BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF009E09

Length=491
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009765281.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR ...    153   1e-41   Nicotiana sylvestris
ref|XP_009765278.1|  PREDICTED: uncharacterized protein LOC104216...    154   2e-41   Nicotiana sylvestris
ref|XP_009610506.1|  PREDICTED: uncharacterized protein LOC104104...    151   2e-40   Nicotiana tomentosiformis
ref|XP_009610509.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR ...    150   2e-40   Nicotiana tomentosiformis
ref|XP_006351347.1|  PREDICTED: uncharacterized protein LOC102597...    144   8e-38   Solanum tuberosum [potatoes]
ref|XP_006351348.1|  PREDICTED: uncharacterized protein LOC102597...    143   2e-37   Solanum tuberosum [potatoes]
ref|XP_004249287.1|  PREDICTED: uncharacterized protein LOC101263558    139   9e-36   
gb|KDP40599.1|  hypothetical protein JCGZ_24598                         117   5e-28   Jatropha curcas
emb|CBI29160.3|  unnamed protein product                                102   1e-22   Vitis vinifera
emb|CDP10151.1|  unnamed protein product                              96.3    1e-20   Coffea canephora [robusta coffee]
ref|XP_002276838.1|  PREDICTED: uncharacterized protein LOC100262520  92.4    3e-19   Vitis vinifera
ref|XP_002525579.1|  ubiquitin-protein ligase, putative               92.0    5e-19   Ricinus communis
gb|KDO48650.1|  hypothetical protein CISIN_1g0162582mg                87.0    6e-18   Citrus sinensis [apfelsine]
gb|ABK96344.1|  unknown                                               88.6    8e-18   Populus trichocarpa x Populus deltoides
ref|XP_002304823.2|  hypothetical protein POPTR_0003s18860g           88.6    8e-18   Populus trichocarpa [western balsam poplar]
ref|XP_008782756.1|  PREDICTED: uncharacterized protein LOC103702200  89.4    8e-18   Phoenix dactylifera
ref|XP_006432513.1|  hypothetical protein CICLE_v10001427mg           87.8    2e-17   Citrus clementina [clementine]
ref|XP_011020515.1|  PREDICTED: uncharacterized protein LOC105122866  87.4    2e-17   Populus euphratica
ref|XP_011075114.1|  PREDICTED: uncharacterized protein LOC105159...  86.7    4e-17   Sesamum indicum [beniseed]
ref|XP_006291209.1|  hypothetical protein CARUB_v10017338mg           87.0    4e-17   Capsella rubella
ref|XP_008445920.1|  PREDICTED: uncharacterized protein LOC103488802  87.0    4e-17   Cucumis melo [Oriental melon]
ref|XP_011075118.1|  PREDICTED: uncharacterized protein LOC105159...  85.5    6e-17   Sesamum indicum [beniseed]
ref|XP_010504239.1|  PREDICTED: uncharacterized protein LOC104781301  85.1    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_004147090.1|  PREDICTED: uncharacterized protein LOC101210945  85.1    2e-16   Cucumis sativus [cucumbers]
gb|KCW65832.1|  hypothetical protein EUGRSUZ_G03178                   83.2    4e-16   Eucalyptus grandis [rose gum]
ref|XP_010067651.1|  PREDICTED: uncharacterized protein LOC104454492  83.6    4e-16   Eucalyptus grandis [rose gum]
gb|KCW65831.1|  hypothetical protein EUGRSUZ_G03178                   84.0    5e-16   Eucalyptus grandis [rose gum]
ref|XP_002877973.1|  binding protein                                  84.0    5e-16   
gb|EYU39947.1|  hypothetical protein MIMGU_mgv1a009191mg              82.8    8e-16   Erythranthe guttata [common monkey flower]
ref|XP_011034631.1|  PREDICTED: uncharacterized protein LOC105132695  81.6    2e-15   Populus euphratica
ref|XP_010427133.1|  PREDICTED: uncharacterized protein LOC104712035  82.4    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009116123.1|  PREDICTED: uncharacterized protein LOC103841350  81.6    4e-15   Brassica rapa
emb|CDX78232.1|  BnaA09g34270D                                        81.3    5e-15   
emb|CDX73486.1|  BnaC08g25170D                                        81.3    5e-15   
ref|XP_006403583.1|  hypothetical protein EUTSA_v10010421mg           80.9    6e-15   Eutrema salsugineum [saltwater cress]
ref|NP_191004.1|  zinc ion binding protein                            80.9    7e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CDX67597.1|  BnaA07g16370D                                        80.5    1e-14   
ref|XP_010515962.1|  PREDICTED: uncharacterized protein LOC104791708  80.5    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010921286.1|  PREDICTED: uncharacterized protein LOC105044901  79.7    1e-14   Elaeis guineensis
ref|XP_010938114.1|  PREDICTED: uncharacterized protein LOC105057...  78.6    5e-14   
ref|XP_009103916.1|  PREDICTED: uncharacterized protein LOC103829975  78.2    7e-14   Brassica rapa
ref|XP_002297702.1|  hypothetical protein POPTR_0001s07350g           77.4    8e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010938116.1|  PREDICTED: uncharacterized protein LOC105057...  77.4    1e-13   
gb|ACU19631.1|  unknown                                               75.1    1e-13   Glycine max [soybeans]
ref|XP_003522869.1|  PREDICTED: uncharacterized protein LOC100813...  75.9    3e-13   Glycine max [soybeans]
ref|XP_004516522.1|  PREDICTED: uncharacterized protein LOC101498396  74.7    7e-13   Cicer arietinum [garbanzo]
ref|XP_010689828.1|  PREDICTED: uncharacterized protein LOC104903488  73.9    2e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007148770.1|  hypothetical protein PHAVU_005G012800g           73.9    2e-12   Phaseolus vulgaris [French bean]
ref|XP_007010628.1|  Zinc ion binding                                 72.4    5e-12   
gb|ACU21424.1|  unknown                                               70.1    7e-12   Glycine max [soybeans]
ref|XP_008793368.1|  PREDICTED: uncharacterized protein LOC103709685  72.0    7e-12   
ref|XP_010533372.1|  PREDICTED: uncharacterized protein LOC104809184  72.0    7e-12   Tarenaya hassleriana [spider flower]
ref|XP_010276468.1|  PREDICTED: uncharacterized protein LOC104611195  72.0    7e-12   Nelumbo nucifera [Indian lotus]
ref|XP_003527531.1|  PREDICTED: uncharacterized protein LOC100813844  70.9    2e-11   Glycine max [soybeans]
gb|KEH32916.1|  zinc ion-binding protein, putative                    70.9    2e-11   Medicago truncatula
gb|KHN26422.1|  Polycomb complex protein BMI-1                        70.5    2e-11   Glycine soja [wild soybean]
gb|KJB67761.1|  hypothetical protein B456_010G208800                  70.5    2e-11   Gossypium raimondii
gb|KHF99857.1|  E3 ubiquitin-protein ligase CHFR                      70.1    3e-11   Gossypium arboreum [tree cotton]
gb|KEH32917.1|  zinc ion-binding protein, putative                    68.9    8e-11   Medicago truncatula
ref|XP_009420238.1|  PREDICTED: uncharacterized protein LOC104000028  68.9    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010091318.1|  E3 ubiquitin-protein ligase CHFR                 68.6    1e-10   
emb|CDM81302.1|  unnamed protein product                              67.0    4e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007218231.1|  hypothetical protein PRUPE_ppa007956mg           64.7    2e-09   Prunus persica
gb|EMT10100.1|  E3 ubiquitin-protein ligase CHFR                      65.1    3e-09   
ref|XP_008231724.1|  PREDICTED: uncharacterized protein LOC103330891  64.3    3e-09   Prunus mume [ume]
ref|XP_006643640.1|  PREDICTED: uncharacterized protein LOC102704921  64.3    3e-09   Oryza brachyantha
ref|XP_008375385.1|  PREDICTED: uncharacterized protein LOC103438629  64.3    3e-09   
ref|XP_003559441.1|  PREDICTED: uncharacterized protein LOC100832811  63.9    4e-09   Brachypodium distachyon [annual false brome]
gb|EEC69773.1|  hypothetical protein OsI_00037                        64.3    4e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_010554493.1|  PREDICTED: uncharacterized protein LOC104824200  63.5    7e-09   Tarenaya hassleriana [spider flower]
gb|EMS59099.1|  E3 ubiquitin-protein ligase CHFR                      63.9    8e-09   Triticum urartu
ref|XP_006829771.1|  hypothetical protein AMTR_s00119p00030390        60.8    1e-08   
ref|NP_001041762.2|  Os01g0104100                                     62.0    2e-08   
ref|XP_004306461.1|  PREDICTED: uncharacterized protein LOC101299030  61.6    2e-08   Fragaria vesca subsp. vesca
dbj|BAJ86803.1|  predicted protein                                    61.6    3e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563481.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR-...  61.6    3e-08   Brachypodium distachyon [annual false brome]
dbj|BAJ90412.1|  predicted protein                                    61.2    3e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN45782.1|  Polycomb complex protein BMI-1-B                      59.3    2e-07   Glycine soja [wild soybean]
gb|KDO48653.1|  hypothetical protein CISIN_1g0162582mg                55.5    4e-07   Citrus sinensis [apfelsine]
gb|EPS69962.1|  hypothetical protein M569_04796                       57.8    4e-07   Genlisea aurea
ref|XP_004978719.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR-...  58.2    4e-07   Setaria italica
ref|XP_002444897.1|  hypothetical protein SORBIDRAFT_07g001060        56.6    1e-06   Sorghum bicolor [broomcorn]
ref|XP_001754304.1|  predicted protein                                56.6    1e-06   
ref|XP_002981629.1|  hypothetical protein SELMODRAFT_154638           56.2    1e-06   Selaginella moellendorffii
gb|ACG25350.1|  hypothetical protein                                  55.5    3e-06   Zea mays [maize]
ref|NP_001140913.1|  LOC100272990                                     55.5    3e-06   Zea mays [maize]
ref|NP_001048384.1|  Os02g0795300                                     54.7    5e-06   
ref|XP_004967927.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR-...  54.7    5e-06   Setaria italica
gb|EEC74169.1|  hypothetical protein OsI_09273                        48.9    5e-04   Oryza sativa Indica Group [Indian rice]



>ref|XP_009765281.1| PREDICTED: E3 ubiquitin-protein ligase CHFR isoform X2 [Nicotiana 
sylvestris]
Length=347

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 93/130 (72%), Gaps = 9/130 (7%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE-KPKQESGEPAMVPSKCPFVHKQQAGS  279
            M PVCPFV+A+RPDD S+KKPGE+Q+KQ    E KPKQESGE A+V  KCPF +    G 
Sbjct  1    MKPVCPFVRASRPDDTSIKKPGENQNKQPASQESKPKQESGESAIVSPKCPFGY----GQ  56

Query  280  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  459
            E KP + SGE A  S +CPFGY    G ENK KQ S +   +SPKCP G+DSQ FKLGP 
Sbjct  57   ETKPKEASGESAVASPQCPFGY----GQENKAKQESGESATVSPKCPFGYDSQAFKLGPF  112

Query  460  SCMICQALLY  489
            SCMICQALLY
Sbjct  113  SCMICQALLY  122



>ref|XP_009765278.1| PREDICTED: uncharacterized protein LOC104216841 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765279.1| PREDICTED: uncharacterized protein LOC104216841 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765280.1| PREDICTED: uncharacterized protein LOC104216841 isoform X1 [Nicotiana 
sylvestris]
Length=409

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 93/130 (72%), Gaps = 9/130 (7%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE-KPKQESGEPAMVPSKCPFVHKQQAGS  279
            M PVCPFV+A+RPDD S+KKPGE+Q+KQ    E KPKQESGE A+V  KCPF +    G 
Sbjct  1    MKPVCPFVRASRPDDTSIKKPGENQNKQPASQESKPKQESGESAIVSPKCPFGY----GQ  56

Query  280  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  459
            E KP + SGE A  S +CPFGY    G ENK KQ S +   +SPKCP G+DSQ FKLGP 
Sbjct  57   ETKPKEASGESAVASPQCPFGY----GQENKAKQESGESATVSPKCPFGYDSQAFKLGPF  112

Query  460  SCMICQALLY  489
            SCMICQALLY
Sbjct  113  SCMICQALLY  122



>ref|XP_009610506.1| PREDICTED: uncharacterized protein LOC104104198 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610507.1| PREDICTED: uncharacterized protein LOC104104198 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610508.1| PREDICTED: uncharacterized protein LOC104104198 isoform X1 [Nicotiana 
tomentosiformis]
Length=409

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 92/130 (71%), Gaps = 9/130 (7%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE-KPKQESGEPAMVPSKCPFVHKQQAGS  279
            M PVCPFV+A+RPDD S KKPGE+Q+KQ    E KPKQES E A+V  KCPF +    G 
Sbjct  1    MKPVCPFVRASRPDDTSTKKPGENQNKQPASQESKPKQESRESAIVSPKCPFGY----GQ  56

Query  280  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  459
            E KP + SGE A VS +CPFGY    G ENK KQ S +   +SPKCP G+DSQ FKLGP 
Sbjct  57   ESKPKEASGESAVVSPQCPFGY----GQENKAKQESGESATVSPKCPFGYDSQAFKLGPF  112

Query  460  SCMICQALLY  489
            SCMICQALLY
Sbjct  113  SCMICQALLY  122



>ref|XP_009610509.1| PREDICTED: E3 ubiquitin-protein ligase CHFR isoform X2 [Nicotiana 
tomentosiformis]
Length=347

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 92/130 (71%), Gaps = 9/130 (7%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE-KPKQESGEPAMVPSKCPFVHKQQAGS  279
            M PVCPFV+A+RPDD S KKPGE+Q+KQ    E KPKQES E A+V  KCPF +    G 
Sbjct  1    MKPVCPFVRASRPDDTSTKKPGENQNKQPASQESKPKQESRESAIVSPKCPFGY----GQ  56

Query  280  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  459
            E KP + SGE A VS +CPFGY    G ENK KQ S +   +SPKCP G+DSQ FKLGP 
Sbjct  57   ESKPKEASGESAVVSPQCPFGY----GQENKAKQESGESATVSPKCPFGYDSQAFKLGPF  112

Query  460  SCMICQALLY  489
            SCMICQALLY
Sbjct  113  SCMICQALLY  122



>ref|XP_006351347.1| PREDICTED: uncharacterized protein LOC102597556 isoform X1 [Solanum 
tuberosum]
Length=415

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 91/141 (65%), Gaps = 19/141 (13%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVH-------  261
            M PVCPF  A+RPDDA++ KP +   +Q     +PK+ESGE A V  KCPF +       
Sbjct  1    MIPVCPFAGASRPDDATLNKPHDENKQQ----AQPKKESGEAATVSPKCPFGYDSTLKKP  56

Query  262  -----KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLG  426
                 KQQ G E KP Q+SGE A VS KCPFGY    G E+KPKQ S +   MSPKCP G
Sbjct  57   CDDQNKQQDGQESKPKQDSGESATVSPKCPFGYD---GQESKPKQDSGESATMSPKCPFG  113

Query  427  FDSQTFKLGPLSCMICQALLY  489
            +DSQ FKLGP SCMICQALLY
Sbjct  114  YDSQAFKLGPFSCMICQALLY  134



>ref|XP_006351348.1| PREDICTED: uncharacterized protein LOC102597556 isoform X2 [Solanum 
tuberosum]
Length=400

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 88/129 (68%), Gaps = 10/129 (8%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            M PVCPF  A+RPDDA++ KP +   +Q     +PK+ESGE A V  KCPF +    G E
Sbjct  1    MIPVCPFAGASRPDDATLNKPHDENKQQ----AQPKKESGEAATVSPKCPFGYD---GQE  53

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
             KP Q+SGE A VS KCPFGY    G E+KPKQ S +   MSPKCP G+DSQ FKLGP S
Sbjct  54   SKPKQDSGESATVSPKCPFGYD---GQESKPKQDSGESATMSPKCPFGYDSQAFKLGPFS  110

Query  463  CMICQALLY  489
            CMICQALLY
Sbjct  111  CMICQALLY  119



>ref|XP_004249287.1| PREDICTED: uncharacterized protein LOC101263558 [Solanum lycopersicum]
Length=443

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 96/163 (59%), Gaps = 35/163 (21%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVH-------  261
            M PVCPF  A+RPDDA++ KP + ++KQ     KPK+ESGE A V  KCPF +       
Sbjct  1    MIPVCPFAGASRPDDATLNKPYD-ENKQQAQESKPKKESGEVATVSPKCPFGYDSTLKKP  59

Query  262  -----KQQAGSEIKPNQESGEQAKVSSKCPFGYT-QEA---------------------G  360
                 KQQ G E KP Q+SGE A VS KCPFGY  QE+                     G
Sbjct  60   CDDQNKQQDGQESKPKQDSGESATVSPKCPFGYDGQESKPKQDSGESATVSPKCPFGYDG  119

Query  361  GENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
             ++KPKQ S +   MSPKCP G+DSQ FKLGP SCMICQALLY
Sbjct  120  QKSKPKQDSGESATMSPKCPFGYDSQAFKLGPFSCMICQALLY  162



>gb|KDP40599.1| hypothetical protein JCGZ_24598 [Jatropha curcas]
Length=393

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 84/132 (64%), Gaps = 27/132 (20%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE--KPKQESGEPAMV-PSKCPFVHKQQA  273
            MTPVCPFVKAARPDD+S+KKPGE+ SK HG     K K++SG+ A   P+KCPF +    
Sbjct  1    MTPVCPFVKAARPDDSSLKKPGENPSK-HGAEHDGKGKKDSGDSATASPAKCPFGY----  55

Query  274  GSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLG  453
                       + A  S KCP GY   +         S K G +SPKCPLG+DSQ+FK+G
Sbjct  56   -----------DSANASPKCPVGYDSAS--------TSPKSGSISPKCPLGYDSQSFKIG  96

Query  454  PLSCMICQALLY  489
            PLSC++CQALL+
Sbjct  97   PLSCILCQALLF  108



>emb|CBI29160.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 70/135 (52%), Gaps = 45/135 (33%)
 Frame = +1

Query  85   HGLLIKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHK  264
            H LLIKMTPVCPFVKAARPDDA+ +KP E                         CP  HK
Sbjct  20   HVLLIKMTPVCPFVKAARPDDATSRKPNE-------------------------CP--HK  52

Query  265  QQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTF  444
             Q   E K  ++SG+ A                    K+ S     +SPKCP G+DSQTF
Sbjct  53   HQLELEGKGKKDSGDSAS------------------TKKDSVDAASISPKCPFGYDSQTF  94

Query  445  KLGPLSCMICQALLY  489
            KLGPLSCMICQALL+
Sbjct  95   KLGPLSCMICQALLF  109



>emb|CDP10151.1| unnamed protein product [Coffea canephora]
Length=371

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 66/132 (50%), Gaps = 50/132 (38%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MT VCPF KA RPDDA+VKK  E+QSK                                 
Sbjct  1    MTTVCPFAKAGRPDDAAVKKCPENQSK---------------------------------  27

Query  283  IKPNQESGEQAKVSSKCPFGY---TQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLG  453
                          SKCPFGY   T  AG E+KP+Q S +   ++PKCP G+DS TFKLG
Sbjct  28   --------------SKCPFGYDSATSAAGNESKPEQESGESARVTPKCPFGYDSDTFKLG  73

Query  454  PLSCMICQALLY  489
            P SCMICQALL+
Sbjct  74   PFSCMICQALLF  85



>ref|XP_002276838.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
 ref|XP_010659029.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
 ref|XP_010659030.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
 ref|XP_010659031.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
Length=369

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 65/129 (50%), Gaps = 45/129 (35%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MTPVCPFVKAARPDDA+ +KP E                         CP  HK Q   E
Sbjct  1    MTPVCPFVKAARPDDATSRKPNE-------------------------CP--HKHQLELE  33

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
             K  ++SG+ A                    K+ S     +SPKCP G+DSQTFKLGPLS
Sbjct  34   GKGKKDSGDSAS------------------TKKDSVDAASISPKCPFGYDSQTFKLGPLS  75

Query  463  CMICQALLY  489
            CMICQALL+
Sbjct  76   CMICQALLF  84



>ref|XP_002525579.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF36838.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=392

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 74/134 (55%), Gaps = 36/134 (27%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MTPVCPFVKA+RPDD+  KK  E+QSK                         H Q+   E
Sbjct  1    MTPVCPFVKASRPDDSPAKKTSENQSK-------------------------HGQEL--E  33

Query  283  IKPNQES---GEQAKVSS-KCPFGY-TQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFK  447
            +K  +ES   G+    +S KCPFGY +  A     PK  +  P     KCPLG+DS++FK
Sbjct  34   LKAKKESCGGGDSVNSNSPKCPFGYDSVNADANASPKSAATIPA----KCPLGYDSRSFK  89

Query  448  LGPLSCMICQALLY  489
            +GPLSC+ICQALL+
Sbjct  90   IGPLSCIICQALLF  103



>gb|KDO48650.1| hypothetical protein CISIN_1g0162582mg, partial [Citrus sinensis]
 gb|KDO48651.1| hypothetical protein CISIN_1g0162582mg, partial [Citrus sinensis]
 gb|KDO48652.1| hypothetical protein CISIN_1g0162582mg, partial [Citrus sinensis]
Length=192

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 72/129 (56%), Gaps = 29/129 (22%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MTPVCPF KA RPDDAS +KPGE+ +K                  P++CPF       S+
Sbjct  1    MTPVCPFAKA-RPDDASPRKPGENSNK-----------------YPAECPF-------SK  35

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
             +P+  +  +A  +S  P    Q     +K K  S     + PKCP G+D+Q+FK+GPLS
Sbjct  36   ARPDDAASRKAVENSAKP----QAEHDGDKAKSDSMDSASIPPKCPFGYDAQSFKIGPLS  91

Query  463  CMICQALLY  489
            CMICQALL+
Sbjct  92   CMICQALLF  100



>gb|ABK96344.1| unknown [Populus trichocarpa x Populus deltoides]
Length=363

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 67/129 (52%), Gaps = 52/129 (40%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MTPVCPFVKA+RPDD S +KPGE                         CP  H    G+E
Sbjct  1    MTPVCPFVKASRPDDGSPRKPGE-------------------------CPIKH----GAE  31

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
                 E G +AK          +E+GGE+           +SPKCP G+DSQTFKLGPLS
Sbjct  32   ----HEGGGKAK----------KESGGES---------ATVSPKCPFGYDSQTFKLGPLS  68

Query  463  CMICQALLY  489
            CMICQALL+
Sbjct  69   CMICQALLF  77



>ref|XP_002304823.2| hypothetical protein POPTR_0003s18860g [Populus trichocarpa]
 gb|EEE79802.2| hypothetical protein POPTR_0003s18860g [Populus trichocarpa]
Length=371

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 67/129 (52%), Gaps = 52/129 (40%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MTPVCPFVKA+RPDD S +KPGE                         CP  H    G+E
Sbjct  1    MTPVCPFVKASRPDDGSPRKPGE-------------------------CPIKH----GAE  31

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
                 E G +AK          +E+GGE+           +SPKCP G+DSQTFKLGPLS
Sbjct  32   ----HEGGGKAK----------KESGGES---------ATVSPKCPFGYDSQTFKLGPLS  68

Query  463  CMICQALLY  489
            CMICQALL+
Sbjct  69   CMICQALLF  77



>ref|XP_008782756.1| PREDICTED: uncharacterized protein LOC103702200 [Phoenix dactylifera]
Length=428

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 72/140 (51%), Gaps = 11/140 (8%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGG-SEKPKQESGEPAMVPSKCPFVH-----K  264
            M+ VCPF KAA    +   K  E+ S+Q     +K   +S +   V   CP  H     +
Sbjct  1    MSFVCPFAKAAGAGASYPMKHEENHSRQQAECDDKGDTKSNDSTSVGDGCPMKHEGNYNR  60

Query  265  QQAGSEIKPNQESGEQAKVSSKCPFGY-----TQEAGGENKPKQVSEKPGVMSPKCPLGF  429
             QA  + K + +S +   V   CP  +       +A  ++K    S    V+SPKCP G+
Sbjct  61   HQAECDDKVDTKSNDSTSVGGGCPMKHEGNYNRHQAECDDKVDTKSNDSAVISPKCPFGY  120

Query  430  DSQTFKLGPLSCMICQALLY  489
            DS TFKLGPLSCMICQALLY
Sbjct  121  DSHTFKLGPLSCMICQALLY  140



>ref|XP_006432513.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
 ref|XP_006432514.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
 ref|XP_006471276.1| PREDICTED: uncharacterized protein LOC102626165 [Citrus sinensis]
 gb|ESR45753.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
 gb|ESR45754.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
Length=392

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 72/129 (56%), Gaps = 29/129 (22%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MTPVCPF KA RPDDAS +KPGE+ +K                  P++CPF       S+
Sbjct  1    MTPVCPFAKA-RPDDASPRKPGENSNK-----------------YPAECPF-------SK  35

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
             +P+  +  +A  +S  P    Q     +K K  S     + PKCP G+D+Q+FK+GPLS
Sbjct  36   ARPDDAASRKAVENSAKP----QAEHDGDKAKSDSIDSASIPPKCPFGYDAQSFKIGPLS  91

Query  463  CMICQALLY  489
            CMICQALL+
Sbjct  92   CMICQALLF  100



>ref|XP_011020515.1| PREDICTED: uncharacterized protein LOC105122866 [Populus euphratica]
Length=363

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 62/129 (48%), Gaps = 52/129 (40%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MTPVCPFVKA+RPDD S +KPGE                         CP  H       
Sbjct  1    MTPVCPFVKASRPDDGSPRKPGE-------------------------CPIKH-------  28

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
                               G   E GG+ K K+ S +   +SPKCP G+DSQTFKLGPLS
Sbjct  29   -------------------GAEHEGGGKAK-KESSGESATVSPKCPFGYDSQTFKLGPLS  68

Query  463  CMICQALLY  489
            CMICQALL+
Sbjct  69   CMICQALLF  77



>ref|XP_011075114.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
 ref|XP_011075115.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
 ref|XP_011075116.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
 ref|XP_011075117.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
Length=353

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 63/129 (49%), Gaps = 59/129 (46%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MTPVCPF+KA+RPDDAS KKP E+Q                           +KQQA ++
Sbjct  1    MTPVCPFIKASRPDDASGKKPSENQ---------------------------NKQQAVND  33

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
             KP Q+S                                 +SPKCP G+DSQTFKLGPLS
Sbjct  34   NKPQQDSA--------------------------------ISPKCPFGYDSQTFKLGPLS  61

Query  463  CMICQALLY  489
            C+ICQALL+
Sbjct  62   CVICQALLF  70



>ref|XP_006291209.1| hypothetical protein CARUB_v10017338mg [Capsella rubella]
 gb|EOA24107.1| hypothetical protein CARUB_v10017338mg [Capsella rubella]
Length=415

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 73/136 (54%), Gaps = 23/136 (17%)
 Frame = +1

Query  106  TPVCPFVKAARPDDASVKKPGESQ------SKQHGGSEKPKQESGEPAMVPSKCPFVHKQ  267
            T VCPF KAARPDD S++K GE        SK     +   ++ GE A   S CPF    
Sbjct  3    TSVCPFSKAARPDDVSIRKQGEMNASGCPFSKAARPDDASARKQGETA--ASGCPF----  56

Query  268  QAGSEIKPNQESGE-QAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQT  441
                  +P+  S   Q ++S+K CP    ++ G  NK    S     +  KCP G+DSQT
Sbjct  57   --SKSARPDDASARNQGEISNKGCP----EDEGKLNKD---STDSATVPAKCPFGYDSQT  107

Query  442  FKLGPLSCMICQALLY  489
            FKLGP SCM+CQALLY
Sbjct  108  FKLGPFSCMLCQALLY  123



>ref|XP_008445920.1| PREDICTED: uncharacterized protein LOC103488802 [Cucumis melo]
Length=404

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 70/139 (50%), Gaps = 36/139 (26%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKP-GESQ-------SKQHGGSEKPKQESGEPAMVPSKCPFV  258
            MTPVCPFVK+ARPDDAS +K  GES              S KP+ ES         CPF 
Sbjct  1    MTPVCPFVKSARPDDASSRKHQGESACPFAKSGRSDDASSRKPQSESA--------CPFS  52

Query  259  H--KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFD  432
               +    S ++ NQ  GE                G E   K V +  G    KCP G+D
Sbjct  53   KSVRSDDASSLEKNQAEGESN--------------GAE---KDVGDAAGA-GGKCPFGYD  94

Query  433  SQTFKLGPLSCMICQALLY  489
            SQTFK+GPLSCMICQALL+
Sbjct  95   SQTFKIGPLSCMICQALLF  113



>ref|XP_011075118.1| PREDICTED: uncharacterized protein LOC105159671 isoform X2 [Sesamum 
indicum]
Length=314

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 63/129 (49%), Gaps = 59/129 (46%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MTPVCPF+KA+RPDDAS KKP E+Q                           +KQQA ++
Sbjct  1    MTPVCPFIKASRPDDASGKKPSENQ---------------------------NKQQAVND  33

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
             KP Q+S                                 +SPKCP G+DSQTFKLGPLS
Sbjct  34   NKPQQDSA--------------------------------ISPKCPFGYDSQTFKLGPLS  61

Query  463  CMICQALLY  489
            C+ICQALL+
Sbjct  62   CVICQALLF  70



>ref|XP_010504239.1| PREDICTED: uncharacterized protein LOC104781301 [Camelina sativa]
Length=417

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 74/136 (54%), Gaps = 21/136 (15%)
 Frame = +1

Query  106  TPVCPFVKAARPDDAS-VKKPGES-------QSKQHGGSEKPKQESGEPAMVPSKCPFVH  261
            T VCPF KAARPDDAS  +K GE+        SK     +   ++ GE A   S CPF  
Sbjct  3    TSVCPFSKAARPDDASSTRKQGETAASGCPFSSKAARPDDASARKQGETA--ASGCPF--  58

Query  262  KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQT  441
             + A S+    ++ GE A  S  CP    +E G  NK    S     +  KCP G+DSQT
Sbjct  59   SKSARSDDASARKKGEIA--SKGCP----EEEGKLNKD---STDSATVPAKCPFGYDSQT  109

Query  442  FKLGPLSCMICQALLY  489
            FKLGP SCM+CQALLY
Sbjct  110  FKLGPFSCMLCQALLY  125



>ref|XP_004147090.1| PREDICTED: uncharacterized protein LOC101210945 [Cucumis sativus]
 ref|XP_004161939.1| PREDICTED: uncharacterized LOC101210945 [Cucumis sativus]
 gb|KGN51585.1| hypothetical protein Csa_5G581690 [Cucumis sativus]
Length=404

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 68/139 (49%), Gaps = 36/139 (26%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKP-GESQ-------SKQHGGSEKPKQESGEPAMVPSKCPFV  258
            MTPVCPFVK+ARPDDAS +K  GES              S KP+ ES         CP  
Sbjct  1    MTPVCPFVKSARPDDASSRKHQGESACPFAKSGRSDDASSRKPQSESA--------CPVS  52

Query  259  H--KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFD  432
               +    S +K NQ                  EA      K V++  G    KCP G+D
Sbjct  53   KSVRSDDASSLKKNQ-----------------AEAESNGAEKDVADAAGA-GGKCPFGYD  94

Query  433  SQTFKLGPLSCMICQALLY  489
            SQTFK+GPLSCMICQALL+
Sbjct  95   SQTFKIGPLSCMICQALLF  113



>gb|KCW65832.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
Length=301

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 67/129 (52%), Gaps = 49/129 (38%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            M PVCPFVKA+RP+DA    P  S  K                         H+++AG++
Sbjct  1    MKPVCPFVKASRPEDA----PPPSSRK-------------------------HQKEAGAD  31

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
                      A VS KCPFGY       + P       G +SPKCPLG+DSQTFKLGPLS
Sbjct  32   ---------PASVSPKCPFGY-------DAPPD----SGAISPKCPLGYDSQTFKLGPLS  71

Query  463  CMICQALLY  489
            CMICQALL+
Sbjct  72   CMICQALLF  80



>ref|XP_010067651.1| PREDICTED: uncharacterized protein LOC104454492 [Eucalyptus grandis]
 ref|XP_010067652.1| PREDICTED: uncharacterized protein LOC104454492 [Eucalyptus grandis]
 gb|KCW65829.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
 gb|KCW65830.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
Length=366

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 67/129 (52%), Gaps = 49/129 (38%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            M PVCPFVKA+RP+DA    P  S  K                         H+++AG++
Sbjct  1    MKPVCPFVKASRPEDA----PPPSSRK-------------------------HQKEAGAD  31

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
                      A VS KCPFGY       + P       G +SPKCPLG+DSQTFKLGPLS
Sbjct  32   ---------PASVSPKCPFGY-------DAPPD----SGAISPKCPLGYDSQTFKLGPLS  71

Query  463  CMICQALLY  489
            CMICQALL+
Sbjct  72   CMICQALLF  80



>gb|KCW65831.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
Length=396

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 67/129 (52%), Gaps = 49/129 (38%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            M PVCPFVKA+RP+DA    P  S  K                         H+++AG++
Sbjct  1    MKPVCPFVKASRPEDA----PPPSSRK-------------------------HQKEAGAD  31

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
                      A VS KCPFGY       + P       G +SPKCPLG+DSQTFKLGPLS
Sbjct  32   ---------PASVSPKCPFGY-------DAPPD----SGAISPKCPLGYDSQTFKLGPLS  71

Query  463  CMICQALLY  489
            CMICQALL+
Sbjct  72   CMICQALLF  80



>ref|XP_002877973.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54232.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=415

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 72/136 (53%), Gaps = 23/136 (17%)
 Frame = +1

Query  106  TPVCPFVKAARPDDASVKKPGESQ------SKQHGGSEKPKQESGEPAMVPSKCPFVHKQ  267
            T VCPF KAARPDDAS +K G++       SK     +   ++ GE  +  S CPF    
Sbjct  3    TSVCPFSKAARPDDASTRKQGDTAASGCPFSKAARPDDASARKQGE--ITASGCPF----  56

Query  268  QAGSEIKPNQESGE-QAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQT  441
                  +P+  S   Q +++S  CP    +  G  NK    S     +  KCP G+DSQT
Sbjct  57   --SKAARPDDASARKQDEIASNGCP----EHEGKLNKD---STDSATVPAKCPFGYDSQT  107

Query  442  FKLGPLSCMICQALLY  489
            FKLGP SCM+CQALLY
Sbjct  108  FKLGPFSCMLCQALLY  123



>gb|EYU39947.1| hypothetical protein MIMGU_mgv1a009191mg [Erythranthe guttata]
Length=350

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 59/129 (46%), Gaps = 59/129 (46%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MTPVCPF KA+RPDDAS K+PGE+Q+KQ   ++   Q+ G                    
Sbjct  1    MTPVCPFTKASRPDDASCKRPGENQNKQQTVNDSKSQQEG--------------------  40

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
                        +S KCPFGY                            DSQTFKLGPLS
Sbjct  41   -----------AISPKCPFGY----------------------------DSQTFKLGPLS  61

Query  463  CMICQALLY  489
            CMICQALL+
Sbjct  62   CMICQALLF  70



>ref|XP_011034631.1| PREDICTED: uncharacterized protein LOC105132695 [Populus euphratica]
 ref|XP_011034632.1| PREDICTED: uncharacterized protein LOC105132695 [Populus euphratica]
 ref|XP_011034633.1| PREDICTED: uncharacterized protein LOC105132695 [Populus euphratica]
Length=363

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 59/129 (46%), Gaps = 52/129 (40%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MTPVCPFVKA+RPDD S +KPGE                         CP  H  +    
Sbjct  1    MTPVCPFVKASRPDDGSSRKPGE-------------------------CPEKHAAE----  31

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
                                   E GG+ K + V     V SPKCP G+DSQTFKLGP S
Sbjct  32   ----------------------HEGGGKAKEESVGASATV-SPKCPFGYDSQTFKLGPHS  68

Query  463  CMICQALLY  489
            CMICQALL+
Sbjct  69   CMICQALLF  77



>ref|XP_010427133.1| PREDICTED: uncharacterized protein LOC104712035 [Camelina sativa]
Length=417

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 73/138 (53%), Gaps = 25/138 (18%)
 Frame = +1

Query  106  TPVCPFVKAARPDDAS-VKKPGES-------QSKQHGGSEKPKQESGEPAMVPSKCPFVH  261
            T VCPF KAARPDDAS  +K G+         SK     +   ++ GE A   S CPF  
Sbjct  3    TSVCPFSKAARPDDASSTRKQGDMTASGCPFSSKAARPDDASARKQGETA--ASGCPF--  58

Query  262  KQQAGSEIKPNQESGE-QAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDS  435
                    +P+  S   Q +++SK CP    +E G  NK    S     +  KCP G+DS
Sbjct  59   ----SKSARPDDASARKQGEIASKGCP----EEEGKLNKD---STDSATVPAKCPFGYDS  107

Query  436  QTFKLGPLSCMICQALLY  489
            QTFKLGP SCM+CQALLY
Sbjct  108  QTFKLGPFSCMLCQALLY  125



>ref|XP_009116123.1| PREDICTED: uncharacterized protein LOC103841350 [Brassica rapa]
Length=409

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 68/132 (52%), Gaps = 19/132 (14%)
 Frame = +1

Query  106  TPVCPFVKAARPDDASVKKPGESQSKQ---HGGSEKPKQESGEPAMVPSKCPFVHKQQAG  276
            T VCPF KAARPDDAS  +     +        ++   ++ GE     S CPF       
Sbjct  3    TSVCPFSKAARPDDASASRKQADTTPSVCPFSKADASARKQGET--TASGCPFS------  54

Query  277  SEIKPNQESGEQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLG  453
               K +  + +Q +V+SK CP       G  NK +  +     +  KCP G+DSQTFKLG
Sbjct  55   ---KSDASARKQGEVASKGCPVN----EGRVNKEEDSTTDSATVPAKCPFGYDSQTFKLG  107

Query  454  PLSCMICQALLY  489
            P SCM+CQALLY
Sbjct  108  PFSCMLCQALLY  119



>emb|CDX78232.1| BnaA09g34270D [Brassica napus]
Length=409

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 69/132 (52%), Gaps = 19/132 (14%)
 Frame = +1

Query  106  TPVCPFVKAARPDDASVKKPGESQSKQ---HGGSEKPKQESGEPAMVPSKCPFVHKQQAG  276
            T VCPF KAARPDDAS  +     +        ++   ++ GE     S CPF       
Sbjct  3    TSVCPFSKAARPDDASAARKQADTTPSACPFSKADASARKQGET--TASACPFS------  54

Query  277  SEIKPNQESGEQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLG  453
               K +  + +Q +V+SK CP    +  G  NK +  +     +  KCP G+DSQTFKLG
Sbjct  55   ---KSDASARKQGEVASKGCP----ENEGRVNKEEDSTPDSATVPAKCPFGYDSQTFKLG  107

Query  454  PLSCMICQALLY  489
            P SCM+CQALLY
Sbjct  108  PFSCMLCQALLY  119



>emb|CDX73486.1| BnaC08g25170D [Brassica napus]
Length=409

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 70/131 (53%), Gaps = 18/131 (14%)
 Frame = +1

Query  106  TPVCPFVKAARPDDASVKKPGESQSKQ--HGGSEKPKQESGEPAMVPSKCPFVHKQQAGS  279
            T VCPF KAARPDDAS +K  ++         ++   ++ GE     S CPF        
Sbjct  3    TSVCPFSKAARPDDASARKQADTTPSACPFSKADAFARKQGET--TASACPFS-------  53

Query  280  EIKPNQESGEQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  456
              K +  + +Q +V+SK CP    +  G   K +  +     +  KCP G+DSQTFKLGP
Sbjct  54   --KSDASARKQGEVASKGCP----ENEGIVQKEEDSTTDSATVPAKCPFGYDSQTFKLGP  107

Query  457  LSCMICQALLY  489
             SCM+CQALL+
Sbjct  108  FSCMLCQALLF  118



>ref|XP_006403583.1| hypothetical protein EUTSA_v10010421mg [Eutrema salsugineum]
 gb|ESQ45036.1| hypothetical protein EUTSA_v10010421mg [Eutrema salsugineum]
Length=408

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 66/139 (47%), Gaps = 37/139 (27%)
 Frame = +1

Query  106  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  285
            T VCPF KAARPDDAS +K GE                    +  S CPF          
Sbjct  3    TSVCPFSKAARPDDASARKQGE--------------------VTASGCPF------SKAA  36

Query  286  KPNQESGE-QAKVS-SKCPFGYT------QEAGGENKPK---QVSEKPGVMSPKCPLGFD  432
            +P+  S   Q +V+ S CPF          E   +  PK   + S     +  KCP G+D
Sbjct  37   RPDDASARKQGEVTASGCPFSKAARPNEGDEMASKESPKLESRDSTASATVPAKCPFGYD  96

Query  433  SQTFKLGPLSCMICQALLY  489
            SQTFKLGP SCM+CQALLY
Sbjct  97   SQTFKLGPFSCMLCQALLY  115



>ref|NP_191004.1| zinc ion binding protein [Arabidopsis thaliana]
 gb|AAK95259.1|AF410273_1 AT3g54360/T12E18_50 [Arabidopsis thaliana]
 emb|CAB81801.1| RING finger-like protein [Arabidopsis thaliana]
 gb|AAM63273.1| RING finger-like protein [Arabidopsis thaliana]
 gb|AAN18187.1| At3g54360/T12E18_50 [Arabidopsis thaliana]
 gb|AEE79220.1| zinc ion binding protein [Arabidopsis thaliana]
Length=405

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 66/142 (46%), Gaps = 37/142 (26%)
 Frame = +1

Query  97   IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  276
            +  T VCPF KAARPDD S +K GE                    +  S CPF       
Sbjct  1    MTTTSVCPFSKAARPDDGSTRKQGE--------------------ITASGCPF------S  34

Query  277  SEIKPNQESGEQ--AKVSSKCPFGYT---QEAGGENKPKQ------VSEKPGVMSPKCPL  423
               +P+  S  +     +S CPF  +    E G +  P+Q       S     +  KCP 
Sbjct  35   KAARPDDASARKQGETTASGCPFSKSARPDENGSKGCPEQEGNLNKDSTDSATVPAKCPF  94

Query  424  GFDSQTFKLGPLSCMICQALLY  489
            G+DSQTFKLGP SCM+CQALLY
Sbjct  95   GYDSQTFKLGPFSCMLCQALLY  116



>emb|CDX67597.1| BnaA07g16370D [Brassica napus]
Length=401

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 63/134 (47%), Gaps = 31/134 (23%)
 Frame = +1

Query  106  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  285
            T VCPF KAARPD+AS                 PKQ        PS CPF          
Sbjct  3    TSVCPFSKAARPDNAS---------------SAPKQAD----TTPSACPF------SKST  37

Query  286  KPNQESGEQAKVSSKCPFGYTQEAGG------ENKPKQVSEKPGVMSPKCPLGFDSQTFK  447
            +P+     +   S+ CPF  + +A        E + +   E    +  KCP G+DSQTFK
Sbjct  38   RPDDTKQGETTASAACPFSKSADASAPSKGCPEKEGRLSKEDSATVPAKCPFGYDSQTFK  97

Query  448  LGPLSCMICQALLY  489
            LGP SCM+CQ+LL+
Sbjct  98   LGPFSCMLCQSLLF  111



>ref|XP_010515962.1| PREDICTED: uncharacterized protein LOC104791708 [Camelina sativa]
Length=408

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 68/140 (49%), Gaps = 38/140 (27%)
 Frame = +1

Query  106  TPVCPFVKAARPDDAS-VKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            T VCPF KAARPDDAS  +K G+                    M  S CPF  K  A  +
Sbjct  3    TSVCPFSKAARPDDASSTRKQGD--------------------MTASGCPFSSKA-ARPD  41

Query  283  IKPNQESGEQAKVSSKCPF-----------GYTQEAGGENKPKQVSEKPGVMSPKCPLGF  429
                ++ GE A  +S CPF           G  +E G  NK    S     +  KCP G+
Sbjct  42   DASARKQGETA--ASGCPFSKSARPDDGSKGCPEEEGKLNKD---STDSATVPAKCPFGY  96

Query  430  DSQTFKLGPLSCMICQALLY  489
            DSQTFKLGP SCM+CQALLY
Sbjct  97   DSQTFKLGPFSCMLCQALLY  116



>ref|XP_010921286.1| PREDICTED: uncharacterized protein LOC105044901 [Elaeis guineensis]
Length=395

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 64/138 (46%), Gaps = 41/138 (30%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVH----KQQ  270
            M+ VCPF KAA  D               GG                 CP  H    +QQ
Sbjct  1    MSSVCPFAKAACAD---------------GG-----------------CPVKHEKQSRQQ  28

Query  271  AGSEIKPNQESGEQAKVSSKCPFGY-----TQEAGGENKPKQVSEKPGVMSPKCPLGFDS  435
            A  + K + +S + A V   CP  +       +A  ++K    S    V+SPKCP G+DS
Sbjct  29   AECDDKVDTKSNDSASVDGGCPMKHEGNYNRHKAECDDKVDTKSNDSAVVSPKCPFGYDS  88

Query  436  QTFKLGPLSCMICQALLY  489
             TFKLGPLSCMICQALLY
Sbjct  89   HTFKLGPLSCMICQALLY  106



>ref|XP_010938114.1| PREDICTED: uncharacterized protein LOC105057260 isoform X1 [Elaeis 
guineensis]
Length=405

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 64/142 (45%), Gaps = 42/142 (30%)
 Frame = +1

Query  94   LIKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVH----  261
            L  M+ +CPF KAA  D               GG                 CP  H    
Sbjct  7    LSNMSSICPFAKAASAD---------------GG-----------------CPMKHEENH  34

Query  262  -KQQAGSEIKPNQESGEQAKVSSKCPFGYT-----QEAGGENKPKQVSEKPGVMSPKCPL  423
             +QQA  +   +++S   A +   CP  Y       +A  ++K    +    V+SPKCP 
Sbjct  35   SQQQAKCDDNVDRKSHGSASIDGGCPVKYEGDHNKHQAECDDKADTKTNDSAVVSPKCPF  94

Query  424  GFDSQTFKLGPLSCMICQALLY  489
            G+DS TFKLGPLSCMICQALLY
Sbjct  95   GYDSHTFKLGPLSCMICQALLY  116



>ref|XP_009103916.1| PREDICTED: uncharacterized protein LOC103829975 [Brassica rapa]
Length=401

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 65/134 (49%), Gaps = 31/134 (23%)
 Frame = +1

Query  106  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  285
            T VCPF KAARPD+AS                 PKQ        PS CPF    ++    
Sbjct  3    TSVCPFSKAARPDNAS---------------SAPKQAD----TTPSACPFSKAARSD---  40

Query  286  KPNQESGEQAKVSSKCPFGYTQEAGG------ENKPKQVSEKPGVMSPKCPLGFDSQTFK  447
              + + GE    S+ CPF  + +A        E + +   E    +  KCP G+DSQTFK
Sbjct  41   --DAKQGETT-ASAACPFSKSADASAPSKGCPEKEGRLSKEDSATVPAKCPFGYDSQTFK  97

Query  448  LGPLSCMICQALLY  489
            LGP SCM+CQ+LL+
Sbjct  98   LGPFSCMLCQSLLF  111



>ref|XP_002297702.1| hypothetical protein POPTR_0001s07350g [Populus trichocarpa]
 gb|EEE82507.1| hypothetical protein POPTR_0001s07350g [Populus trichocarpa]
Length=363

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 57/129 (44%), Gaps = 52/129 (40%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MT VCP VKA+RPDD S +KPGE                         CP  H  +    
Sbjct  1    MTTVCPLVKASRPDDGSSRKPGE-------------------------CPEKHAAE----  31

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
                                   E GG+ K + V     V SPKCP G+DSQTFKLGP S
Sbjct  32   ----------------------HEGGGKAKKESVGASATV-SPKCPFGYDSQTFKLGPHS  68

Query  463  CMICQALLY  489
            CMICQALL+
Sbjct  69   CMICQALLF  77



>ref|XP_010938116.1| PREDICTED: uncharacterized protein LOC105057260 isoform X2 [Elaeis 
guineensis]
Length=396

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 63/139 (45%), Gaps = 42/139 (30%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVH-----KQ  267
            M+ +CPF KAA  D               GG                 CP  H     +Q
Sbjct  1    MSSICPFAKAASAD---------------GG-----------------CPMKHEENHSQQ  28

Query  268  QAGSEIKPNQESGEQAKVSSKCPFGYT-----QEAGGENKPKQVSEKPGVMSPKCPLGFD  432
            QA  +   +++S   A +   CP  Y       +A  ++K    +    V+SPKCP G+D
Sbjct  29   QAKCDDNVDRKSHGSASIDGGCPVKYEGDHNKHQAECDDKADTKTNDSAVVSPKCPFGYD  88

Query  433  SQTFKLGPLSCMICQALLY  489
            S TFKLGPLSCMICQALLY
Sbjct  89   SHTFKLGPLSCMICQALLY  107



>gb|ACU19631.1| unknown [Glycine max]
Length=188

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 60/131 (46%), Gaps = 54/131 (41%)
 Frame = +1

Query  97   IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  276
            + MTPVCPFVKAARPDD +  K                 +SGE +M         K QA 
Sbjct  1    MNMTPVCPFVKAARPDDNNASK-----------------KSGENSM---------KHQAE  34

Query  277  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  456
            SE K  +E  + A  S                            PKCP G+DSQ+FK+GP
Sbjct  35   SESKVKKEVNDSASTS----------------------------PKCPFGYDSQSFKIGP  66

Query  457  LSCMICQALLY  489
            LSC +CQALL+
Sbjct  67   LSCTVCQALLF  77



>ref|XP_003522869.1| PREDICTED: uncharacterized protein LOC100813258 isoform X1 [Glycine 
max]
 ref|XP_006578395.1| PREDICTED: uncharacterized protein LOC100813258 isoform X2 [Glycine 
max]
Length=367

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 60/131 (46%), Gaps = 54/131 (41%)
 Frame = +1

Query  97   IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  276
            + MTPVCPFVKAARPDD +  K                 +SGE +M         K QA 
Sbjct  1    MNMTPVCPFVKAARPDDNNASK-----------------KSGENSM---------KHQAE  34

Query  277  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  456
            SE K  +E  + A  S                            PKCP G+DSQ+FK+GP
Sbjct  35   SESKVKKEVNDSASTS----------------------------PKCPFGYDSQSFKIGP  66

Query  457  LSCMICQALLY  489
            LSC +CQALL+
Sbjct  67   LSCTVCQALLF  77



>ref|XP_004516522.1| PREDICTED: uncharacterized protein LOC101498396 [Cicer arietinum]
Length=365

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 61/130 (47%), Gaps = 56/130 (43%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASV-KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGS  279
            MTPVCPFVK  RPDD +  KK GE+ +K                         H  +  S
Sbjct  1    MTPVCPFVKIPRPDDNNASKKSGENSNK-------------------------HHAEHES  35

Query  280  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  459
            ++K                             K+V++   V SPKCPLG+DSQTFK+GPL
Sbjct  36   KVK-----------------------------KEVNDSASV-SPKCPLGYDSQTFKIGPL  65

Query  460  SCMICQALLY  489
            SCM+CQALLY
Sbjct  66   SCMVCQALLY  75



>ref|XP_010689828.1| PREDICTED: uncharacterized protein LOC104903488 [Beta vulgaris 
subsp. vulgaris]
Length=363

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 59/130 (45%), Gaps = 57/130 (44%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE-KPKQESGEPAMVPSKCPFVHKQQAGS  279
            MTPVCPFVK ARPDDAS K+ GE+Q+K     E K K ES + AM               
Sbjct  1    MTPVCPFVKVARPDDASSKRNGENQNKHAAEHESKSKNESVDSAM---------------  45

Query  280  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  459
             I+P            KCP GY                            DS +FK+GPL
Sbjct  46   -IEP------------KCPLGY----------------------------DSHSFKIGPL  64

Query  460  SCMICQALLY  489
            SC++CQALL+
Sbjct  65   SCVLCQALLF  74



>ref|XP_007148770.1| hypothetical protein PHAVU_005G012800g [Phaseolus vulgaris]
 gb|ESW20764.1| hypothetical protein PHAVU_005G012800g [Phaseolus vulgaris]
Length=367

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 59/131 (45%), Gaps = 54/131 (41%)
 Frame = +1

Query  97   IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  276
            + MTPVCPFVKAARPDD +  K                 + GE +M         K Q  
Sbjct  1    MNMTPVCPFVKAARPDDNNASK-----------------KLGENSM---------KHQVD  34

Query  277  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  456
            SE K  +E+ + A  S                            PKCP G+DSQ+FK+GP
Sbjct  35   SESKVKKEANDSASAS----------------------------PKCPFGYDSQSFKIGP  66

Query  457  LSCMICQALLY  489
            LSC +CQALL+
Sbjct  67   LSCTVCQALLF  77



>ref|XP_007010628.1| Zinc ion binding [Theobroma cacao]
 gb|EOY19438.1| Zinc ion binding [Theobroma cacao]
Length=366

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 55/128 (43%), Gaps = 61/128 (48%)
 Frame = +1

Query  106  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  285
            TPVCPFVKAARPDDA     G ++    GGSE  +++SG+ A V                
Sbjct  3    TPVCPFVKAARPDDA-----GSAKKAATGGSEAARKDSGDTATV----------------  41

Query  286  KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC  465
                        S KCPFGY                            DS  FKLGPLSC
Sbjct  42   ------------SPKCPFGY----------------------------DSNNFKLGPLSC  61

Query  466  MICQALLY  489
            MICQALL+
Sbjct  62   MICQALLF  69



>gb|ACU21424.1| unknown [Glycine max]
Length=189

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 58/131 (44%), Gaps = 54/131 (41%)
 Frame = +1

Query  97   IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  276
            + MTPVCPFVKA+RPDD +  K                 +SGE +M         K Q  
Sbjct  1    MNMTPVCPFVKASRPDDNNASK-----------------KSGENSM---------KHQVE  34

Query  277  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  456
            SE K  +E  + A  S                            PKCP G+DS +FK+GP
Sbjct  35   SESKGKKEVNDSASTS----------------------------PKCPFGYDSHSFKIGP  66

Query  457  LSCMICQALLY  489
            LSC +CQALL+
Sbjct  67   LSCTVCQALLF  77



>ref|XP_008793368.1| PREDICTED: uncharacterized protein LOC103709685 [Phoenix dactylifera]
Length=378

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 5/81 (6%)
 Frame = +1

Query  262  KQQAGSEIKPNQESGEQAKVSSKCPFGYT-----QEAGGENKPKQVSEKPGVMSPKCPLG  426
            +QQA  +   + +S   A +   CP  +       +A  ++K    S    V+SPKCP G
Sbjct  9    QQQAKCDDNVDTKSSGSASIDVGCPMKHEGDYNKHQADCDDKADTKSNDSAVVSPKCPFG  68

Query  427  FDSQTFKLGPLSCMICQALLY  489
            +DS TFKLGPLSCMICQALLY
Sbjct  69   YDSHTFKLGPLSCMICQALLY  89



>ref|XP_010533372.1| PREDICTED: uncharacterized protein LOC104809184 [Tarenaya hassleriana]
 ref|XP_010533373.1| PREDICTED: uncharacterized protein LOC104809184 [Tarenaya hassleriana]
Length=364

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 57/131 (44%), Gaps = 59/131 (45%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MTPVCPF K+ARP+D+                                CP   ++ A   
Sbjct  1    MTPVCPFAKSARPEDS--------------------------------CPRKQRETAN--  26

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGEN--KPKQVSEKPGVMSPKCPLGFDSQTFKLGP  456
                                   +AG EN  K K+ S +   +SPKCP G+DSQTFK+GP
Sbjct  27   -----------------------KAGSENECKAKKDSTESATVSPKCPFGYDSQTFKIGP  63

Query  457  LSCMICQALLY  489
             SCMICQALLY
Sbjct  64   FSCMICQALLY  74



>ref|XP_010276468.1| PREDICTED: uncharacterized protein LOC104611195 [Nelumbo nucifera]
 ref|XP_010276469.1| PREDICTED: uncharacterized protein LOC104611195 [Nelumbo nucifera]
 ref|XP_010276470.1| PREDICTED: uncharacterized protein LOC104611195 [Nelumbo nucifera]
Length=362

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 56/129 (43%), Gaps = 55/129 (43%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MT VCPF K+ARPDDAS +K  ++ S+                                 
Sbjct  1    MTSVCPFAKSARPDDASPRKSMDNHSRDQA------------------------------  30

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
                                   E GG  K ++ S+    +SPKCP G+DS TFKLGPLS
Sbjct  31   -----------------------EPGG--KVRRESDDSASVSPKCPFGYDSHTFKLGPLS  65

Query  463  CMICQALLY  489
            C+ICQALLY
Sbjct  66   CVICQALLY  74



>ref|XP_003527531.1| PREDICTED: uncharacterized protein LOC100813844 [Glycine max]
Length=367

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 58/131 (44%), Gaps = 54/131 (41%)
 Frame = +1

Query  97   IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  276
            + MTPVCPFVKA+RPDD +  K                 +SGE +M         K Q  
Sbjct  1    MNMTPVCPFVKASRPDDNNASK-----------------KSGENSM---------KHQVE  34

Query  277  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  456
            SE K  +E  + A  S                            PKCP G+DS +FK+GP
Sbjct  35   SESKGKKEVNDSASTS----------------------------PKCPFGYDSHSFKIGP  66

Query  457  LSCMICQALLY  489
            LSC +CQALL+
Sbjct  67   LSCTVCQALLF  77



>gb|KEH32916.1| zinc ion-binding protein, putative [Medicago truncatula]
Length=379

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 58/138 (42%), Gaps = 54/138 (39%)
 Frame = +1

Query  76   CRSHGLLIKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPF  255
            CR       M PVCPFVK  RPDD++  K     S +                       
Sbjct  5    CRFLLWRFNMKPVCPFVKIPRPDDSNASKKSNENSNK-----------------------  41

Query  256  VHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDS  435
             H  +  S++K                             K+V +   V SPKCPLG+DS
Sbjct  42   -HHVEHDSKVK-----------------------------KEVKDSASV-SPKCPLGYDS  70

Query  436  QTFKLGPLSCMICQALLY  489
            QTFK+GPLSCM+CQALL+
Sbjct  71   QTFKIGPLSCMVCQALLF  88



>gb|KHN26422.1| Polycomb complex protein BMI-1 [Glycine soja]
Length=365

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 57/129 (44%), Gaps = 54/129 (42%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MTPVCPFVKA+RPDD +  K                 +SGE +M         K Q  SE
Sbjct  1    MTPVCPFVKASRPDDNNASK-----------------KSGENSM---------KHQVESE  34

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
             K  +E  + A  S                            PKCP G+DS +FK+GPLS
Sbjct  35   SKGKKEVNDSASTS----------------------------PKCPFGYDSHSFKIGPLS  66

Query  463  CMICQALLY  489
            C +CQALL+
Sbjct  67   CTVCQALLF  75



>gb|KJB67761.1| hypothetical protein B456_010G208800 [Gossypium raimondii]
Length=365

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 54/128 (42%), Gaps = 61/128 (48%)
 Frame = +1

Query  106  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  285
            TPVCPFVKAARPDD      G ++    GGSE  +++SG+ A V                
Sbjct  3    TPVCPFVKAARPDD-----NGSAKKSTVGGSEATRKDSGDTATV----------------  41

Query  286  KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC  465
                        S KCPFGY                            DS  FKLGPLSC
Sbjct  42   ------------SPKCPFGY----------------------------DSNNFKLGPLSC  61

Query  466  MICQALLY  489
            MICQALL+
Sbjct  62   MICQALLF  69



>gb|KHF99857.1| E3 ubiquitin-protein ligase CHFR [Gossypium arboreum]
Length=365

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 54/128 (42%), Gaps = 61/128 (48%)
 Frame = +1

Query  106  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  285
            TPVCPFVKAARPDD      G ++    GGSE  +++SG+ A V                
Sbjct  3    TPVCPFVKAARPDD-----NGSAKKSTVGGSEATRKDSGDSATV----------------  41

Query  286  KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC  465
                        S KCPFGY                            DS  FKLGPLSC
Sbjct  42   ------------SPKCPFGY----------------------------DSNNFKLGPLSC  61

Query  466  MICQALLY  489
            MICQALL+
Sbjct  62   MICQALLF  69



>gb|KEH32917.1| zinc ion-binding protein, putative [Medicago truncatula]
Length=366

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 56/129 (43%), Gaps = 54/129 (42%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            M PVCPFVK  RPDD++  K     S +                        H  +  S+
Sbjct  1    MKPVCPFVKIPRPDDSNASKKSNENSNK------------------------HHVEHDSK  36

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
            +K                             K+V +   V SPKCPLG+DSQTFK+GPLS
Sbjct  37   VK-----------------------------KEVKDSASV-SPKCPLGYDSQTFKIGPLS  66

Query  463  CMICQALLY  489
            CM+CQALL+
Sbjct  67   CMVCQALLF  75



>ref|XP_009420238.1| PREDICTED: uncharacterized protein LOC104000028 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420239.1| PREDICTED: uncharacterized protein LOC104000028 [Musa acuminata 
subsp. malaccensis]
Length=365

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 39/63 (62%), Gaps = 4/63 (6%)
 Frame = +1

Query  313  AKVSSKCPFGYT----QEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQA  480
            A V   CP        Q+A  ENK  + S     +SPKCP GFDS TFKLGPLSCMICQ+
Sbjct  11   ASVGGACPMKSVNNEKQQAENENKGDEESNPSDTVSPKCPYGFDSHTFKLGPLSCMICQS  70

Query  481  LLY  489
            LLY
Sbjct  71   LLY  73



>ref|XP_010091318.1| E3 ubiquitin-protein ligase CHFR [Morus notabilis]
 gb|EXB44292.1| E3 ubiquitin-protein ligase CHFR [Morus notabilis]
Length=438

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 56/130 (43%), Gaps = 57/130 (44%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPF-VHKQQAGS  279
            MTPVCPFVKA+RPD+AS                            P KCPF    Q   S
Sbjct  1    MTPVCPFVKASRPDEAS----------------------------PKKCPFGFDSQTTTS  32

Query  280  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  459
              K  Q+  + + V +KCPFGY                            DSQTFKLGPL
Sbjct  33   NNKQQQQQQQSSVVEAKCPFGY----------------------------DSQTFKLGPL  64

Query  460  SCMICQALLY  489
            SC+ICQAL +
Sbjct  65   SCVICQALTF  74



>emb|CDM81302.1| unnamed protein product [Triticum aestivum]
Length=373

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 52/91 (57%), Gaps = 6/91 (7%)
 Frame = +1

Query  235  VPSKCPFVHKQQAG-----SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKP-KQVSEKP  396
            + S CPF      G     S+ KP++  G    V+ K      +E+G +    ++ +E P
Sbjct  1    MSSLCPFAKATTGGVCPMKSDKKPDKSGGAACPVTGKSHGSENKESGADRATGEEGAEDP  60

Query  397  GVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
             V+  KCP G+DS TFKLGPLSCM+CQALL+
Sbjct  61   RVVPAKCPFGYDSNTFKLGPLSCMVCQALLH  91



>ref|XP_007218231.1| hypothetical protein PRUPE_ppa007956mg [Prunus persica]
 gb|EMJ19430.1| hypothetical protein PRUPE_ppa007956mg [Prunus persica]
Length=350

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  376  KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
            K+ S     +SPKCPLG+DSQTFKLGPLSCMIC ALL+
Sbjct  19   KESSADTATISPKCPLGYDSQTFKLGPLSCMICHALLF  56



>gb|EMT10100.1| E3 ubiquitin-protein ligase CHFR [Aegilops tauschii]
Length=540

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 78/170 (46%), Gaps = 38/170 (22%)
 Frame = +1

Query  61   STEIQCRSHGLLIKMTPVCPFVK-----AARPDDASVKKPGESQSKQHG-GSEKPK---Q  213
            +TE     +G L  +  VC         +A   D++V     S +  HG G+   K   Q
Sbjct  73   NTEGGISMYGNLTIVLSVCQLTNWWVDTSANIHDSTVLMENGSPASVHGIGTTNLKFILQ  132

Query  214  E---SGEPAMVPSKCPFVHKQQAG-----SEIKPNQESGEQAKVSSKCPFGYTQEAGGEN  369
            E   + E   + S CPF      G     S+ KP++ SG    V+ K         GGE 
Sbjct  133  EGTINKESIAMSSLCPFAKATTGGVCPMKSDKKPDKSSGAACPVTGK---------GGE-  182

Query  370  KPKQVS----------EKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
             PK+ S          E P ++  KCP G+DS TFKLGPLSCM+CQALL+
Sbjct  183  -PKETSADHAAGEESAEDPRLVPAKCPFGYDSNTFKLGPLSCMVCQALLH  231



>ref|XP_008231724.1| PREDICTED: uncharacterized protein LOC103330891 [Prunus mume]
Length=350

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  376  KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
            K+ S     +SPKCPLG+DSQTFKLGPLSCMIC ALL+
Sbjct  19   KESSADTATISPKCPLGYDSQTFKLGPLSCMICHALLF  56



>ref|XP_006643640.1| PREDICTED: uncharacterized protein LOC102704921 [Oryza brachyantha]
Length=361

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 7/85 (8%)
 Frame = +1

Query  235  VPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPK  414
            + S CPF     AG+  K   +S +    ++ CP          +K     + P ++ PK
Sbjct  1    MSSLCPFAKLASAGA--KCPVKSDKNNSTTASCPAN-----SHHHKEDDAQQNPSMVPPK  53

Query  415  CPLGFDSQTFKLGPLSCMICQALLY  489
            CP G+DS TFKLGPLSCM+C ALLY
Sbjct  54   CPFGYDSNTFKLGPLSCMVCHALLY  78



>ref|XP_008375385.1| PREDICTED: uncharacterized protein LOC103438629 [Malus domestica]
Length=364

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 39/55 (71%), Gaps = 5/55 (9%)
 Frame = +1

Query  331  CPFGYTQEAGGENKP--KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
            CPF    +AG  ++P  K+ S     + PKCPLG+DSQTFKLGPLSCMIC AL++
Sbjct  6    CPFA---KAGRPSEPSKKETSADTATIPPKCPLGYDSQTFKLGPLSCMICHALMF  57



>ref|XP_003559441.1| PREDICTED: uncharacterized protein LOC100832811 [Brachypodium 
distachyon]
Length=380

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 49/96 (51%), Gaps = 11/96 (11%)
 Frame = +1

Query  235  VPSKCPFVHKQQAGSEI---KPNQES---GEQAKVSSKCPF-----GYTQEAGGENKPKQ  381
            + S CPF      G  +   K N+ S     +   SS CP      G   E  G +   +
Sbjct  1    MSSLCPFAKATTGGGGVCPMKSNKNSTVKSNKNDSSSVCPVTGKNNGEEHEESGTDHAGE  60

Query  382  VSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
             S  P V+  KCP G+DS TFKLGPLSCM+CQALL+
Sbjct  61   ESPDPRVVPAKCPFGYDSNTFKLGPLSCMVCQALLH  96



>gb|EEC69773.1| hypothetical protein OsI_00037 [Oryza sativa Indica Group]
Length=409

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 54/101 (53%), Gaps = 8/101 (8%)
 Frame = +1

Query  190  GGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGEN  369
            G +  P  ++  P M  S CPF     AG+   P + S +     +K    +T +   +N
Sbjct  33   GVNNPPTIDTTNPIM-SSLCPFAKLASAGATC-PVKSSSD-----NKTTINHTDDDDDDN  85

Query  370  -KPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
             K    +  P V+ PKCP G+DS TFKLGPLSCM+C ALL+
Sbjct  86   EKTGNANTDPRVVPPKCPFGYDSNTFKLGPLSCMVCHALLH  126



>ref|XP_010554493.1| PREDICTED: uncharacterized protein LOC104824200 [Tarenaya hassleriana]
 ref|XP_010554494.1| PREDICTED: uncharacterized protein LOC104824200 [Tarenaya hassleriana]
 ref|XP_010554495.1| PREDICTED: uncharacterized protein LOC104824200 [Tarenaya hassleriana]
Length=367

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 53/129 (41%), Gaps = 55/129 (43%)
 Frame = +1

Query  103  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  282
            MT VCPF K+ARPD++                                CP   ++ A   
Sbjct  1    MTSVCPFAKSARPDES--------------------------------CPRKQREAA---  25

Query  283  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  462
                         S  CP         E K K+       +SPKCP G+DSQTFK+GP S
Sbjct  26   -------------SKSCP-------ELEGKAKKDCTDSATVSPKCPFGYDSQTFKIGPFS  65

Query  463  CMICQALLY  489
            C+ICQALLY
Sbjct  66   CVICQALLY  74



>gb|EMS59099.1| E3 ubiquitin-protein ligase CHFR [Triticum urartu]
Length=573

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 52/97 (54%), Gaps = 8/97 (8%)
 Frame = +1

Query  223  EPAMVPSKCPFVHKQQAG-----SEIKPNQESGEQA-KVSSKCPFGYTQEAGGENKPKQ-  381
            E   + S CPF      G     S+ KP++  G  A  V+ K      +E+G +    + 
Sbjct  94   ETIAMSSLCPFAKATTGGVCPMKSDKKPDKSGGGAACPVTGKSHGSENKESGADRAAGEE  153

Query  382  -VSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
               E P V+  KCP G+DS TFKLGPLSCM+CQALL+
Sbjct  154  GAEEDPRVVPAKCPFGYDSNTFKLGPLSCMVCQALLH  190



>ref|XP_006829771.1| hypothetical protein AMTR_s00119p00030390 [Amborella trichopoda]
 gb|ERM97187.1| hypothetical protein AMTR_s00119p00030390 [Amborella trichopoda]
Length=221

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  376  KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
            K+ SE P  +SPKCP G+DS  FKLGPLSC+IC+ALL+
Sbjct  38   KEESEAPNTVSPKCPFGYDSHAFKLGPLSCVICRALLF  75



>ref|NP_001041762.2| Os01g0104100 [Oryza sativa Japonica Group]
 dbj|BAD44834.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG96566.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53706.1| hypothetical protein OsJ_00033 [Oryza sativa Japonica Group]
 dbj|BAF03676.2| Os01g0104100 [Oryza sativa Japonica Group]
Length=363

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 7/86 (8%)
 Frame = +1

Query  235  VPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGEN-KPKQVSEKPGVMSP  411
            + S CPF     AG+   P + S +     +K    +T +   +N K    +  P V+ P
Sbjct  1    MSSLCPFAKLASAGATC-PVKSSSD-----NKTTINHTDDDDDDNEKTGNANTDPRVVPP  54

Query  412  KCPLGFDSQTFKLGPLSCMICQALLY  489
            KCP G+DS TFKLGPLSCM+C ALL+
Sbjct  55   KCPFGYDSNTFKLGPLSCMVCHALLH  80



>ref|XP_004306461.1| PREDICTED: uncharacterized protein LOC101299030 [Fragaria vesca 
subsp. vesca]
Length=338

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  MSPKCPLGFDSQTFKLGPLSCMICQALLY  489
            +SPKCPLG+DSQTFKLGPLSCMIC ALL+
Sbjct  31   VSPKCPLGYDSQTFKLGPLSCMICHALLF  59



>dbj|BAJ86803.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 49/94 (52%), Gaps = 9/94 (10%)
 Frame = +1

Query  235  VPSKCPFVHKQQAG-----SEIKPNQESGEQA-KVSSKCPFGYTQEAGGENKPKQVSE--  390
            + S CPF      G     S+ KP++  G  A  V+ K   G  +E G +          
Sbjct  1    MSSLCPFAKATTGGVCPMKSDKKPDKSGGAAACPVTGKTHGGEDKETGADRAAAGEEGAE  60

Query  391  -KPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
              P ++  KCP G+DS TFKLGPLSCM+CQALL+
Sbjct  61   GDPRLVPAKCPFGYDSNTFKLGPLSCMVCQALLH  94



>ref|XP_003563481.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Brachypodium 
distachyon]
Length=379

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 48/97 (49%), Gaps = 12/97 (12%)
 Frame = +1

Query  235  VPSKCPFVHKQQAGSEIKPNQESGEQAKV-------SSKCPF-----GYTQEAGGENKPK  378
            + S CPF      G  + P +     + V       SS CP      G   +  G +   
Sbjct  1    MSSLCPFAKATTGGGGVCPMKSDKNSSTVKSNKNDSSSVCPVTGKNNGEEHKESGTDHAG  60

Query  379  QVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
            + S  P ++  KCP G+DS TFKLGPLSCM+CQALL+
Sbjct  61   EESPDPRMVPAKCPFGYDSNTFKLGPLSCMVCQALLH  97



>dbj|BAJ90412.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 49/94 (52%), Gaps = 9/94 (10%)
 Frame = +1

Query  235  VPSKCPFVHKQQAG-----SEIKPNQESGEQAK-VSSKCPFGYTQEAGGENKPKQVSE--  390
            + S CPF      G     S+ KP++  G  A  V+ K   G  +E G +          
Sbjct  1    MSSLCPFAKATTGGVCPMKSDKKPDKSGGAAACPVTGKTHGGEDKETGADRAAAGEEGAE  60

Query  391  -KPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
              P ++  KCP G+DS TFKLGPLSCM+CQALL+
Sbjct  61   GDPRLVPAKCPFGYDSNTFKLGPLSCMVCQALLH  94



>gb|KHN45782.1| Polycomb complex protein BMI-1-B [Glycine soja]
Length=339

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  349  QEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
             +A  E+K K+        SPKCP G+DSQ+FK+GPLSC +CQALL+
Sbjct  3    HQAESESKVKKEVNDSASTSPKCPFGYDSQSFKIGPLSCTVCQALLF  49



>gb|KDO48653.1| hypothetical protein CISIN_1g0162582mg, partial [Citrus sinensis]
Length=126

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  409  PKCPLGFDSQTFKLGPLSCMICQALLY  489
            PKCP G+D+Q+FK+GPLSCMICQALL+
Sbjct  8    PKCPFGYDAQSFKIGPLSCMICQALLF  34



>gb|EPS69962.1| hypothetical protein M569_04796, partial [Genlisea aurea]
Length=307

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  KCPLGFDSQTFKLGPLSCMICQALLY  489
            KCP G+DSQTFKLGPLSCMICQALL+
Sbjct  1    KCPFGYDSQTFKLGPLSCMICQALLF  26



>ref|XP_004978719.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Setaria italica]
Length=361

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 42/79 (53%), Gaps = 10/79 (13%)
 Frame = +1

Query  283  IKPNQESG------EQAKVSSKCPFGY----TQEAGGENKPKQVSEKPGVMSPKCPLGFD  432
            +K N+ SG          +S  CP        +E G     +  S  P ++  KCP G+D
Sbjct  1    MKSNRSSGGVCPAKSDKNISGVCPVTGKNHGAEEQGSTGNAEGKSSDPRLVPAKCPFGYD  60

Query  433  SQTFKLGPLSCMICQALLY  489
            S TFKLGPLSCMICQALL+
Sbjct  61   SGTFKLGPLSCMICQALLH  79



>ref|XP_002444897.1| hypothetical protein SORBIDRAFT_07g001060 [Sorghum bicolor]
 gb|EES14392.1| hypothetical protein SORBIDRAFT_07g001060 [Sorghum bicolor]
Length=382

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 3/44 (7%)
 Frame = +1

Query  358  GGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
            GGE K    ++ P ++  KCP G+DS TFKLGPLSC++CQALL+
Sbjct  60   GGEEKG---TDDPRMVPAKCPFGYDSNTFKLGPLSCIVCQALLH  100



>ref|XP_001754304.1| predicted protein [Physcomitrella patens]
 gb|EDQ80754.1| predicted protein [Physcomitrella patens]
Length=372

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 42/80 (53%), Gaps = 16/80 (20%)
 Frame = +1

Query  289  PNQESGEQAKVSSKCPFGY-------------TQEAGGENKPKQVSEKPGVMSPKCPLGF  429
             + E+ +   +S +CPFGY               E G E K +      G    KCPLG+
Sbjct  10   AHAEAKKSDNISGQCPFGYGKSEGSKESHENGVDEQGKERKDENTEASAG---GKCPLGY  66

Query  430  DSQTFKLGPLSCMICQALLY  489
            DS +FK+GP SC++C+ALL+
Sbjct  67   DSVSFKIGPFSCVLCRALLH  86



>ref|XP_002981629.1| hypothetical protein SELMODRAFT_154638 [Selaginella moellendorffii]
 gb|EFJ17444.1| hypothetical protein SELMODRAFT_154638 [Selaginella moellendorffii]
Length=338

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 12/53 (23%)
 Frame = +1

Query  331  CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
            CPFG            +VS+     SPKCPLG+D+ +FKLGPLSC++C+ALL+
Sbjct  3    CPFG--------GATHEVSDS----SPKCPLGYDTASFKLGPLSCLVCRALLF  43



>gb|ACG25350.1| hypothetical protein [Zea mays]
Length=351

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  394  PGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
            P V+  KCP G+DS TFKLGPLSC++CQALL+
Sbjct  66   PRVVPAKCPFGYDSNTFKLGPLSCIVCQALLH  97



>ref|NP_001140913.1| LOC100272990 [Zea mays]
 ref|XP_008672386.1| PREDICTED: LOC100272990 isoform X1 [Zea mays]
 gb|ACF84952.1| unknown [Zea mays]
 tpg|DAA53866.1| TPA: putative RING zinc finger domain and TPR repeat-containing 
protein domain protein isoform 1 [Zea mays]
 tpg|DAA53867.1| TPA: putative RING zinc finger domain and TPR repeat-containing 
protein domain protein isoform 2 [Zea mays]
 tpg|DAA53868.1| TPA: putative RING zinc finger domain and TPR repeat-containing 
protein domain protein isoform 3 [Zea mays]
Length=379

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  394  PGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
            P V+  KCP G+DS TFKLGPLSC++CQALL+
Sbjct  66   PRVVPAKCPFGYDSNTFKLGPLSCIVCQALLH  97



>ref|NP_001048384.1| Os02g0795300 [Oryza sativa Japonica Group]
 dbj|BAD19269.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10298.1| Os02g0795300 [Oryza sativa Japonica Group]
 dbj|BAG92291.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92078.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57969.1| hypothetical protein OsJ_08709 [Oryza sativa Japonica Group]
Length=365

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 12/90 (13%)
 Frame = +1

Query  235  VPSKCPFVHKQQAGSE--IKPNQESGEQAKVSSKCPFGYTQEAGGENKPK--QVSEKPGV  402
            + S CPF     AG+   +K + ++       + CP         ++  K    +  P V
Sbjct  1    MSSLCPFAKLASAGATCPVKSDNKT-------TSCPVTANNHTDDDDNEKTGNANTDPRV  53

Query  403  MSPKCPLGFDSQ-TFKLGPLSCMICQALLY  489
            +  KCP G+DS  TFKLGPLSC++C ALL+
Sbjct  54   VPAKCPFGYDSNNTFKLGPLSCVVCHALLH  83



>ref|XP_004967927.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Setaria italica]
Length=379

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  394  PGVMSPKCPLGFDSQTFKLGPLSCMICQALLY  489
            P ++  KCP G+DS TFKLGPLSC+ICQALL+
Sbjct  66   PRMVPAKCPFGYDSNTFKLGPLSCIICQALLH  97



>gb|EEC74169.1| hypothetical protein OsI_09273 [Oryza sativa Indica Group]
Length=655

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = +1

Query  370  KPKQVSEKPGVMSPKCPLGFDSQ-TFKLGPLSCMICQALLY  489
            K    +  P V+  KCP G+DS  TFKLGPLSC++C ALL+
Sbjct  333  KTGNANTDPRVVPAKCPFGYDSNNTFKLGPLSCVVCHALLH  373



Lambda      K        H        a         alpha
   0.316    0.134    0.413    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370