BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF009D12

Length=244
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587086.1|  PREDICTED: uncharacterized protein LOC104084...  58.9    7e-09   Nicotiana tomentosiformis
ref|XP_009587088.1|  PREDICTED: uncharacterized protein LOC104084...  58.5    9e-09   Nicotiana tomentosiformis
ref|XP_009796725.1|  PREDICTED: uncharacterized protein LOC104243262  56.6    4e-08   Nicotiana sylvestris
ref|XP_006353405.1|  PREDICTED: uncharacterized protein LOC102603...  55.1    2e-07   Solanum tuberosum [potatoes]
ref|XP_004240896.1|  PREDICTED: uncharacterized protein LOC101265648  50.8    5e-06   Solanum lycopersicum
ref|XP_010031141.1|  PREDICTED: uncharacterized protein LOC104421024  45.1    5e-04   Eucalyptus grandis [rose gum]



>ref|XP_009587086.1| PREDICTED: uncharacterized protein LOC104084834 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009587087.1| PREDICTED: uncharacterized protein LOC104084834 isoform X1 [Nicotiana 
tomentosiformis]
Length=189

 Score = 58.9 bits (141),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 46/72 (64%), Gaps = 5/72 (7%)
 Frame = +3

Query  18   MGKSVPSPTKLQDFARIIGSNTPR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  194
            MGKSVPSP ++QDFARII S+  R   PTQVKPP SR RS+  A   K + +VGG  S  
Sbjct  1    MGKSVPSPNRIQDFARIISSSNNRIHGPTQVKPPASRIRSLPSA---KSRAVVGGDSSER  57

Query  195  serrlrrNKMEE  230
              +   +N MEE
Sbjct  58   RLKLKTKN-MEE  68



>ref|XP_009587088.1| PREDICTED: uncharacterized protein LOC104084834 isoform X2 [Nicotiana 
tomentosiformis]
Length=175

 Score = 58.5 bits (140),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 46/72 (64%), Gaps = 5/72 (7%)
 Frame = +3

Query  18   MGKSVPSPTKLQDFARIIGSNTPR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  194
            MGKSVPSP ++QDFARII S+  R   PTQVKPP SR RS+  A   K + +VGG  S  
Sbjct  1    MGKSVPSPNRIQDFARIISSSNNRIHGPTQVKPPASRIRSLPSA---KSRAVVGGDSSER  57

Query  195  serrlrrNKMEE  230
              +   +N MEE
Sbjct  58   RLKLKTKN-MEE  68



>ref|XP_009796725.1| PREDICTED: uncharacterized protein LOC104243262 [Nicotiana sylvestris]
 ref|XP_009796726.1| PREDICTED: uncharacterized protein LOC104243262 [Nicotiana sylvestris]
Length=175

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 45/72 (63%), Gaps = 5/72 (7%)
 Frame = +3

Query  18   MGKSVPSPTKLQDFARIIGSNTPR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  194
            MGKSV SP ++QDFARII S+  R   PTQVKPP SR RSV  A   K + +VGG  S  
Sbjct  1    MGKSVLSPNRIQDFARIISSSNNRIHGPTQVKPPASRIRSVPSA---KSRAVVGGDSSER  57

Query  195  serrlrrNKMEE  230
              +   +N MEE
Sbjct  58   RLKLRTKN-MEE  68



>ref|XP_006353405.1| PREDICTED: uncharacterized protein LOC102603532 isoform X1 [Solanum 
tuberosum]
 ref|XP_006353406.1| PREDICTED: uncharacterized protein LOC102603532 isoform X2 [Solanum 
tuberosum]
Length=176

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = +3

Query  18   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGG  179
            MGKS+PSP ++QDFARII SN   +RPTQVK P SR RSV      K + +V G
Sbjct  1    MGKSLPSPNRIQDFARIISSNRI-QRPTQVK-PASRIRSVPSPVAAKFRAVVDG  52



>ref|XP_004240896.1| PREDICTED: uncharacterized protein LOC101265648 [Solanum lycopersicum]
Length=176

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = +3

Query  18   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGG  179
            MGKS+PSP ++QDFARII SN     PTQVK P +R RSV      K + +V G
Sbjct  1    MGKSLPSPNRIQDFARIINSNRI-HHPTQVK-PATRIRSVPSPVAAKSRAVVDG  52



>ref|XP_010031141.1| PREDICTED: uncharacterized protein LOC104421024 [Eucalyptus grandis]
 ref|XP_010031142.1| PREDICTED: uncharacterized protein LOC104421024 [Eucalyptus grandis]
 ref|XP_010031143.1| PREDICTED: uncharacterized protein LOC104421024 [Eucalyptus grandis]
 gb|KCW50408.1| hypothetical protein EUGRSUZ_J00156 [Eucalyptus grandis]
 gb|KCW50409.1| hypothetical protein EUGRSUZ_J00156 [Eucalyptus grandis]
Length=171

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  18   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSP  143
            MGKS+PS T+LQDFAR + S+   R P Q K P+SR R  +P
Sbjct  1    MGKSIPSATRLQDFARAVSSSDKLRLPKQAK-PISRIRVSTP  41



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559512047520