hypothetical protein CARUB_v10023324mg [Capsella rubella]
Length=409

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  160  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGR  318
            P  + +Q+ LQ +L      W YAI+WQ S D+ G   L WGDGF++G +  +
Sbjct  11   PVETAVQKLLQAVLDGTHRGWTYAIYWQPSFDNSGETVLVWGDGFYKGQEDSK  63



>ref|XP_003548195.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=466

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  214  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            D W YAIFWQ S+DD+G L+L++G+G FQGTK
Sbjct  39   DWWVYAIFWQASHDDNGNLYLSFGEGHFQGTK  70



>gb|KHN15898.1| Transcription factor bHLH14 [Glycine soja]
Length=465

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  214  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            D W YAIFWQ S+DD+G L+L++G+G FQGTK
Sbjct  39   DWWVYAIFWQASHDDNGNLYLSFGEGHFQGTK  70



>ref|XP_008350027.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=517

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT  306
            +T QQRLQFI++   + W Y+IFW+ S D   ++ L+W  G FQ T
Sbjct  21   TTFQQRLQFIVQNVPEWWVYSIFWRASKDSSDQVSLSWAGGHFQNT  66



>ref|XP_007210206.1| hypothetical protein PRUPE_ppa016220mg [Prunus persica]
 gb|EMJ11405.1| hypothetical protein PRUPE_ppa016220mg [Prunus persica]
Length=459

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ  300
            Q N  T QQRLQFI + + + W Y IFWQ+S D + ++ L+W  G F+
Sbjct  15   QENLGTFQQRLQFIFQNRPEWWLYWIFWQSSKDSNDQVSLSWAAGDFR  62



>ref|XP_001752627.1| predicted protein [Physcomitrella patens]
 gb|EDQ82498.1| predicted protein [Physcomitrella patens]
Length=982

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG  303
            + N S LQ+RL  +++  +++W Y IFWQ S    G   L WGDG+++G
Sbjct  44   EQNDSVLQRRLHTLVEESSENWIYGIFWQRSLSPSGESILGWGDGYYKG  92



>gb|ACU18071.1| unknown [Glycine max]
Length=245

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  214  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK  309
            D W YAIFWQ S+DD+G L+L++G+G FQGTK
Sbjct  39   DWWVYAIFWQASHDDNGSLYLSFGEGHFQGTK  70



>ref|XP_007210118.1| hypothetical protein PRUPE_ppa022201mg [Prunus persica]
 gb|EMJ11317.1| hypothetical protein PRUPE_ppa022201mg [Prunus persica]
Length=476

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDG  291
            Q N  + QQRLQFI++ + + W Y+IFWQ S D + ++ L+W  G
Sbjct  15   QENSVSFQQRLQFIVQNRPEWWVYSIFWQASKDSNDQVALSWAGG  59



>emb|CDX78808.1| BnaA01g08750D [Brassica napus]
Length=579

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 6/50 (12%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR------LFLAWGDGFFQG  303
            TLQQRLQ +++   +SW YA+FWQ S+D  G         L+WGDG+++G
Sbjct  61   TLQQRLQALIEGARESWTYAVFWQLSHDFAGEDISNTAALLSWGDGYYKG  110



>emb|CDY44507.1| BnaC01g10420D [Brassica napus]
Length=586

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 6/50 (12%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR------LFLAWGDGFFQG  303
            TLQQRLQ +++   +SW YA+FWQ S+D  G         L+WGDG+++G
Sbjct  61   TLQQRLQALIEGARESWTYAVFWQLSHDFAGEDISNTAALLSWGDGYYKG  110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559392177135