BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF009C01

Length=333
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS68501.1|  hypothetical protein M569_06265                         119   3e-29   Genlisea aurea
ref|XP_011071137.1|  PREDICTED: glutamate--glyoxylate aminotransf...    118   6e-29   
ref|XP_009765091.1|  PREDICTED: glutamate--glyoxylate aminotransf...    117   8e-29   Nicotiana sylvestris
ref|XP_009623844.1|  PREDICTED: glutamate--glyoxylate aminotransf...    117   9e-29   Nicotiana tomentosiformis
ref|XP_009759837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    117   1e-28   Nicotiana sylvestris
ref|XP_009624740.1|  PREDICTED: glutamate--glyoxylate aminotransf...    117   1e-28   Nicotiana tomentosiformis
ref|XP_004228555.1|  PREDICTED: glutamate--glyoxylate aminotransf...    117   1e-28   Solanum lycopersicum
ref|XP_006348507.1|  PREDICTED: glutamate--glyoxylate aminotransf...    117   1e-28   
ref|XP_011086618.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    117   2e-28   
ref|XP_004239121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    116   2e-28   Solanum lycopersicum
emb|CDY25781.1|  BnaA07g10010D                                          108   2e-28   Brassica napus [oilseed rape]
ref|XP_006357614.1|  PREDICTED: glutamate--glyoxylate aminotransf...    116   2e-28   Solanum tuberosum [potatoes]
gb|AFK37995.1|  unknown                                                 109   3e-28   Lotus japonicus
gb|EYU28421.1|  hypothetical protein MIMGU_mgv1a005535mg                116   3e-28   Erythranthe guttata [common monkey flower]
emb|CDP13207.1|  unnamed protein product                                115   5e-28   Coffea canephora [robusta coffee]
ref|XP_010498838.1|  PREDICTED: glutamate--glyoxylate aminotransf...    115   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010552672.1|  PREDICTED: glutamate--glyoxylate aminotransf...    115   8e-28   Tarenaya hassleriana [spider flower]
ref|XP_010460118.1|  PREDICTED: glutamate--glyoxylate aminotransf...    115   9e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006416098.1|  hypothetical protein EUTSA_v10007514mg             114   9e-28   
ref|XP_006307377.1|  hypothetical protein CARUB_v10009003mg             115   1e-27   Capsella rubella
dbj|BAH20108.1|  AT1G70580                                              114   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390865.1|  hypothetical protein EUTSA_v10018474mg             114   1e-27   
ref|NP_177215.1|  glutamate--glyoxylate aminotransferase 2              114   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887312.1|  alanine-2-oxoglutarate aminotransferase 2          114   1e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_009115544.1|  PREDICTED: glutamate--glyoxylate aminotransf...    114   2e-27   Brassica rapa
ref|XP_010477627.1|  PREDICTED: glutamate--glyoxylate aminotransf...    114   2e-27   Camelina sativa [gold-of-pleasure]
ref|NP_001031083.1|  glutamate:glyoxylate aminotransferase              113   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893277.1|  alanine-2-oxoglutarate aminotransferase 1          114   3e-27   
gb|AAK25905.1|AF360195_1  putative alanine aminotransferase             114   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658210.1|  PREDICTED: glutamate--glyoxylate aminotransf...    114   3e-27   
gb|AAL24255.1|  At1g23310/F26F24_4                                      114   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564192.2|  glutamate:glyoxylate aminotransferase                 114   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682426.1|  PREDICTED: glutamate--glyoxylate aminotransf...    113   4e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010471056.1|  PREDICTED: glutamate--glyoxylate aminotransf...    113   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006416099.1|  hypothetical protein EUTSA_v10007514mg             113   4e-27   
ref|XP_004955317.1|  PREDICTED: glutamate--glyoxylate aminotransf...    113   4e-27   Setaria italica
ref|XP_006300456.1|  hypothetical protein CARUB_v10020212mg             113   4e-27   
emb|CDY61225.1|  BnaC06g43710D                                          113   4e-27   Brassica napus [oilseed rape]
ref|XP_010427837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    113   5e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010415743.1|  PREDICTED: glutamate--glyoxylate aminotransf...    113   5e-27   Camelina sativa [gold-of-pleasure]
ref|NP_001151209.1|  alanine aminotransferase 2                         112   5e-27   
emb|CDY66294.1|  BnaAnng22050D                                          113   5e-27   Brassica napus [oilseed rape]
ref|XP_009105727.1|  PREDICTED: glutamate--glyoxylate aminotransf...    112   5e-27   Brassica rapa
ref|NP_001058716.1|  Os07g0108300                                       112   6e-27   
ref|XP_004309987.1|  PREDICTED: glutamate--glyoxylate aminotransf...    112   6e-27   Fragaria vesca subsp. vesca
gb|AAO84040.1|  alanine aminotransferase                                112   6e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_002312679.2|  alanine-2-oxoglutarate aminotransferase 1 fa...    112   6e-27   Populus trichocarpa [western balsam poplar]
ref|XP_009105726.1|  PREDICTED: glutamate--glyoxylate aminotransf...    112   7e-27   Brassica rapa
gb|KDP26646.1|  hypothetical protein JCGZ_17804                         112   7e-27   Jatropha curcas
emb|CDY12474.1|  BnaC07g13140D                                          113   7e-27   Brassica napus [oilseed rape]
ref|XP_008340115.1|  PREDICTED: glutamate--glyoxylate aminotransf...    112   8e-27   Malus domestica [apple tree]
ref|XP_002527918.1|  alanine aminotransferase, putative                 112   9e-27   
ref|XP_008447004.1|  PREDICTED: glutamate--glyoxylate aminotransf...    111   9e-27   
ref|XP_004955316.1|  PREDICTED: glutamate--glyoxylate aminotransf...    112   9e-27   
ref|XP_009103182.1|  PREDICTED: glutamate--glyoxylate aminotransf...    112   1e-26   Brassica rapa
ref|XP_004489787.1|  PREDICTED: glutamate--glyoxylate aminotransf...    112   1e-26   Cicer arietinum [garbanzo]
ref|XP_003613139.1|  Alanine aminotransferase                           111   1e-26   Medicago truncatula
ref|XP_004489786.1|  PREDICTED: glutamate--glyoxylate aminotransf...    112   1e-26   
ref|XP_006378236.1|  hypothetical protein POPTR_0010s05530g             110   1e-26   
gb|AAM61453.1|  putative alanine aminotransferase                       111   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406515.1|  PREDICTED: glutamate--glyoxylate aminotransf...    111   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003613140.1|  Alanine aminotransferase                           111   2e-26   
ref|XP_008446998.1|  PREDICTED: glutamate--glyoxylate aminotransf...    108   2e-26   
ref|XP_002315675.1|  hypothetical protein POPTR_0010s05530g             111   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_011014669.1|  PREDICTED: glutamate--glyoxylate aminotransf...    111   2e-26   Populus euphratica
ref|XP_009359228.1|  PREDICTED: glutamate--glyoxylate aminotransf...    111   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_010100388.1|  Glutamate--glyoxylate aminotransferase 2           111   2e-26   Morus notabilis
ref|XP_003557680.1|  PREDICTED: glutamate--glyoxylate aminotransf...    111   2e-26   Brachypodium distachyon [annual false brome]
ref|XP_004135487.1|  PREDICTED: glutamate--glyoxylate aminotransf...    111   2e-26   
ref|XP_010023477.1|  PREDICTED: glutamate--glyoxylate aminotransf...    111   2e-26   Eucalyptus grandis [rose gum]
ref|XP_010927963.1|  PREDICTED: glutamate--glyoxylate aminotransf...    111   2e-26   Elaeis guineensis
emb|CBI23368.3|  unnamed protein product                                111   2e-26   Vitis vinifera
gb|AAZ43368.1|  AlaT1                                                   111   2e-26   Vitis labrusca [Concord grape]
ref|XP_009413361.1|  PREDICTED: glutamate--glyoxylate aminotransf...    111   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN62302.1|  hypothetical protein VITISV_023686                     111   3e-26   Vitis vinifera
ref|XP_006840828.1|  hypothetical protein AMTR_s00083p00031040          110   3e-26   Amborella trichopoda
ref|NP_001268094.1|  uncharacterized protein LOC100261274               110   3e-26   Vitis vinifera
gb|KDO82251.1|  hypothetical protein CISIN_1g041151mg                   110   3e-26   Citrus sinensis [apfelsine]
gb|EMS58349.1|  Alanine aminotransferase 2                              110   3e-26   Triticum urartu
ref|XP_004155366.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    110   3e-26   
gb|KGN51767.1|  hypothetical protein Csa_5G598750                       110   3e-26   Cucumis sativus [cucumbers]
ref|XP_010251104.1|  PREDICTED: glutamate--glyoxylate aminotransf...    110   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_008221924.1|  PREDICTED: glutamate--glyoxylate aminotransf...    110   4e-26   Prunus mume [ume]
gb|KGN51765.1|  hypothetical protein Csa_5G598730                       110   4e-26   Cucumis sativus [cucumbers]
ref|XP_006438274.1|  hypothetical protein CICLE_v10031381mg             110   5e-26   Citrus clementina [clementine]
emb|CDY41452.1|  BnaA08g20540D                                          110   5e-26   Brassica napus [oilseed rape]
ref|XP_009110107.1|  PREDICTED: glutamate--glyoxylate aminotransf...    110   5e-26   Brassica rapa
gb|KHG15331.1|  Glutamate--glyoxylate aminotransferase 2 -like pr...    110   5e-26   Gossypium arboreum [tree cotton]
ref|XP_008789746.1|  PREDICTED: glutamate--glyoxylate aminotransf...    110   5e-26   
ref|XP_006438273.1|  hypothetical protein CICLE_v10031381mg             109   5e-26   
ref|NP_001183048.1|  uncharacterized protein LOC100501386               110   5e-26   Zea mays [maize]
ref|XP_008444367.1|  PREDICTED: glutamate--glyoxylate aminotransf...    109   6e-26   Cucumis melo [Oriental melon]
ref|XP_007222799.1|  hypothetical protein PRUPE_ppa005017mg             109   7e-26   Prunus persica
ref|XP_002968244.1|  hypothetical protein SELMODRAFT_145611             109   7e-26   Selaginella moellendorffii
ref|XP_007044762.1|  Alanine-2-oxoglutarate aminotransferase 2 is...    109   1e-25   
gb|EMT29455.1|  Alanine aminotransferase 2                              109   1e-25   
tpg|DAA42656.1|  TPA: hypothetical protein ZEAMMB73_648980              109   1e-25   
tpg|DAA42658.1|  TPA: LOW QUALITY PROTEIN: alanine aminotransfera...    108   1e-25   
ref|XP_008389735.1|  PREDICTED: glutamate--glyoxylate aminotransf...    108   2e-25   
ref|NP_001237581.1|  alanine aminotransferase 3                         108   2e-25   Glycine max [soybeans]
ref|XP_003519649.1|  PREDICTED: glutamate--glyoxylate aminotransf...    108   2e-25   Glycine max [soybeans]
ref|NP_001237567.1|  alanine aminotransferase 2                         108   2e-25   
gb|KHN14541.1|  Glutamate--glyoxylate aminotransferase 2                108   2e-25   Glycine soja [wild soybean]
gb|KJB31174.1|  hypothetical protein B456_005G179600                    107   4e-25   Gossypium raimondii
ref|XP_010928898.1|  PREDICTED: glutamate--glyoxylate aminotransf...    107   5e-25   Elaeis guineensis
gb|KJB31170.1|  hypothetical protein B456_005G179600                    107   6e-25   Gossypium raimondii
gb|AET06145.1|  PLP-dependent aminotransferase                          107   8e-25   Papaver somniferum
ref|XP_007158412.1|  hypothetical protein PHAVU_002G150800g             106   2e-24   Phaseolus vulgaris [French bean]
ref|XP_001782822.1|  predicted protein                                  105   2e-24   
gb|ABK25444.1|  unknown                                                 105   3e-24   Picea sitchensis
ref|XP_001777071.1|  predicted protein                                  105   4e-24   
ref|XP_004142968.1|  PREDICTED: glutamate--glyoxylate aminotransf...    104   5e-24   Cucumis sativus [cucumbers]
ref|XP_001763950.1|  predicted protein                                  103   1e-23   
emb|CAO02585.1|  alanine amino-transferase                            95.1    5e-23   Medicago truncatula var. truncatula
gb|KJB31175.1|  hypothetical protein B456_005G179600                  99.4    6e-22   Gossypium raimondii
ref|XP_002947519.1|  alanine aminotransferase                         92.0    3e-19   Volvox carteri f. nagariensis
gb|AAB01685.1|  alanine aminotransferase                              88.2    7e-18   Chlamydomonas reinhardtii
ref|XP_001698518.1|  alanine aminotransferase                         88.2    7e-18   Chlamydomonas reinhardtii
ref|XP_005651940.1|  alanine aminotransferase                         85.1    1e-16   Coccomyxa subellipsoidea C-169
emb|CBJ25743.1|  nicotinanamine aminotransferase A                    84.0    2e-16   Ectocarpus siliculosus
gb|KIZ04988.1|  alanine transaminase                                  80.5    5e-16   Monoraphidium neglectum
gb|EWM24220.1|  alanine-2-oxoglutarate aminotransferase 2             79.7    8e-15   Nannochloropsis gaditana
gb|KIY95165.1|  alanine transaminase                                  74.7    5e-14   Monoraphidium neglectum
ref|XP_005847240.1|  hypothetical protein CHLNCDRAFT_57929            75.5    2e-13   Chlorella variabilis
gb|KIZ07569.1|  alanine transaminase                                  74.3    6e-13   Monoraphidium neglectum
ref|XP_011398130.1|  putative alanine aminotransferase, mitochond...  73.6    1e-12   Auxenochlorella protothecoides
gb|EJK50290.1|  hypothetical protein THAOC_30762                      72.0    4e-12   Thalassiosira oceanica
gb|KDD76740.1|  aminotransferase                                      71.2    6e-12   Helicosporidium sp. ATCC 50920
ref|XP_002176328.1|  predicted protein                                69.7    2e-11   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_009041360.1|  hypothetical protein AURANDRAFT_67623            70.1    3e-11   Aureococcus anophagefferens
gb|ACF86318.1|  unknown                                               64.7    4e-11   Zea mays [maize]
gb|EJK48082.1|  hypothetical protein THAOC_33157                      68.6    7e-11   Thalassiosira oceanica
dbj|BAQ21243.1|  hypothetical protein                                 63.9    1e-10   Ostrinia furnacalis
ref|XP_002289904.1|  alanine aminotransferase                         67.0    1e-10   Thalassiosira pseudonana CCMP1335
gb|AGT60040.1|  aminotransferase                                      67.0    2e-10   uncultured bacterium
ref|XP_001745052.1|  hypothetical protein                             66.6    2e-10   Monosiga brevicollis MX1
ref|XP_004992298.1|  alanine aminotransferase                         65.9    5e-10   Salpingoeca rosetta
ref|WP_026853156.1|  aminotransferase class I/II                      64.7    1e-09   Geothrix fermentans
ref|XP_003646187.1|  hypothetical protein Ecym_4307                   63.9    3e-09   Eremothecium cymbalariae DBVPG#7215
ref|XP_005766369.1|  hypothetical protein EMIHUDRAFT_256711           60.8    4e-09   Emiliania huxleyi CCMP1516
ref|XP_010783831.1|  PREDICTED: alanine aminotransferase 1-like       59.3    4e-09   Notothenia coriiceps [yellowbelly rockcod]
ref|WP_012096788.1|  aminotransferase class I/II                      62.8    5e-09   Anaeromyxobacter sp. Fw109-5
ref|XP_008797360.1|  PREDICTED: alanine aminotransferase 2-like       62.8    7e-09   Phoenix dactylifera
ref|XP_010917381.1|  PREDICTED: alanine aminotransferase 2-like i...  62.0    9e-09   Elaeis guineensis
ref|XP_010917379.1|  PREDICTED: alanine aminotransferase 2-like i...  62.0    1e-08   Elaeis guineensis
ref|XP_010917380.1|  PREDICTED: alanine aminotransferase 2-like i...  61.6    1e-08   Elaeis guineensis
ref|XP_010261672.1|  PREDICTED: alanine aminotransferase 2-like       61.6    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_005790253.1|  alanine aminotransferase                         61.6    2e-08   Emiliania huxleyi CCMP1516
ref|XP_010917378.1|  PREDICTED: alanine aminotransferase 2-like i...  61.6    2e-08   Elaeis guineensis
ref|XP_004924185.1|  PREDICTED: alanine aminotransferase 2-like       61.2    2e-08   
ref|XP_010939848.1|  PREDICTED: alanine aminotransferase 2 isofor...  60.5    3e-08   Elaeis guineensis
ref|WP_005033524.1|  aminotransferase class I/II                      60.5    3e-08   Holophaga foetida
ref|XP_003627448.1|  Alanine aminotransferase                         60.5    4e-08   Medicago truncatula
ref|XP_002304255.2|  hypothetical protein POPTR_0003s07020g           60.1    4e-08   
gb|AFK39904.1|  unknown                                               60.5    4e-08   Medicago truncatula
emb|CEF68484.1|  Alanine aminotransferase 1                           60.1    4e-08   Strongyloides ratti
gb|ACJ85860.1|  unknown                                               60.1    4e-08   Medicago truncatula
ref|XP_008380735.1|  PREDICTED: alanine aminotransferase 2            60.1    5e-08   Malus domestica [apple tree]
ref|XP_004510570.1|  PREDICTED: alanine aminotransferase 2, mitoc...  60.1    5e-08   Cicer arietinum [garbanzo]
ref|XP_005648726.1|  alanine aminotransferase 2                       60.1    5e-08   Coccomyxa subellipsoidea C-169
gb|EHJ74142.1|  putative alanine aminotransferase                     59.7    7e-08   
gb|KFH67262.1|  alanine transaminase                                  59.7    7e-08   Mortierella verticillata NRRL 6337
ref|XP_006657960.1|  PREDICTED: alanine aminotransferase 2-like i...  59.3    7e-08   Oryza brachyantha
ref|XP_008783332.1|  PREDICTED: alanine aminotransferase 2            59.3    8e-08   Phoenix dactylifera
gb|EEE67593.1|  hypothetical protein OsJ_25140                        59.3    8e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82447.1|  hypothetical protein OsI_26881                        59.3    8e-08   Oryza sativa Indica Group [Indian rice]
gb|KFV83100.1|  Alanine aminotransferase 2                            59.3    9e-08   Struthio camelus australis
ref|XP_002532946.1|  alanine transaminase, putative                   56.6    1e-07   
tpg|DAA63614.1|  TPA: hypothetical protein ZEAMMB73_898222            56.6    1e-07   
ref|XP_002112002.1|  hypothetical protein TRIADDRAFT_50189            58.9    1e-07   Trichoplax adhaerens
ref|XP_008305774.1|  PREDICTED: alanine aminotransferase 1            58.9    1e-07   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_011079322.1|  PREDICTED: alanine aminotransferase 2-like       58.9    1e-07   Sesamum indicum [beniseed]
ref|XP_011048627.1|  PREDICTED: alanine aminotransferase 2, mitoc...  58.5    1e-07   Populus euphratica
ref|XP_008460349.1|  PREDICTED: alanine aminotransferase 1, mitoc...  58.5    1e-07   Cucumis melo [Oriental melon]
ref|XP_009380146.1|  PREDICTED: alanine aminotransferase 2-like       58.5    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006342898.1|  PREDICTED: alanine aminotransferase 2, mitoc...  58.5    2e-07   Solanum tuberosum [potatoes]
gb|AIT69925.1|  alanine transaminase                                  58.5    2e-07   Saccharina sculpera
gb|KHJ88132.1|  hypothetical protein OESDEN_12077                     55.5    2e-07   Oesophagostomum dentatum [nodule worm]
gb|AIT69927.1|  alanine transaminase                                  58.5    2e-07   Saccharina japonica
sp|P52894.1|ALA2_HORVU  RecName: Full=Alanine aminotransferase 2;...  58.2    2e-07   Hordeum vulgare [barley]
pdb|3TCM|A  Chain A, Crystal Structure Of Alanine Aminotransferas...  58.2    2e-07   Hordeum vulgare [barley]
ref|XP_008800517.1|  PREDICTED: alanine aminotransferase 2-like       58.2    2e-07   
ref|XP_011109633.1|  hypothetical protein H072_3664                   58.2    2e-07   
gb|AGE89226.1|  cytosolic alanine aminotransferase                    55.8    2e-07   Dicentrarchus labrax [European sea bass]
emb|CDJ98237.1|  Putative alanine aminotransferase                    54.3    2e-07   Haemonchus contortus [red stomach worm]
ref|XP_008460347.1|  PREDICTED: alanine aminotransferase 2-like i...  58.2    2e-07   Cucumis melo [Oriental melon]
ref|XP_009110415.1|  PREDICTED: alanine aminotransferase 1, mitoc...  58.2    2e-07   Brassica rapa
ref|XP_003682412.1|  hypothetical protein TDEL_0F03900                58.2    2e-07   Torulaspora delbrueckii
gb|KDR12685.1|  Alanine aminotransferase 2                            58.2    2e-07   Zootermopsis nevadensis
emb|CDX96776.1|  BnaA08g23190D                                        58.2    2e-07   
ref|XP_004141733.1|  PREDICTED: alanine aminotransferase 2, mitoc...  58.2    2e-07   Cucumis sativus [cucumbers]
ref|XP_004144444.1|  PREDICTED: alanine aminotransferase 2, mitoc...  58.2    2e-07   
ref|XP_004155894.1|  PREDICTED: alanine aminotransferase 2, mitoc...  58.2    2e-07   
gb|KGN58474.1|  hypothetical protein Csa_3G646610                     58.2    2e-07   Cucumis sativus [cucumbers]
ref|XP_006416720.1|  hypothetical protein EUTSA_v10007290mg           58.2    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_007409910.1|  hypothetical protein MELLADRAFT_43385            57.8    3e-07   Melampsora larici-populina 98AG31
ref|XP_002175263.1|  alanine aminotransferase                         57.8    3e-07   Schizosaccharomyces japonicus yFS275
ref|XP_011036545.1|  PREDICTED: alanine aminotransferase 2-like       57.8    3e-07   Populus euphratica
ref|XP_011072689.1|  PREDICTED: alanine aminotransferase 2            57.8    3e-07   Sesamum indicum [beniseed]
ref|XP_002430266.1|  Alanine aminotransferase, putative               57.8    3e-07   Pediculus humanus corporis [human body lice]
gb|KJB70038.1|  hypothetical protein B456_011G0552002                 54.7    3e-07   Gossypium raimondii
ref|NP_001237553.1|  alanine aminotransferase 1                       57.8    3e-07   
ref|XP_011499275.1|  PREDICTED: alanine aminotransferase 2            57.8    3e-07   Ceratosolen solmsi marchali
ref|XP_003967921.1|  PREDICTED: alanine aminotransferase 2-like       57.4    3e-07   
ref|XP_011127540.1|  hypothetical protein AOL_s00215g36               57.4    4e-07   Arthrobotrys oligospora ATCC 24927
gb|AIT69915.1|  alanine transaminase                                  57.4    4e-07   Undaria pinnatifida
gb|KHN39571.1|  Alanine aminotransferase 2, mitochondrial             57.4    4e-07   Glycine soja [wild soybean]
ref|XP_008180133.1|  PREDICTED: alanine aminotransferase 2 isofor...  57.4    4e-07   Acyrthosiphon pisum
ref|XP_010029516.1|  PREDICTED: alanine aminotransferase 2-like       57.4    4e-07   Eucalyptus grandis [rose gum]
ref|XP_001948711.2|  PREDICTED: alanine aminotransferase 1 isofor...  57.4    4e-07   Acyrthosiphon pisum
ref|XP_003528736.1|  PREDICTED: alanine aminotransferase 2, mitoc...  57.4    4e-07   Glycine max [soybeans]
ref|XP_001966097.1|  GF19406                                          55.8    4e-07   Drosophila ananassae
emb|CDX83914.1|  BnaC08g17310D                                        57.4    4e-07   
ref|XP_008462239.1|  PREDICTED: alanine aminotransferase 1, mitoc...  57.0    4e-07   Cucumis melo [Oriental melon]
tpg|DAA46932.1|  TPA: hypothetical protein ZEAMMB73_135514            53.9    4e-07   
ref|XP_007217248.1|  hypothetical protein PRUPE_ppa003850mg           57.4    5e-07   Prunus persica
ref|XP_001622550.1|  hypothetical protein NEMVEDRAFT_v1g236165        57.0    5e-07   Nematostella vectensis
ref|XP_009389580.1|  PREDICTED: alanine aminotransferase 2-like       57.0    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBK19835.2|  Alanine aminotransferase 2                           57.0    5e-07   Blastocystis hominis
emb|CDX81815.1|  BnaC08g37860D                                        57.0    5e-07   
ref|XP_004303756.1|  PREDICTED: alanine aminotransferase 2            57.0    5e-07   Fragaria vesca subsp. vesca
emb|CCW65758.1|  unnamed protein product                              57.0    5e-07   Phytomonas sp. isolate EM1
emb|CBN81871.1|  Alanine aminotransferase 2-like                      57.0    5e-07   Dicentrarchus labrax [European sea bass]
ref|XP_002265294.2|  PREDICTED: alanine aminotransferase 2            57.0    5e-07   Vitis vinifera
ref|XP_007239533.1|  PREDICTED: alanine aminotransferase 2-like       53.5    5e-07   
ref|NP_001132269.1|  uncharacterized protein LOC100193705             54.7    5e-07   
ref|XP_008228107.1|  PREDICTED: alanine aminotransferase 2, mitoc...  57.0    5e-07   Prunus mume [ume]
ref|XP_455940.1|  hypothetical protein                                57.0    6e-07   Kluyveromyces lactis
ref|XP_006307188.1|  hypothetical protein CARUB_v10008780mg           57.0    6e-07   Capsella rubella
gb|AAF82782.1|AF275372_1  alanine aminotransferase                    57.0    6e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173173.3|  alanine aminotransferase                            57.0    6e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAK64147.2|  putative alanine aminotransferase                     57.0    6e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48485.1|  BnaC05g13450D                                        57.0    6e-07   Brassica napus [oilseed rape]
gb|ADB91976.1|  alanine aminotransferase                              57.0    6e-07   Branchiostoma belcheri
ref|XP_009149177.1|  PREDICTED: alanine aminotransferase 1, mitoc...  57.0    6e-07   Brassica rapa
emb|CBI35796.3|  unnamed protein product                              56.6    6e-07   Vitis vinifera
ref|XP_009117710.1|  PREDICTED: alanine aminotransferase 1, mitoc...  57.0    6e-07   Brassica rapa
gb|EWC46913.1|  hypothetical protein DRE_03925                        56.6    6e-07   Drechslerella stenobrocha 248
ref|XP_002890217.1|  alanine aminotransferase                         57.0    6e-07   Arabidopsis lyrata subsp. lyrata
gb|KFK43924.1|  hypothetical protein AALP_AA1G191800                  57.0    6e-07   Arabis alpina [alpine rockcress]
ref|XP_001769989.1|  predicted protein                                56.6    6e-07   
gb|AIT69921.1|  alanine transaminase                                  56.6    6e-07   Sargassum muticum
ref|XP_003760591.1|  PREDICTED: alanine aminotransferase 1            56.6    6e-07   
gb|KDP40629.1|  hypothetical protein JCGZ_24628                       57.0    6e-07   Jatropha curcas
ref|XP_008653343.1|  PREDICTED: alanine aminotransferase 2            57.0    6e-07   Zea mays [maize]
emb|CDY26256.1|  BnaA06g11610D                                        56.6    6e-07   Brassica napus [oilseed rape]
ref|XP_006775215.1|  PREDICTED: alanine aminotransferase 1            55.8    6e-07   Myotis davidii
emb|CDY21752.1|  BnaA09g45030D                                        57.0    6e-07   Brassica napus [oilseed rape]
gb|EFX71233.1|  hypothetical protein DAPPUDRAFT_309150                56.6    7e-07   Daphnia pulex
emb|CDO96247.1|  unnamed protein product                              56.6    7e-07   Kluyveromyces dobzhanskii CBS 2104
gb|EYC32543.1|  hypothetical protein Y032_0003g1641                   56.6    7e-07   Ancylostoma ceylanicum
ref|XP_010318453.1|  PREDICTED: alanine aminotransferase 2, mitoc...  56.6    7e-07   Solanum lycopersicum
gb|EPZ32571.1|  Aminotransferase, class I/classII domain-containi...  55.8    7e-07   Rozella allomycis CSF55
gb|AIT69919.1|  alanine transaminase                                  56.6    7e-07   Sargassum vachellianum
ref|NP_001021022.1|  Protein C32F10.8, isoform b                      56.2    7e-07   Caenorhabditis elegans [roundworm]
gb|EYE95145.1|  PLP-dependent transferase                             56.6    7e-07   Aspergillus ruber CBS 135680
ref|XP_007488862.1|  PREDICTED: alanine aminotransferase 1 isofor...  56.6    7e-07   Monodelphis domestica
emb|CDO97792.1|  unnamed protein product                              56.6    8e-07   Coffea canephora [robusta coffee]
ref|XP_009051124.1|  hypothetical protein LOTGIDRAFT_114341           56.6    8e-07   Lottia gigantea
gb|AIT69926.1|  alanine transaminase                                  56.6    8e-07   Sargassum horneri
gb|AIT69931.1|  alanine transaminase                                  56.6    8e-07   Sargassum thunbergii
gb|AIT69930.1|  alanine transaminase                                  56.6    8e-07   Sargassum hemiphyllum var. chinense
ref|XP_001372290.1|  PREDICTED: alanine aminotransferase 1 isofor...  56.6    8e-07   
gb|AIT69922.1|  alanine transaminase                                  56.6    8e-07   Sargassum fusiforme
ref|XP_004235528.1|  PREDICTED: alanine aminotransferase 2, mitoc...  56.2    8e-07   
gb|AIT69916.1|  alanine transaminase                                  56.2    8e-07   Sargassum henslowianum
gb|AIT69934.1|  alanine transaminase                                  56.6    8e-07   Gracilaria chouae
ref|XP_010318452.1|  PREDICTED: alanine aminotransferase 2, mitoc...  56.2    8e-07   Solanum lycopersicum
gb|KIH47618.1|  alanine aminotransferase 2 family protein             55.8    9e-07   Ancylostoma duodenale
ref|XP_010537653.1|  PREDICTED: alanine aminotransferase 2, mitoc...  56.2    9e-07   Tarenaya hassleriana [spider flower]
ref|XP_002430215.1|  Alanine aminotransferase, putative               56.2    9e-07   Pediculus humanus corporis [human body lice]
dbj|GAD97541.1|  alanine aminotransferase                             56.2    9e-07   Byssochlamys spectabilis No. 5
ref|NP_001021021.1|  Protein C32F10.8, isoform a                      56.2    1e-06   Caenorhabditis elegans [roundworm]
gb|KDO53769.1|  hypothetical protein CISIN_1g009517mg                 55.8    1e-06   Citrus sinensis [apfelsine]
ref|XP_007510961.1|  predicted protein                                56.2    1e-06   Bathycoccus prasinos
ref|XP_003111097.1|  hypothetical protein CRE_03967                   56.2    1e-06   Caenorhabditis remanei
ref|XP_011140986.1|  PREDICTED: alanine aminotransferase 1 isofor...  56.2    1e-06   Harpegnathos saltator
ref|XP_005865158.1|  PREDICTED: alanine aminotransferase 1            55.1    1e-06   Myotis brandtii
tpe|CBF85834.1|  TPA: alanine transaminase (Eurofung)                 56.2    1e-06   Aspergillus nidulans FGSC A4
ref|XP_010273809.1|  PREDICTED: alanine aminotransferase 2-like       56.2    1e-06   
ref|XP_006426797.1|  hypothetical protein CICLE_v10025334mg           56.2    1e-06   
ref|XP_005181202.1|  PREDICTED: alanine aminotransferase 1            56.2    1e-06   
ref|XP_008302267.1|  PREDICTED: alanine aminotransferase 1            56.2    1e-06   
ref|XP_008436808.1|  PREDICTED: alanine aminotransferase 1            56.2    1e-06   
ref|XP_006828619.1|  hypothetical protein AMTR_s00129p00079480        53.5    1e-06   
ref|XP_003425526.1|  PREDICTED: alanine aminotransferase 2            56.2    1e-06   
ref|XP_659527.1|  hypothetical protein AN1923.2                       55.8    1e-06   
ref|XP_002340696.1|  alanine aminotransferase, putative               56.2    1e-06   
emb|CAX73841.1|  1-aminocyclopropane-1-carboxylate synthase/ alan...  55.8    1e-06   
ref|XP_002639464.1|  Hypothetical protein CBG04059                    55.8    1e-06   
ref|XP_004212634.1|  PREDICTED: uncharacterized protein LOC101238311  55.5    1e-06   
ref|XP_010476874.1|  PREDICTED: alanine aminotransferase 1, mitoc...  55.8    1e-06   
ref|XP_010937250.1|  PREDICTED: alanine aminotransferase 2            55.8    1e-06   
ref|XP_002340697.1|  alanine aminotransferase, putative               55.8    1e-06   
ref|XP_006794722.1|  PREDICTED: alanine aminotransferase 2-like       55.8    1e-06   
gb|KHN77825.1|  Alanine aminotransferase 1                            55.8    1e-06   
dbj|BAC79866.1|  putative alanine aminotransferase                    55.8    1e-06   
gb|KDO53768.1|  hypothetical protein CISIN_1g009517mg                 55.5    1e-06   
ref|XP_005825112.1|  hypothetical protein GUITHDRAFT_77426            55.8    1e-06   
ref|XP_002463187.1|  hypothetical protein SORBIDRAFT_02g039340        55.8    1e-06   
ref|XP_004959833.1|  PREDICTED: alanine aminotransferase 2, mitoc...  55.8    2e-06   
ref|XP_002076705.1|  GD11952                                          54.7    2e-06   
ref|XP_005052721.1|  PREDICTED: alanine aminotransferase 2 isofor...  55.5    2e-06   
ref|XP_005526439.1|  PREDICTED: alanine aminotransferase 2 isofor...  55.5    2e-06   
ref|XP_003291733.1|  alanine transaminase                             55.5    2e-06   
dbj|BAO40163.1|  probable alanine aminotransferase                    55.5    2e-06   
dbj|BAP71656.1|  probable alanine aminotransferase                    55.5    2e-06   
ref|XP_001267930.1|  alanine aminotransferase, putative               55.5    2e-06   
ref|XP_008637027.1|  PREDICTED: alanine aminotransferase 2            55.5    2e-06   
ref|XP_006426798.1|  hypothetical protein CICLE_v10025334mg           55.5    2e-06   
ref|XP_002075264.1|  GK17070                                          55.5    2e-06   
ref|XP_002194653.1|  PREDICTED: alanine aminotransferase 2            55.5    2e-06   
gb|KFP06658.1|  Alanine aminotransferase 2                            55.5    2e-06   
gb|EGT35396.1|  hypothetical protein CAEBREN_11946                    55.5    2e-06   
gb|EGT33395.1|  hypothetical protein CAEBREN_19959                    55.5    2e-06   
gb|KFW64540.1|  Alanine aminotransferase 2                            55.5    2e-06   
ref|NP_001016805.1|  alanine aminotransferase 2                       55.5    2e-06   
ref|XP_007441689.1|  PREDICTED: alanine aminotransferase 2-like i...  55.5    2e-06   
gb|AAG51787.1|AC067754_3  alanine aminotransferase, putative, 3' ...  53.1    2e-06   
gb|KFQ95766.1|  Alanine aminotransferase 2                            55.5    2e-06   
gb|KJB57088.1|  hypothetical protein B456_009G147700                  55.5    2e-06   
ref|XP_007441688.1|  PREDICTED: alanine aminotransferase 2-like i...  55.5    2e-06   
gb|KFO63157.1|  Alanine aminotransferase 2                            55.5    2e-06   
ref|XP_010733467.1|  PREDICTED: alanine aminotransferase 1            55.5    2e-06   
ref|XP_007441690.1|  PREDICTED: alanine aminotransferase 2-like i...  55.5    2e-06   
gb|KDO53767.1|  hypothetical protein CISIN_1g009517mg                 55.5    2e-06   
gb|KFM05788.1|  Alanine aminotransferase 2                            55.5    2e-06   
gb|AIT69936.1|  alanine transaminase                                  55.1    2e-06   
emb|CDQ82436.1|  unnamed protein product                              55.5    2e-06   
ref|XP_008499534.1|  PREDICTED: alanine aminotransferase 2            55.1    2e-06   
ref|XP_006465804.1|  PREDICTED: alanine aminotransferase 2, mitoc...  55.5    2e-06   
ref|XP_009382959.1|  PREDICTED: alanine aminotransferase 2            55.5    2e-06   
ref|XP_007135364.1|  hypothetical protein PHAVU_010G123200g           55.5    2e-06   
ref|XP_009059448.1|  hypothetical protein LOTGIDRAFT_192553           55.1    2e-06   
ref|XP_007673116.1|  hypothetical protein BAUCODRAFT_63743            55.1    2e-06   
ref|XP_004227217.1|  PREDICTED: alanine aminotransferase 2            55.1    2e-06   
gb|EYC32542.1|  hypothetical protein Y032_0003g1641                   55.1    2e-06   
gb|KJB57090.1|  hypothetical protein B456_009G147700                  55.1    2e-06   
ref|XP_009798100.1|  PREDICTED: alanine aminotransferase 2-like       55.1    2e-06   
gb|KJB57091.1|  hypothetical protein B456_009G147700                  55.1    2e-06   
ref|XP_006559494.1|  PREDICTED: alanine aminotransferase 2-like       55.1    2e-06   
ref|XP_006121251.1|  PREDICTED: alanine aminotransferase 2            55.1    2e-06   
gb|AIT69942.1|  alanine transaminase                                  55.1    2e-06   
ref|XP_006110043.1|  PREDICTED: LOW QUALITY PROTEIN: glutamic-pyr...  55.1    2e-06   
gb|AIT69928.1|  alanine transaminase                                  55.1    2e-06   
gb|AGE89227.1|  mitochondrial alanine aminotransferase                52.4    2e-06   
gb|EMP35918.1|  Alanine aminotransferase 2                            55.1    2e-06   
ref|XP_006357426.1|  PREDICTED: alanine aminotransferase 2, mitoc...  55.1    2e-06   
ref|XP_003692587.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  55.1    2e-06   
ref|XP_005912151.1|  PREDICTED: alanine aminotransferase 2-like i...  55.1    2e-06   
ref|XP_004546617.1|  PREDICTED: alanine aminotransferase 2-like i...  55.1    2e-06   
ref|XP_005289905.1|  PREDICTED: alanine aminotransferase 2            55.1    2e-06   
ref|XP_005722569.1|  PREDICTED: alanine aminotransferase 2-like       55.1    2e-06   
gb|EXX69945.1|  alanine transaminase ALT1                             55.1    3e-06   
ref|XP_006607395.1|  PREDICTED: alanine aminotransferase 2-like i...  55.1    3e-06   
ref|XP_005912152.1|  PREDICTED: alanine aminotransferase 2-like i...  55.1    3e-06   
ref|XP_004546618.1|  PREDICTED: alanine aminotransferase 2-like i...  55.1    3e-06   
ref|XP_007059708.1|  PREDICTED: alanine aminotransferase 2            55.1    3e-06   
ref|XP_011430941.1|  PREDICTED: alanine aminotransferase 1-like       55.1    3e-06   
gb|ESA18192.1|  hypothetical protein GLOINDRAFT_334935                55.1    3e-06   
ref|XP_005471814.1|  PREDICTED: alanine aminotransferase 2-like i...  55.1    3e-06   
ref|XP_009783410.1|  PREDICTED: alanine aminotransferase 2, mitoc...  55.1    3e-06   
ref|XP_009627254.1|  PREDICTED: alanine aminotransferase 2-like       55.1    3e-06   
ref|XP_001978278.1|  GG17777                                          55.1    3e-06   
gb|EYU45916.1|  hypothetical protein MIMGU_mgv1a005454mg              54.7    3e-06   
gb|AIT69940.1|  alanine transaminase                                  54.7    3e-06   
ref|XP_003443544.1|  PREDICTED: alanine aminotransferase 2-like i...  54.7    3e-06   
ref|XP_008432758.1|  PREDICTED: alanine aminotransferase 2-like       55.1    3e-06   
gb|EYU21272.1|  hypothetical protein MIMGU_mgv1a003837mg              55.1    3e-06   
gb|AIT69937.1|  alanine transaminase                                  54.7    3e-06   
ref|XP_003055208.1|  predicted protein                                54.7    3e-06   
gb|AIT69918.1|  alanine transaminase                                  54.7    3e-06   
gb|EPR62539.1|  putative aminotransferase                             55.1    3e-06   
ref|XP_010685211.1|  PREDICTED: alanine aminotransferase 2            54.7    3e-06   
ref|XP_002365493.1|  aminotransferase, putative                       54.7    3e-06   
ref|XP_010896061.1|  PREDICTED: alanine aminotransferase 2            54.7    3e-06   
ref|XP_004241856.1|  PREDICTED: alanine aminotransferase 2-like       54.7    3e-06   
gb|AIT69917.1|  alanine transaminase                                  54.7    3e-06   
gb|EFZ12113.1|  hypothetical protein SINV_03790                       54.7    3e-06   
gb|EPS60556.1|  hypothetical protein M569_14246                       54.7    3e-06   
gb|EZF70245.1|  hypothetical protein H105_07420                       54.3    3e-06   
gb|AIT69920.1|  alanine transaminase                                  54.7    3e-06   
gb|KHG30536.1|  Alanine aminotransferase 2, mitochondrial -like p...  54.7    3e-06   
ref|XP_005105612.1|  PREDICTED: alanine aminotransferase 2-like       54.7    3e-06   
gb|ESS31825.1|  putative aminotransferase                             54.7    3e-06   
ref|XP_009606549.1|  PREDICTED: alanine aminotransferase 2            54.7    3e-06   
gb|EZF11507.1|  hypothetical protein H100_07427                       54.3    3e-06   
gb|ENN78579.1|  hypothetical protein YQE_04947                        54.7    3e-06   
gb|EKC33627.1|  Alanine aminotransferase 2                            54.7    3e-06   
ref|XP_007893251.1|  PREDICTED: alanine aminotransferase 1            54.7    3e-06   
ref|XP_008654837.1|  PREDICTED: uncharacterized protein LOC100193...  54.7    3e-06   
ref|XP_008887293.1|  aminotransferase, putative                       54.7    4e-06   
ref|XP_006634237.1|  PREDICTED: alanine aminotransferase 2-like       54.7    4e-06   
gb|KFO69634.1|  Alanine aminotransferase 2                            54.3    4e-06   
ref|XP_010459304.1|  PREDICTED: alanine aminotransferase 1, mitoc...  54.7    4e-06   
ref|XP_006369083.1|  alanine aminotransferas family protein           54.3    4e-06   
ref|XP_003022157.1|  hypothetical protein TRV_03717                   54.3    4e-06   
ref|XP_010884157.1|  PREDICTED: alanine aminotransferase 1 isofor...  54.3    4e-06   
ref|XP_750668.1|  alanine aminotransferase                            54.3    4e-06   
ref|XP_008460348.1|  PREDICTED: alanine aminotransferase 2, mitoc...  54.3    4e-06   
ref|XP_003010818.1|  hypothetical protein ARB_02969                   54.7    4e-06   
ref|XP_011260421.1|  PREDICTED: alanine aminotransferase 1            54.3    4e-06   
ref|XP_003238011.1|  alanine aminotransferase                         54.3    4e-06   
ref|XP_003724792.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  54.3    4e-06   
ref|XP_001257895.1|  alanine aminotransferase, putative               54.3    4e-06   
gb|EFN75006.1|  Alanine aminotransferase 2                            54.3    4e-06   
ref|XP_002970914.1|  hypothetical protein SELMODRAFT_94316            54.3    4e-06   
gb|EGE04493.1|  alanine aminotransferase                              54.3    4e-06   
ref|XP_006342897.1|  PREDICTED: alanine aminotransferase 2, mitoc...  54.3    4e-06   
gb|EGD96819.1|  alanine aminotransferase                              54.3    4e-06   
gb|EZF29412.1|  hypothetical protein H101_06912                       54.3    5e-06   
ref|XP_007024768.1|  Alanine aminotransferase 2                       54.3    5e-06   
ref|XP_010498073.1|  PREDICTED: alanine aminotransferase 1, mitoc...  54.3    5e-06   
ref|XP_011169171.1|  PREDICTED: alanine aminotransferase 2-like i...  54.3    5e-06   
emb|CAF97974.1|  unnamed protein product                              54.3    5e-06   
gb|AAP42511.1|  cytosolic alanine aminotransferase                    54.3    5e-06   
ref|XP_010471259.1|  PREDICTED: alanine aminotransferase 2, mitoc...  54.3    5e-06   
gb|ABC59812.1|  cytosolic alanine aminotransferase 2                  54.3    5e-06   
ref|XP_003177413.1|  alanine aminotransferase 2                       53.9    5e-06   
ref|XP_004235527.1|  PREDICTED: alanine aminotransferase 2-like       54.3    5e-06   
ref|XP_002969652.1|  hypothetical protein SELMODRAFT_91640            53.9    5e-06   
ref|XP_002133684.1|  GA22670                                          54.3    5e-06   
emb|CDW86217.1|  alanine aminotransferase 2                           53.9    5e-06   
ref|NP_001086104.1|  alanine aminotransferase 2                       53.9    5e-06   
ref|XP_003743224.1|  PREDICTED: alanine aminotransferase 2-like       54.3    5e-06   
gb|ERT01918.1|  hypothetical protein HMPREF1624_00213                 53.9    5e-06   
ref|NP_001077811.1|  alanine aminotransferase 2                       53.9    5e-06   
gb|KIH88204.1|  alanine transaminase                                  53.9    6e-06   
gb|AHW58021.1|  YLSs alanine aminotransferase                         53.9    6e-06   
ref|XP_001303059.1|  aminotransferase, classes I and II family pr...  53.9    6e-06   
ref|XP_002100462.1|  GE17071                                          53.9    6e-06   
gb|KFV72169.1|  Alanine aminotransferase 2                            53.9    6e-06   
ref|XP_010415979.1|  PREDICTED: alanine aminotransferase 2, mitoc...  53.9    6e-06   
gb|KFK41654.1|  hypothetical protein AALP_AA2G155600                  53.9    6e-06   
ref|NP_572879.2|  CG1640, isoform A                                   53.9    6e-06   
gb|AHW58022.1|  alanine aminotransferase 1                            53.9    6e-06   
gb|AIT69933.1|  alanine transaminase                                  53.9    6e-06   
ref|XP_010428116.1|  PREDICTED: alanine aminotransferase 2, mitoc...  53.9    6e-06   
gb|EJT41443.1|  ALT2-like protein                                     53.9    6e-06   
ref|XP_004200456.1|  Piso0_003043                                     53.9    6e-06   
ref|XP_007887603.1|  PREDICTED: alanine aminotransferase 2            53.9    6e-06   
ref|XP_008157904.1|  PREDICTED: alanine aminotransferase 1            53.9    6e-06   
ref|XP_009904992.1|  PREDICTED: alanine aminotransferase 2            53.9    6e-06   
gb|AAU09694.1|  YDR111C                                               53.9    6e-06   
ref|XP_004618719.1|  PREDICTED: alanine aminotransferase 1            53.9    6e-06   
gb|AAH61955.1|  Gpt2l protein                                         53.9    6e-06   
ref|NP_010396.1|  alanine transaminase ALT2                           53.9    6e-06   
gb|EWG97184.1|  Alt2p                                                 53.5    6e-06   
gb|EGA83515.1|  Alt2p                                                 53.9    6e-06   
gb|EDZ73134.1|  YDR111Cp-like protein                                 53.9    7e-06   
ref|XP_002887430.1|  ALAAT2                                           53.9    7e-06   
gb|AJP37834.1|  Alt2p                                                 53.9    7e-06   
gb|EEU09336.1|  Alt2p                                                 53.9    7e-06   
gb|EDN60454.1|  alanine transaminase                                  53.9    7e-06   
gb|EGA59376.1|  Alt2p                                                 53.5    7e-06   
sp|Q6NYL5.2|ALAT2_DANRE  RecName: Full=Alanine aminotransferase 2...  53.9    7e-06   
gb|AAL39959.1|  SD05601p                                              53.9    7e-06   
gb|AAK59591.2|  putative alanine aminotransferase                     53.9    7e-06   
ref|NP_727696.2|  CG1640, isoform B                                   53.9    7e-06   
dbj|GAM34311.1|  Alt1 homolog                                         53.5    7e-06   
emb|CDH09283.1|  probable alanine aminotransferase, mitochondrial     53.9    7e-06   
gb|KEQ94204.1|  hypothetical protein AUEXF2481DRAFT_41383             53.9    7e-06   
ref|NP_001185380.1|  alanine aminotransferase 2                       53.9    7e-06   
ref|XP_010096539.1|  Alanine aminotransferase 2                       53.5    7e-06   
emb|CAY81325.1|  Alt1p                                                53.9    7e-06   
ref|NP_013190.1|  alanine transaminase ALT1                           53.9    7e-06   
gb|EIW08706.1|  Alt1p                                                 53.9    7e-06   
ref|XP_002541681.1|  hypothetical protein UREG_01197                  53.5    7e-06   
ref|NP_565040.2|  alanine aminotransferase 2                          53.5    7e-06   
ref|XP_009495905.1|  alanine transaminase                             53.5    7e-06   
ref|XP_002009412.1|  GI15248                                          53.5    7e-06   
emb|CCK71261.1|  hypothetical protein KNAG_0G02040                    53.5    7e-06   
gb|EGA85809.1|  Alt1p                                                 53.5    7e-06   
gb|EGA61365.1|  Alt1p                                                 53.5    7e-06   
ref|XP_006300438.1|  hypothetical protein CARUB_v10020102mg           53.5    7e-06   
ref|XP_002106853.1|  GD17120                                          53.5    8e-06   
gb|EGA81832.1|  Alt1p                                                 53.5    8e-06   
sp|P34106.1|ALA2_PANMI  RecName: Full=Alanine aminotransferase 2;...  53.5    8e-06   
gb|EGA77892.1|  Alt1p                                                 53.5    8e-06   
ref|XP_002681562.1|  alanine aminotransferase                         53.5    8e-06   
ref|NP_001136246.1|  alanine aminotransferase 2-like                  53.5    8e-06   
ref|XP_005536985.1|  alanine aminotransferase                         53.5    8e-06   
gb|EGA57796.1|  Alt1p                                                 53.5    8e-06   
gb|KFZ02261.1|  hypothetical protein V501_09614                       53.5    8e-06   
ref|XP_008560719.1|  PREDICTED: alanine aminotransferase 1            53.5    8e-06   
ref|XP_008682329.1|  PREDICTED: alanine aminotransferase 1            51.6    8e-06   
ref|XP_004079476.1|  PREDICTED: alanine aminotransferase 2-like i...  53.5    8e-06   
ref|XP_011485336.1|  PREDICTED: alanine aminotransferase 2-like i...  53.5    8e-06   
ref|XP_001991951.1|  GH24493                                          53.5    8e-06   
gb|AET06148.1|  PLP-dependent aminotransferase                        53.5    8e-06   
gb|AIT69945.1|  alanine transaminase                                  53.5    8e-06   
ref|XP_001642896.1|  hypothetical protein Kpol_392p5                  53.5    8e-06   
gb|KGO40423.1|  Pyridoxal phosphate-dependent transferase, major ...  53.5    8e-06   
gb|KFY73380.1|  hypothetical protein V499_06550                       53.5    8e-06   
dbj|GAA97564.1|  hypothetical protein E5Q_04242                       53.5    8e-06   
ref|XP_008332649.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  53.5    9e-06   
ref|XP_003429759.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  53.5    9e-06   
ref|XP_005800010.1|  PREDICTED: alanine aminotransferase 2-like i...  53.5    9e-06   
gb|AAV64237.1|  putative alanine aminotransferase                     53.5    9e-06   
ref|XP_003078195.1|  putative Alanine aminotransferase (IC)           53.1    9e-06   



>gb|EPS68501.1| hypothetical protein M569_06265, partial [Genlisea aurea]
Length=481

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/56 (100%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  3    PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  58



>ref|XP_011071137.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Sesamum 
indicum]
Length=481

 Score =   118 bits (296),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 55/55 (100%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_009765091.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
sylvestris]
Length=481

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDY+NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYDNLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_009623844.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
tomentosiformis]
Length=481

 Score =   117 bits (294),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDY+NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYDNLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_009759837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_009624740.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625366.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_004228555.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
lycopersicum]
Length=473

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_006348507.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=476

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_011086618.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Sesamum indicum]
Length=478

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/55 (100%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_004239121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Solanum 
lycopersicum]
Length=481

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/55 (100%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>emb|CDY25781.1| BnaA07g10010D [Brassica napus]
Length=58

 Score =   108 bits (271),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFP 
Sbjct  3    LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPH  57



>ref|XP_006357614.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=481

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/55 (100%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>gb|AFK37995.1| unknown [Lotus japonicus]
Length=83

 Score =   109 bits (273),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYVSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>gb|EYU28421.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
 gb|EYU28422.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
Length=480

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/55 (98%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            +DYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    MDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  59



>emb|CDP13207.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYENLN+NVK+CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYENLNKNVKECQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_010498838.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498839.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498840.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   115 bits (288),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 53/55 (96%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_010552672.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Tarenaya 
hassleriana]
Length=481

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/55 (98%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_010460118.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   115 bits (287),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 53/55 (96%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_006416098.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34451.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=357

 Score =   114 bits (285),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  3    LDYDALNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  57



>ref|XP_006307377.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
 gb|EOA40275.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
Length=481

 Score =   115 bits (287),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>dbj|BAH20108.1| AT1G70580 [Arabidopsis thaliana]
Length=481

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_006390865.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390866.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390867.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390868.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28151.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28152.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28153.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28154.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
Length=481

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|NP_177215.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_974122.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031262.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031263.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9S7E9.1|GGT2_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 2; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT2; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT2; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis 
thaliana]
 gb|AAG52344.1|AC011663_23 putative alanine aminotransferase; 91367-88744 [Arabidopsis thaliana]
 gb|AAG52480.1|AC010796_19 putative alanine aminotransferase; 63135-65758 [Arabidopsis thaliana]
 gb|AAN62333.1|AF479640_1 glutamate:glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AAK59635.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AAL34156.1| putative alanine aminotransferase [Arabidopsis thaliana]
 dbj|BAH19506.1| AT1G70580 [Arabidopsis thaliana]
 gb|AEE35082.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35083.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35084.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35085.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
Length=481

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_002887312.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63571.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=482

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_009115544.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
 emb|CDY44130.1| BnaA09g31220D [Brassica napus]
 emb|CDY04729.1| BnaC05g18600D [Brassica napus]
Length=478

 Score =   114 bits (285),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/55 (96%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            L+YE+LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  3    LEYESLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  57



>ref|XP_010477627.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Camelina 
sativa]
Length=481

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|NP_001031083.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19579.1| AT1G23310 [Arabidopsis thaliana]
 gb|AEE30371.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=441

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_002893277.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69536.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=481

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>gb|AAK25905.1|AF360195_1 putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_006658210.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Oryza 
brachyantha]
Length=494

 Score =   114 bits (284),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 54/56 (96%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  15   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  70



>gb|AAL24255.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAO11559.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
Length=481

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|NP_564192.2| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q9LR30.1|GGT1_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 1; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT1; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT1; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis 
thaliana]
 gb|AAF87015.1|AC005292_24 F26F24.16 [Arabidopsis thaliana]
 gb|AAN62332.1|AF479639_1 glutamate:glyoxylate aminotransferase 1 [Arabidopsis thaliana]
 gb|AAL08235.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAN12918.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AEE30370.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_010682426.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682427.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/55 (98%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYELLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_010471056.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   113 bits (282),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_006416099.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416100.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416101.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34452.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34453.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34454.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=478

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  3    LDYDALNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  57



>ref|XP_004955317.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X2 [Setaria italica]
Length=478

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_006300456.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
 gb|EOA33354.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
Length=481

 Score =   113 bits (282),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>emb|CDY61225.1| BnaC06g43710D [Brassica napus]
Length=481

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_010427837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Camelina 
sativa]
Length=479

 Score =   113 bits (282),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_010415743.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   113 bits (282),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|NP_001151209.1| alanine aminotransferase 2 [Zea mays]
 gb|ACG41981.1| alanine aminotransferase 2 [Zea mays]
Length=478

 Score =   112 bits (281),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE LNENVK+ QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYEELNENVKRVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>emb|CDY66294.1| BnaAnng22050D [Brassica napus]
Length=481

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_009105727.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Brassica rapa]
Length=481

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|NP_001058716.1| Os07g0108300 [Oryza sativa Japonica Group]
 dbj|BAD30627.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF20630.1| Os07g0108300 [Oryza sativa Japonica Group]
 gb|EAZ02507.1| hypothetical protein OsI_24612 [Oryza sativa Indica Group]
 gb|EAZ38438.1| hypothetical protein OsJ_22816 [Oryza sativa Japonica Group]
 dbj|BAG90568.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  12   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  67



>ref|XP_004309987.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457416.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   112 bits (281),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>gb|AAO84040.1| alanine aminotransferase [Oryza sativa Indica Group]
Length=484

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  11   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  66



>ref|XP_002312679.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
 gb|EEE90046.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
Length=481

 Score =   112 bits (281),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_009105726.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Brassica rapa]
Length=509

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>gb|KDP26646.1| hypothetical protein JCGZ_17804 [Jatropha curcas]
Length=481

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE+LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYESLNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPR  60



>emb|CDY12474.1| BnaC07g13140D [Brassica napus]
Length=537

 Score =   113 bits (282),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 52/55 (95%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  68   LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  122



>ref|XP_008340115.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
 ref|XP_008340116.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
Length=481

 Score =   112 bits (280),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_002527918.1| alanine aminotransferase, putative [Ricinus communis]
 gb|EEF34475.1| alanine aminotransferase, putative [Ricinus communis]
Length=452

 Score =   112 bits (279),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPR
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPR  60



>ref|XP_008447004.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=334

 Score =   111 bits (277),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_004955316.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X1 [Setaria italica]
Length=539

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_009103182.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
Length=478

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  3    LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  57



>ref|XP_004489787.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Cicer arietinum]
Length=481

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_003613139.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96097.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=481

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_004489786.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_006378236.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|ERP56033.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=335

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>gb|AAM61453.1| putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   111 bits (278),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/55 (95%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVK CQYAVRGELYLRASELQKE KKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKECKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_009406515.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406516.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_003613140.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96098.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=474

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_008446998.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
melo]
Length=234

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE++NE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESINETVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_002315675.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|EEF01846.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=481

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_011014669.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Populus euphratica]
 ref|XP_011014670.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Populus euphratica]
Length=481

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_009359228.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Pyrus x 
bretschneideri]
Length=481

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_010100388.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
 gb|EXB82522.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
Length=481

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESINENVKKTQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_003557680.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Brachypodium 
distachyon]
Length=479

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/55 (95%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPR
Sbjct  7    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPR  61



>ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
Length=460

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_010023477.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
 ref|XP_010023478.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
Length=481

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_010927963.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Elaeis guineensis]
Length=481

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>emb|CBI23368.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>gb|AAZ43368.1| AlaT1 [Vitis labrusca]
Length=477

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_009413361.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413362.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera]
Length=481

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_006840828.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
 gb|ERN02503.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
Length=481

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYESLNENVKKSVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|NP_001268094.1| uncharacterized protein LOC100261274 [Vitis vinifera]
 gb|AAZ43369.1| AlaT1 [Vitis vinifera]
Length=484

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>gb|KDO82251.1| hypothetical protein CISIN_1g041151mg [Citrus sinensis]
Length=463

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPR
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPR  60



>gb|EMS58349.1| Alanine aminotransferase 2 [Triticum urartu]
Length=478

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/55 (95%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_004155366.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Cucumis sativus]
Length=481

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>gb|KGN51767.1| hypothetical protein Csa_5G598750 [Cucumis sativus]
Length=474

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_010251104.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251105.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251106.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
Length=481

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE++NENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYESINENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_008221924.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221925.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221927.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
Length=481

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKK+IFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKVIFTNVGNPHALGQKPLTFPR  60



>gb|KGN51765.1| hypothetical protein Csa_5G598730 [Cucumis sativus]
Length=481

 Score =   110 bits (275),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_006438274.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438275.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438276.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438277.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438278.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006483938.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483939.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483940.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X3 [Citrus sinensis]
 gb|ESR51514.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51515.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51516.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51517.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51518.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=481

 Score =   110 bits (275),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPR
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPR  60



>emb|CDY41452.1| BnaA08g20540D [Brassica napus]
Length=478

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            L+Y+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  3    LEYDLLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  57



>ref|XP_009110107.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Brassica 
rapa]
Length=478

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            L+Y+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  3    LEYDLLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  57



>gb|KHG15331.1| Glutamate--glyoxylate aminotransferase 2 -like protein [Gossypium 
arboreum]
Length=481

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_008789746.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
 ref|XP_008789747.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
Length=481

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE+LNENVKK  YAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRAAELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_006438273.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51513.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=398

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPR
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPR  60



>ref|NP_001183048.1| uncharacterized protein LOC100501386 [Zea mays]
 gb|ACR35540.1| unknown [Zea mays]
Length=479

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            P+DYE LNE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  61



>ref|XP_008444367.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=473

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE++NEN+KK +YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  5    PLDYESINENMKKVEYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_007222799.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
 gb|EMJ23998.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
Length=481

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPR
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPR  60



>ref|XP_002968244.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
 ref|XP_002976136.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ23041.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ30498.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
Length=481

 Score =   109 bits (273),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 51/55 (93%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LD +N+NENVKKC YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDPDNINENVKKCVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|XP_007044762.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044763.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044764.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00594.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00595.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00596.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
Length=481

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LD+E+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDHESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>gb|EMT29455.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=523

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPR  60



>tpg|DAA42656.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
 tpg|DAA42657.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
Length=483

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            P+DYE LNE VKK QYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPR  61



>tpg|DAA42658.1| TPA: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Zea mays]
Length=479

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            P+DYE LNE VKK QYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPR  61



>ref|XP_008389735.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Malus 
domestica]
Length=481

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE+LNE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  6    LDYESLNEKVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  60



>ref|NP_001237581.1| alanine aminotransferase 3 [Glycine max]
 gb|ABW17198.1| alanine aminotransferase 3 [Glycine max]
Length=480

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPR
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPR  60



>ref|XP_003519649.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
2 [Glycine max]
 gb|KHN00386.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPR
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPR  60



>ref|NP_001237567.1| alanine aminotransferase 2 [Glycine max]
 gb|ABW17197.1| alanine aminotransferase 2 [Glycine max]
Length=481

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPR
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPR  60



>gb|KHN14541.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPR
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPR  60



>gb|KJB31174.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=395

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNP ALGQKPLTFPR
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQKPLTFPR  60



>ref|XP_010928898.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
 ref|XP_010928907.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
Length=481

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE+LNENVKK  YAVRGELY RASELQKEGKKIIFT+VGNPHALGQKPL+FPR
Sbjct  5    PLDYESLNENVKKVAYAVRGELYFRASELQKEGKKIIFTDVGNPHALGQKPLSFPR  60



>gb|KJB31170.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31171.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31172.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31173.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=481

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNP ALGQKPLTFPR
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQKPLTFPR  60



>gb|AET06145.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=480

 Score =   107 bits (266),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 50/55 (91%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LD+E LNENVK  QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPR
Sbjct  5    LDHETLNENVKNVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPR  59



>ref|XP_007158412.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
 gb|ESW30406.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
Length=481

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLD+  +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPR
Sbjct  5    PLDHALINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPR  60



>ref|XP_001782822.1| predicted protein [Physcomitrella patens]
 gb|EDQ52399.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            +D ENLNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  7    MDPENLNENVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  61



>gb|ABK25444.1| unknown [Picea sitchensis]
 gb|ABR16321.1| unknown [Picea sitchensis]
 gb|ABR17158.1| unknown [Picea sitchensis]
 gb|ACN40300.1| unknown [Picea sitchensis]
Length=480

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PLDYE +NENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNP ALGQ+PLTFPR
Sbjct  5    PLDYECINENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQRPLTFPR  60



>ref|XP_001777071.1| predicted protein [Physcomitrella patens]
 gb|EDQ58064.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            +D +NLNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  7    MDPDNLNENVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  61



>ref|XP_004142968.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 ref|XP_004161062.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 gb|KGN62316.1| hypothetical protein Csa_2G349020 [Cucumis sativus]
Length=473

 Score =   104 bits (260),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LDYE++NEN+KK +YAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQ PLTFPR
Sbjct  6    LDYESINENMKKVEYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQMPLTFPR  60



>ref|XP_001763950.1| predicted protein [Physcomitrella patens]
 gb|EDQ71354.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   103 bits (258),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/55 (91%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            +D ENLN NVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  7    MDPENLNLNVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  61



>emb|CAO02585.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02586.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02587.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02588.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02589.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02590.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02591.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02592.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02593.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02594.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02595.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02596.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02597.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02598.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02599.1| alanine amino-transferase, partial [Medicago truncatula var. 
longiaculeata]
 emb|CAO02600.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02601.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02602.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02603.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02604.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02605.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02606.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02607.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02608.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02609.1| alanine amino-transferase [Medicago tornata]
 emb|CAO02610.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02611.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02612.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02613.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02614.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02615.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
Length=48

 Score = 95.1 bits (235),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  190  ENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            E VKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  1    EXVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPR  48



>gb|KJB31175.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=495

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 51/69 (74%), Positives = 52/69 (75%), Gaps = 14/69 (20%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------------IIFTNVGNPHAL  306
            LDYE +NENVKK QYAVRGELYLRASELQKEGKK              IIFTNVGNP AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKYMKSTVCWGSMHFHIIFTNVGNPQAL  65

Query  307  GQKPLTFPR  333
            GQKPLTFPR
Sbjct  66   GQKPLTFPR  74



>ref|XP_002947519.1| alanine aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ51567.1| alanine aminotransferase [Volvox carteri f. nagariensis]
Length=522

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTFPR
Sbjct  60   LNENVMKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFPR  109



>gb|AAB01685.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTF R
Sbjct  59   LNENVVKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFTR  108



>ref|XP_001698518.1| alanine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP08011.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTF R
Sbjct  59   LNENVVKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFTR  108



>ref|XP_005651940.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE27396.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=523

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LNEN+ + +YAVRGELYLR  EL+K+GK+IIFTNVGNPH LGQKPLTF R
Sbjct  62   LNENLVRAEYAVRGELYLRGEELRKQGKEIIFTNVGNPHVLGQKPLTFNR  111



>emb|CBJ25743.1| nicotinanamine aminotransferase A [Ectocarpus siliculosus]
Length=490

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            L Y+ + E VK CQYAVRGE+YL A+E  K GK++IFTNVGNPH LGQKPLTF R
Sbjct  9    LTYDTIAECVKDCQYAVRGEIYLAATERIKAGKEVIFTNVGNPHGLGQKPLTFLR  63



>gb|KIZ04988.1| alanine transaminase [Monoraphidium neglectum]
Length=242

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LNEN++K QYAVRGELYL+A EL+  GK IIFTNVGNPH LG KP+TF R
Sbjct  58   LNENMRKTQYAVRGELYLKAEELKNAGKPIIFTNVGNPHNLGAKPITFTR  107



>gb|EWM24220.1| alanine-2-oxoglutarate aminotransferase 2 [Nannochloropsis gaditana]
Length=593

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            L+Y++L ++VK C+YAVRGELY  A+E    GK++IFTNVGNPH LGQKP+TF R
Sbjct  52   LNYDSLPDHVKHCEYAVRGELYRAATERVAAGKEVIFTNVGNPHGLGQKPITFIR  106



>gb|KIY95165.1| alanine transaminase [Monoraphidium neglectum]
Length=227

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            +N N+ K QYAVRGELYLRA ++++EG+ IIFTN+GNPH LG +P TF R
Sbjct  77   INPNILKTQYAVRGELYLRADKMRREGRDIIFTNIGNPHNLGAQPKTFTR  126



>ref|XP_005847240.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
 gb|EFN55138.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
Length=529

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LNE++ K +YAVRGELY +A ELQK+G+++IFTNVGNP  LGQ+P+TF R
Sbjct  67   LNEDLLKAEYAVRGELYNKAMELQKQGRELIFTNVGNPQQLGQQPITFNR  116



>gb|KIZ07569.1| alanine transaminase [Monoraphidium neglectum]
Length=621

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            +N N+ K QYAVRGELYL+A E+++ G+ +IFTN+GNPH LG KP TF R
Sbjct  116  VNPNIIKTQYAVRGELYLKAEEMRRAGRDVIFTNIGNPHNLGAKPKTFTR  165



>ref|XP_011398130.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25238.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
Length=487

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            LN+N+ K QYAVRGELY RA EL K G ++I+TN+GNP  LGQ+PL F R
Sbjct  24   LNDNILKTQYAVRGELYTRAQELAKSGGEVIYTNIGNPQQLGQEPLVFNR  73



>gb|EJK50290.1| hypothetical protein THAOC_30762 [Thalassiosira oceanica]
Length=570

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            +++N+++ QYAVRGE+ ++A  + K+GKKII+TN+GNPHA+GQKP+T+ R
Sbjct  118  MSQNLRRMQYAVRGEVVIKADAMAKKGKKIIYTNIGNPHAVGQKPITYYR  167



>gb|KDD76740.1| aminotransferase [Helicosporidium sp. ATCC 50920]
Length=485

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            +N  + K +YAVRGELY RA EL  +G++II+TNVGNPH LG KPLTF R
Sbjct  24   MNPAILKAEYAVRGELYNRAMELAAQGREIIYTNVGNPHQLGGKPLTFNR  73



>ref|XP_002176328.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC42720.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=464

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            +++++++ QYAVRGE+ L+A +L  EG+KI +TNVGNPHA+GQ+P+TF R
Sbjct  1    MSQSLRRMQYAVRGEVVLKADKLAAEGRKITYTNVGNPHAVGQQPITFYR  50



>ref|XP_009041360.1| hypothetical protein AURANDRAFT_67623 [Aureococcus anophagefferens]
 gb|EGB03935.1| hypothetical protein AURANDRAFT_67623 [Aureococcus anophagefferens]
Length=1156

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 47/59 (80%), Gaps = 4/59 (7%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEG----KKIIFTNVGNPHALGQKPLTFPR  333
            ++  N+++ ++K QYAVRGE+ ++A  L++EG    K+I++TNVGNPH++GQKPLTF R
Sbjct  146  INASNMSQALRKMQYAVRGEVVMKADALEQEGREQRKEILYTNVGNPHSVGQKPLTFFR  204



>gb|ACF86318.1| unknown [Zea mays]
Length=72

 Score = 64.7 bits (156),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  332  RGKVRGFCPRAWGLPTFVKMIFFPSF*SSEARRYSSPLTAY  210
            RGKV GF PRA GLPT VKMIF PSF SSEARRYSSP TAY
Sbjct  21   RGKVSGFWPRACGLPTLVKMIFLPSFCSSEARRYSSPRTAY  61



>gb|EJK48082.1| hypothetical protein THAOC_33157 [Thalassiosira oceanica]
Length=613

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            + +++++++ QYAVRGE+ + A EL+ EG++IIFTNVGNPHA+GQK +T+ R
Sbjct  127  DTMSQSLRRMQYAVRGEVVMLAEELKAEGREIIFTNVGNPHAVGQKCITYYR  178



>dbj|BAQ21243.1| hypothetical protein, partial [Ostrinia furnacalis]
Length=109

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  324
            L+ +NLN NV K +YAVRG L +RA+E++KE         KK+I  N+G+ HA+GQ+P+T
Sbjct  46   LNADNLNPNVLKLEYAVRGPLVIRAAEIEKELQKGAQKPFKKVIRANIGDAHAMGQQPIT  105

Query  325  FPR  333
            F R
Sbjct  106  FIR  108



>ref|XP_002289904.1| alanine aminotransferase [Thalassiosira pseudonana CCMP1335]
 gb|EED93441.1| alanine aminotransferase [Thalassiosira pseudonana CCMP1335]
Length=444

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            QYAVRGE+ +RA  +  EG+KII+TN+GNPHA+GQKP+T+ R
Sbjct  2    QYAVRGEVVIRADAMAAEGRKIIYTNIGNPHAVGQKPITYYR  43



>gb|AGT60040.1| aminotransferase [uncultured bacterium]
Length=462

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            + + NLN+ +   +YAVRG++  RA EL+K GKKI + N+GNPHA  QKPL++ R
Sbjct  2    ITFNNLNQKLIDAEYAVRGKIVTRAQELEKTGKKITYCNIGNPHAFAQKPLSYVR  56



>ref|XP_001745052.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90285.1| predicted protein [Monosiga brevicollis MX1]
Length=480

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            +N NV    YAVRG++Y  A + + EGKK+I TNVGNPH+LGQ  +TFPR
Sbjct  13   INANVLAATYAVRGKIYEMAMQRKAEGKKVILTNVGNPHSLGQPAITFPR  62



>ref|XP_004992298.1| alanine aminotransferase [Salpingoeca rosetta]
 gb|EGD75245.1| alanine aminotransferase [Salpingoeca rosetta]
Length=481

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            +N+ V    YAVRG +Y+ A + +  GK++IFTN+GNP +LGQKP+TFPR
Sbjct  16   INQFVIASHYAVRGTIYIEAQKRKASGKEVIFTNIGNPQSLGQKPITFPR  65



>ref|WP_026853156.1| aminotransferase class I/II [Geothrix fermentans]
Length=451

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  181  NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            +L + V + +YAVRG +  RA+EL+K+G++II+ N+GNP +LGQKPLT+ R
Sbjct  7    DLGKAVLETEYAVRGPIVARAAELEKQGREIIYCNIGNPQSLGQKPLTWNR  57



>ref|XP_003646187.1| hypothetical protein Ecym_4307 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET39370.1| hypothetical protein Ecym_4307 [Eremothecium cymbalariae DBVPG#7215]
Length=534

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            PL  E+LN NV + +YAVRG++  RA EL+++          KKII+ N+GNP  LGQKP
Sbjct  55   PLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKP  114

Query  319  LTFPR  333
            L+F R
Sbjct  115  LSFSR  119



>ref|XP_005766369.1| hypothetical protein EMIHUDRAFT_256711, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD13940.1| hypothetical protein EMIHUDRAFT_256711, partial [Emiliania huxleyi 
CCMP1516]
Length=162

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PL  EN+N  +   +YAVRG L  RA EL+  G++ +  N+GNP ALGQ+PL++ R
Sbjct  23   PLTPENINPRLVAAEYAVRGRLLDRAKELESVGRRTVKCNIGNPQALGQRPLSWVR  78



>ref|XP_010783831.1| PREDICTED: alanine aminotransferase 1-like [Notothenia coriiceps]
Length=85

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPLT  324
            L  EN+N NV+K +YAVRG +  RA +++KE K        ++I  N+G+ HA+GQKP+T
Sbjct  14   LTLENMNPNVRKVEYAVRGAIVQRAVQIEKELKEGVKKPFTEVIKANIGDAHAMGQKPIT  73

Query  325  FPR  333
            F R
Sbjct  74   FFR  76



>ref|WP_012096788.1| aminotransferase class I/II [Anaeromyxobacter sp. Fw109-5]
 gb|ABS26209.1| aminotransferase class I and II [Anaeromyxobacter sp. Fw109-5]
Length=457

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            E++   V++ QYAVRG +  RA EL+++G+++I+ N+GNP +LGQ+PL++ R
Sbjct  6    EDVAPVVREAQYAVRGPIVARAQELERQGREVIYCNIGNPQSLGQRPLSWVR  57



>ref|XP_008797360.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+  E +N  VKKC+YAVRGE+   A  LQ+E          ++I++ N+GNP ALGQ+P
Sbjct  52   PITVETINPKVKKCEYAVRGEIVSHAQRLQQELQTKPRSHPFEEILYCNIGNPQALGQQP  111

Query  319  LTFPR  333
            +TF R
Sbjct  112  ITFFR  116



>ref|XP_010917381.1| PREDICTED: alanine aminotransferase 2-like isoform X4 [Elaeis 
guineensis]
Length=470

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  319  LTFPR  333
            +TF R
Sbjct  112  ITFFR  116



>ref|XP_010917379.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Elaeis 
guineensis]
Length=516

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  319  LTFPR  333
            +TF R
Sbjct  112  ITFFR  116



>ref|XP_010917380.1| PREDICTED: alanine aminotransferase 2-like isoform X3 [Elaeis 
guineensis]
Length=488

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  319  LTFPR  333
            +TF R
Sbjct  112  ITFFR  116



>ref|XP_010261672.1| PREDICTED: alanine aminotransferase 2-like [Nelumbo nucifera]
Length=528

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  E LN  V KCQYAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  50   PVTAETLNPKVLKCQYAVRGEIVTHAQRLQQELQSKPSSHPFNEILYCNIGNPQSLGQQP  109

Query  319  LTFPR  333
            +TF R
Sbjct  110  ITFFR  114



>ref|XP_005790253.1| alanine aminotransferase [Emiliania huxleyi CCMP1516]
 gb|EOD37824.1| alanine aminotransferase [Emiliania huxleyi CCMP1516]
Length=526

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            PL  EN+N  +   +YAVRG L  RA EL+  G++ +  N+GNP ALGQ+PL++ R
Sbjct  23   PLTPENINPRLVAAEYAVRGRLLDRAKELESVGRRTVKCNIGNPQALGQRPLSWVR  78



>ref|XP_010917378.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Elaeis 
guineensis]
Length=534

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  319  LTFPR  333
            +TF R
Sbjct  112  ITFFR  116



>ref|XP_004924185.1| PREDICTED: alanine aminotransferase 2-like [Bombyx mori]
Length=516

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  324
            L  EN+N N+ K +YAVRG L +RA E++KE         K++I  N+G+ HA+GQKP+T
Sbjct  42   LTVENMNPNIVKLEYAVRGPLVIRAGEIEKELEKGAQKPFKRVIKANIGDAHAMGQKPIT  101

Query  325  FPR  333
            F R
Sbjct  102  FIR  104



>ref|XP_010939848.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Elaeis guineensis]
Length=518

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            PL ++++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  40   PLTFDSINPKVLKCEYAVRGEIVSHAQRLQQELQTKPGSYPFDEILYCNIGNPQSLGQQP  99

Query  319  LTFPR  333
            +TF R
Sbjct  100  VTFFR  104



>ref|WP_005033524.1| aminotransferase class I/II [Holophaga foetida]
Length=451

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  333
            +  ++L + V + QYAVRG +  +A ++++EG++II+ N+GNP AL QKPLT+ R
Sbjct  3    MQLKDLGKAVLETQYAVRGPIVAKAQDMEREGREIIYCNIGNPQALEQKPLTYLR  57



>ref|XP_003627448.1| Alanine aminotransferase [Medicago truncatula]
 gb|AET01924.1| alanine aminotransferase [Medicago truncatula]
Length=524

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KCQYAVRGE+   A  LQK  +         +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  319  LTFPR  333
            +TF R
Sbjct  106  ITFFR  110



>ref|XP_002304255.2| hypothetical protein POPTR_0003s07020g [Populus trichocarpa]
 gb|EEE79234.2| hypothetical protein POPTR_0003s07020g [Populus trichocarpa]
Length=481

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  3    PVSLDNINPKVLKCEYAVRGEIVTLAQALQEELKSKPGSHPFDEILYCNIGNPQSLGQQP  62

Query  319  LTFPR  333
            +TF R
Sbjct  63   ITFFR  67



>gb|AFK39904.1| unknown [Medicago truncatula]
Length=524

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KCQYAVRGE+   A  LQK  +         +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  319  LTFPR  333
            +TF R
Sbjct  106  ITFFR  110



>emb|CEF68484.1| Alanine aminotransferase 1 [Strongyloides ratti]
Length=481

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  324
            L+ +NLN NVK  QYAVRG L +RA +++KE         K +I  N+G+ HA+GQKP+T
Sbjct  7    LNLDNLNPNVKTMQYAVRGPLPIRAVQIEKELASGVVKPFKNVIKANIGDAHAMGQKPIT  66

Query  325  FPR  333
            F R
Sbjct  67   FIR  69



>gb|ACJ85860.1| unknown [Medicago truncatula]
Length=524

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KCQYAVRGE+   A  LQK  +         +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  319  LTFPR  333
            +TF R
Sbjct  106  ITFFR  110



>ref|XP_008380735.1| PREDICTED: alanine aminotransferase 2 [Malus domestica]
Length=543

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  65   PVTLQNINPKVLKCEYAVRGEIVTLAQRLQEELKANPGSHPFDEILYCNIGNPQSLGQQP  124

Query  319  LTFPR  333
            +TF R
Sbjct  125  ITFFR  129



>ref|XP_004510570.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cicer 
arietinum]
Length=531

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V +CQYAVRGE+   A  LQK+ +         +II+ N+GNP +LGQ+P
Sbjct  53   PVTAQNINPQVLQCQYAVRGEIVTLAQNLQKDLQANPGSHSFDEIIYCNIGNPQSLGQQP  112

Query  319  LTFPR  333
            +TF R
Sbjct  113  ITFFR  117



>ref|XP_005648726.1| alanine aminotransferase 2 [Coccomyxa subellipsoidea C-169]
 gb|EIE24182.1| alanine aminotransferase 2 [Coccomyxa subellipsoidea C-169]
Length=505

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 8/64 (13%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPL  321
            PL  EN+N  V K QYAVRGE+ +RA EL+ +          KI++ N+GNP  LGQ P+
Sbjct  19   PLALENINPKVVKAQYAVRGEIVIRAKELEDKLHAGEKLPFDKILYCNIGNPQQLGQHPV  78

Query  322  TFPR  333
            TF R
Sbjct  79   TFYR  82



>gb|EHJ74142.1| putative alanine aminotransferase [Danaus plexippus]
Length=513

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 8/60 (13%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLTFPR  333
            ENLN N+ K +YAVRG L +RA E++KE         +K+I  N+G+ HA+GQ+P+TF R
Sbjct  43   ENLNPNIIKLEYAVRGPLVIRAGEIEKELEKGASKPFQKVIRANIGDAHAMGQRPITFIR  102



>gb|KFH67262.1| alanine transaminase [Mortierella verticillata NRRL 6337]
Length=540

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  324
            L  +N+NE V+K +YAVRGEL +R+ EL+ E         K+++  N+GNP AL QKP+T
Sbjct  62   LTSKNMNEQVRKAEYAVRGELAIRSEELKNELAKGVKLPFKRVVGCNIGNPQALDQKPIT  121

Query  325  FPR  333
            F R
Sbjct  122  FFR  124



>ref|XP_006657960.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Oryza 
brachyantha]
Length=491

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  13   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPESLPFDEILYCNIGNPQSLGQQP  72

Query  319  LTFPR  333
            +TF R
Sbjct  73   VTFFR  77



>ref|XP_008783332.1| PREDICTED: alanine aminotransferase 2 [Phoenix dactylifera]
Length=526

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+ ++++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  48   PVTFDSINPKVLKCEYAVRGEIVSHAQRLQQELQTKPGSRPFDEILYCNIGNPQSLGQQP  107

Query  319  LTFPR  333
            +TF R
Sbjct  108  ITFFR  112



>gb|EEE67593.1| hypothetical protein OsJ_25140 [Oryza sativa Japonica Group]
Length=546

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  68   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPDSLPFDEILYCNIGNPQSLGQQP  127

Query  319  LTFPR  333
            +TF R
Sbjct  128  VTFFR  132



>gb|EEC82447.1| hypothetical protein OsI_26881 [Oryza sativa Indica Group]
Length=546

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  68   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPDSLPFDEILYCNIGNPQSLGQQP  127

Query  319  LTFPR  333
            +TF R
Sbjct  128  VTFFR  132



>gb|KFV83100.1| Alanine aminotransferase 2, partial [Struthio camelus australis]
Length=501

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 5/60 (8%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFT-----NVGNPHALGQKPLTFPR  333
            L  E++N  VK  +YAVRG + L+A E++KEG K  FT     N+G+ HA+GQ+P+TF R
Sbjct  29   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKEGIKKPFTEVIKANIGDAHAMGQRPITFLR  88



>ref|XP_002532946.1| alanine transaminase, putative [Ricinus communis]
 gb|EEF29430.1| alanine transaminase, putative [Ricinus communis]
Length=170

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            PL    +N  V +C+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  56   PLSLNTINPKVLECEYAVRGEIVTIAQRLQEELKTNPGSHPFDEILYCNIGNPQSLGQQP  115

Query  319  LTFPR  333
            +TF R
Sbjct  116  ITFFR  120



>tpg|DAA63614.1| TPA: hypothetical protein ZEAMMB73_898222, partial [Zea mays]
Length=175

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+    +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  63   PVSVATINPKVLKCEYAVRGEIVTHAQNLQQELQKNPESLPFDEILYCNIGNPQSLGQQP  122

Query  319  LTFPR  333
            +T+ R
Sbjct  123  VTYFR  127



>ref|XP_002112002.1| hypothetical protein TRIADDRAFT_50189 [Trichoplax adhaerens]
 gb|EDV25969.1| hypothetical protein TRIADDRAFT_50189 [Trichoplax adhaerens]
Length=469

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 8/58 (14%)
 Frame = +1

Query  184  LNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLTFPR  333
            +N+N+ K +YAVRG L +RA EL +E K+        IIF N+G+PHA+GQ+P TF R
Sbjct  1    MNQNIVKMEYAVRGILPIRAMELARELKQGVKKPFDSIIFANIGDPHAMGQQPTTFFR  58



>ref|XP_008305774.1| PREDICTED: alanine aminotransferase 1 [Cynoglossus semilaevis]
Length=491

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPLT  324
            L  +N+N  VK+ +YAVRG +YLRA E++KE K        ++I  N+G+ HA+GQ+P+T
Sbjct  16   LTLDNMNPFVKRVEYAVRGPIYLRAVEIEKELKEGVKKPFTEVIKANIGDAHAMGQQPIT  75

Query  325  FPR  333
            F R
Sbjct  76   FFR  78



>ref|XP_011079322.1| PREDICTED: alanine aminotransferase 2-like [Sesamum indicum]
Length=542

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            PL  + +N  V +C+YAVRGE+ + A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  64   PLTLDTINPKVLECEYAVRGEIVILAQRLQEELKNNPNAHPFDEILYCNIGNPQSLGQQP  123

Query  319  LTFPR  333
            +TF R
Sbjct  124  ITFFR  128



>ref|XP_011048627.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Populus 
euphratica]
Length=481

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  + +N  V KCQYAVRGE+   A  +Q+E K         +I++ N+GNP +LGQ+P
Sbjct  3    PVSLDTINPKVLKCQYAVRGEIVTLAQAVQEELKSKPGSRPFDEILYCNIGNPQSLGQQP  62

Query  319  LTFPR  333
            LTF R
Sbjct  63   LTFFR  67



>ref|XP_008460349.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X3 [Cucumis melo]
 ref|XP_008460350.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X4 [Cucumis melo]
 ref|XP_008460351.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X5 [Cucumis melo]
Length=436

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  52   PLSVATINDKVLKCEYAVRGEIVTLAQKLQEELSAKPGLHPFDEILYCNIGNPQSLGQQP  111

Query  319  LTFPR  333
            +TF R
Sbjct  112  ITFFR  116



>ref|XP_009380146.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+  + +N+ V KC+YAVRGE+   A  LQ+E          ++I++ N+GNP +LGQ+P
Sbjct  45   PVALDTINQKVLKCEYAVRGEIVTHAQRLQQELQSKPGSHPFEEILYCNIGNPQSLGQQP  104

Query  319  LTFPR  333
            +TF R
Sbjct  105  ITFFR  109



>ref|XP_006342898.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=487

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+   +LN  V KC YA+RGE+   A  LQ++           +I++ N+GNPH+LGQKP
Sbjct  9    PITLNDLNPKVLKCAYAIRGEIVTHAQTLQQDLTENPGSHPFNEILYCNIGNPHSLGQKP  68

Query  319  LTFPR  333
            ++F R
Sbjct  69   ISFFR  73



>gb|AIT69925.1| alanine transaminase [Saccharina sculpera]
Length=501

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 8/64 (13%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  321
            PLD   +NENVK  +YAVRG +  R+ ELQ+    G+K+ F      N+GNPHA  Q PL
Sbjct  21   PLDGTTINENVKSAKYAVRGNVLERSMELQRRMAAGEKLPFDTIVPCNIGNPHACLQSPL  80

Query  322  TFPR  333
            +F R
Sbjct  81   SFHR  84



>gb|KHJ88132.1| hypothetical protein OESDEN_12077 [Oesophagostomum dentatum]
Length=121

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  324
            L  + +N  V   QYAVRG + +RA EL+KE         K +I  N+G+ HA+GQKP+T
Sbjct  29   LTKDTINPQVITMQYAVRGPIVIRAVELEKELAKGANKPFKSVIKANIGDAHAMGQKPIT  88

Query  325  FPR  333
            F R
Sbjct  89   FIR  91



>gb|AIT69927.1| alanine transaminase [Saccharina japonica]
 gb|AIW62927.1| alanine transaminase [Saccharina japonica]
Length=501

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 8/64 (13%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  321
            PLD   +NENVK  +YAVRG +  R+ ELQ+    G+K+ F      N+GNPHA  Q PL
Sbjct  21   PLDGTTINENVKSAKYAVRGNVLERSMELQRRMAAGEKLPFDTIVPCNIGNPHACLQSPL  80

Query  322  TFPR  333
            +F R
Sbjct  81   SFHR  84



>sp|P52894.1|ALA2_HORVU RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Hordeum vulgare]
 emb|CAA81231.1| alanine aminotransferase [Hordeum vulgare subsp. vulgare]
Length=482

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 9/61 (15%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            +NLN  V KC+YAVRGE+ + A  LQ++ K         +I++ N+GNP +LGQ+P+TF 
Sbjct  8    DNLNPKVLKCEYAVRGEIVIHAQRLQEQLKTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  67

Query  331  R  333
            R
Sbjct  68   R  68



>pdb|3TCM|A Chain A, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
 pdb|3TCM|B Chain B, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
Length=500

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 9/61 (15%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            +NLN  V KC+YAVRGE+ + A  LQ++ K         +I++ N+GNP +LGQ+P+TF 
Sbjct  26   DNLNPKVLKCEYAVRGEIVIHAQRLQEQLKTQPGSLPFDEILYCNIGNPQSLGQQPVTFF  85

Query  331  R  333
            R
Sbjct  86   R  86



>ref|XP_008800517.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+ + ++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  52   PVTFASINPKVLKCEYAVRGEIVSHAQRLQQELQTKPDSHPFDEILYCNIGNPQSLGQQP  111

Query  319  LTFPR  333
            +TF R
Sbjct  112  VTFFR  116



>ref|XP_011109633.1| hypothetical protein H072_3664 [Dactylellina haptotyla CBS 200.50]
 gb|EPS42354.1| hypothetical protein H072_3664 [Dactylellina haptotyla CBS 200.50]
Length=487

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 43/64 (67%), Gaps = 9/64 (14%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPL  321
            L+Y+N+N +VK  +YAVRGEL ++A  +++E ++         +IF N+GNP  L QKP+
Sbjct  10   LNYDNINPHVKAAKYAVRGELAVKAEAIRRELEQNPSSHPFDHVIFANIGNPQQLDQKPI  69

Query  322  TFPR  333
            TF R
Sbjct  70   TFFR  73



>gb|AGE89226.1| cytosolic alanine aminotransferase, partial [Dicentrarchus labrax]
Length=186

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPLT  324
            L  + +N NVK+ +YAVRG +  RA +++KE K        ++I  N+G+ HA+GQKP+T
Sbjct  1    LTVDTMNPNVKRVEYAVRGPIVQRAVQIEKELKEGVKKPFSEVIKANIGDAHAMGQKPIT  60

Query  325  FPR  333
            F R
Sbjct  61   FLR  63



>emb|CDJ98237.1| Putative alanine aminotransferase, partial [Haemonchus contortus]
Length=66

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  324
            L  EN+N  V   QYAVRG + +RA E++KE         K +I  N+G+ HA+GQ P+T
Sbjct  3    LVKENINPQVITMQYAVRGPIVIRAVEIEKELEKGAKKPFKSVIKANIGDAHAMGQVPIT  62

Query  325  FPR  333
            F R
Sbjct  63   FNR  65



>ref|XP_008460347.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Cucumis 
melo]
Length=530

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  52   PLSVATINDKVLKCEYAVRGEIVTLAQKLQEELSAKPGLHPFDEILYCNIGNPQSLGQQP  111

Query  319  LTFPR  333
            +TF R
Sbjct  112  ITFFR  116



>ref|XP_009110415.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like [Brassica 
rapa]
Length=542

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  ++LN  V KC+YAVRGE+   A +LQ++ K         +II+ N+GNP +LGQ+P
Sbjct  64   PVTLDSLNPKVLKCEYAVRGEIVNIAQKLQEDLKINKDAYPFDEIIYCNIGNPQSLGQQP  123

Query  319  LTFPR  333
            +TF R
Sbjct  124  ITFFR  128



>ref|XP_003682412.1| hypothetical protein TDEL_0F03900 [Torulaspora delbrueckii]
 emb|CCE93201.1| hypothetical protein TDEL_0F03900 [Torulaspora delbrueckii]
Length=559

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 9/64 (14%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPL  321
            L   +LNENV K +YAVRG + +RA ELQ++ K         KI+  N+GNP  L QKPL
Sbjct  78   LTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPL  137

Query  322  TFPR  333
            +F R
Sbjct  138  SFYR  141



>gb|KDR12685.1| Alanine aminotransferase 2 [Zootermopsis nevadensis]
Length=538

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 8/60 (13%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPLTFPR  333
            EN+N  +K+ +YAVRG L +RASE++KE +        ++I  N+G+ HA+GQKPLTF R
Sbjct  68   ENMNPCLKRMEYAVRGPLVIRASEIEKELQEGVKKPFSEVIKANIGDCHAMGQKPLTFIR  127



>emb|CDX96776.1| BnaA08g23190D [Brassica napus]
Length=542

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  ++LN  V KC+YAVRGE+   A +LQ++ K         +II+ N+GNP +LGQ+P
Sbjct  64   PVTLDSLNPKVLKCEYAVRGEIVNIAQKLQEDLKINKDAYPFDEIIYCNIGNPQSLGQQP  123

Query  319  LTFPR  333
            +TF R
Sbjct  124  ITFFR  128



>ref|XP_004141733.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
 gb|KGN45438.1| hypothetical protein Csa_7G448000 [Cucumis sativus]
Length=488

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+   N+N  V KC+YAVRGE+   A  LQ+E          ++I++ N+GNP +LGQ+P
Sbjct  10   PISIHNINPKVLKCEYAVRGEIVALAQTLQEELLTNPGSRPFEEILYCNIGNPQSLGQQP  69

Query  319  LTFPR  333
            +TF R
Sbjct  70   ITFFR  74



>ref|XP_004144444.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=528

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  50   PLSIATINDKVLKCEYAVRGEIVTLAQKLQEELSVKPGSHPFDEILYCNIGNPQSLGQQP  109

Query  319  LTFPR  333
            +TF R
Sbjct  110  ITFFR  114



>ref|XP_004155894.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=488

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+   N+N  V KC+YAVRGE+   A  LQ+E          ++I++ N+GNP +LGQ+P
Sbjct  10   PISIHNINPKVLKCEYAVRGEIVALAQTLQEELLTNPGSRPFEEILYCNIGNPQSLGQQP  69

Query  319  LTFPR  333
            +TF R
Sbjct  70   ITFFR  74



>gb|KGN58474.1| hypothetical protein Csa_3G646610 [Cucumis sativus]
Length=535

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  57   PLSIATINDKVLKCEYAVRGEIVTLAQKLQEELSVKPGSHPFDEILYCNIGNPQSLGQQP  116

Query  319  LTFPR  333
            +TF R
Sbjct  117  ITFFR  121



>ref|XP_006416720.1| hypothetical protein EUTSA_v10007290mg [Eutrema salsugineum]
 gb|ESQ35073.1| hypothetical protein EUTSA_v10007290mg [Eutrema salsugineum]
Length=545

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +++N  V KC+YAVRGE+   A  LQ+E K         +II+ N+GNP +LGQ+P
Sbjct  67   PVTLDSINPKVLKCEYAVRGEIVNIAQRLQEELKTNKDAYPFDEIIYCNIGNPQSLGQQP  126

Query  319  LTFPR  333
            +TF R
Sbjct  127  ITFFR  131



>ref|XP_007409910.1| hypothetical protein MELLADRAFT_43385 [Melampsora larici-populina 
98AG31]
 gb|EGG06950.1| hypothetical protein MELLADRAFT_43385 [Melampsora larici-populina 
98AG31]
Length=484

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 39/68 (57%), Gaps = 12/68 (18%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK------------IIFTNVGNPHALG  309
            PL  +N+N  V + QYAVRGE+ LRA EL+ E               +I  N+GNP  LG
Sbjct  6    PLSIDNINPAVVEAQYAVRGEIALRAEELRNELASDPQAKDRLGFNNVISCNIGNPQQLG  65

Query  310  QKPLTFPR  333
            QKPL+F R
Sbjct  66   QKPLSFTR  73



>ref|XP_002175263.1| alanine aminotransferase [Schizosaccharomyces japonicus yFS275]
 gb|EEB08970.1| alanine aminotransferase [Schizosaccharomyces japonicus yFS275]
Length=486

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 39/63 (62%), Gaps = 9/63 (14%)
 Frame = +1

Query  172  DYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLT  324
            D E LN+NV   QYAVRG L +RA EL+ + K         +II  N+GNPH +GQ PLT
Sbjct  12   DPEQLNQNVFAAQYAVRGPLAVRAEELRAQLKEKPDSLPFTEIINANIGNPHQMGQIPLT  71

Query  325  FPR  333
            F R
Sbjct  72   FIR  74



>ref|XP_011036545.1| PREDICTED: alanine aminotransferase 2-like [Populus euphratica]
Length=533

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 9/61 (15%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            +N+N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P+TF 
Sbjct  59   DNINPKVLKCEYAVRGEIVTLAQALQEELKSKPGSHPFDEILYCNIGNPQSLGQQPITFF  118

Query  331  R  333
            R
Sbjct  119  R  119



>ref|XP_011072689.1| PREDICTED: alanine aminotransferase 2 [Sesamum indicum]
Length=547

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+  +++N  V +C+YAVRGE+   A +LQ+E KK         I++ N+GNP +LGQ+P
Sbjct  69   PVKLDSINPKVLECEYAVRGEIVTLAQKLQEELKKNPGSHPFDEILYCNIGNPQSLGQQP  128

Query  319  LTFPR  333
            +TF R
Sbjct  129  ITFFR  133



>ref|XP_002430266.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
 gb|EEB17528.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
Length=485

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 8/60 (13%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKE---GKKIIFT-----NVGNPHALGQKPLTFPR  333
            EN+NEN+ + +YAVRG + +RA E++KE   G K  FT     N+G+ HA+GQKP+TF R
Sbjct  15   ENMNENIIRLEYAVRGPIVIRAGEIEKELEQGVKKPFTEVLKANIGDCHAMGQKPITFFR  74



>gb|KJB70038.1| hypothetical protein B456_011G0552002, partial [Gossypium raimondii]
Length=116

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 9/61 (15%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFP  330
            +++N  V +CQYAVRGE+ + A +LQ+E          ++I++ N+GNP +LGQK +TF 
Sbjct  8    DSINPKVIECQYAVRGEIVILAQKLQQEIQAKPEAYPFQEILYCNIGNPQSLGQKSITFF  67

Query  331  R  333
            R
Sbjct  68   R  68



>ref|NP_001237553.1| alanine aminotransferase 1 [Glycine max]
 gb|ABW17196.1| alanine aminotransferase 1 [Glycine max]
Length=486

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KC+YAVRGE+   A  LQK+ +         +I++ N+GNP +LGQ+P
Sbjct  8    PVTAQNINPKVLKCEYAVRGEVVTLAQNLQKDLQANPGSHPFDEILYCNIGNPQSLGQQP  67

Query  319  LTFPR  333
            +TF R
Sbjct  68   ITFFR  72



>ref|XP_011499275.1| PREDICTED: alanine aminotransferase 2 [Ceratosolen solmsi marchali]
Length=533

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  324
            L  +N+ EN+ K +YAVRG L LRA EL+KE         K++I  NVG+ HA+GQKP+T
Sbjct  59   LTEDNVFENLVKMEYAVRGPLLLRAIELEKELLKGAKKPFKEVIKANVGDAHAMGQKPVT  118

Query  325  FPR  333
            F R
Sbjct  119  FLR  121



>ref|XP_003967921.1| PREDICTED: alanine aminotransferase 2-like [Takifugu rubripes]
Length=451

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPLT  324
            L  +N+N NVK+ +YAVRG + LRA +L+KE K        ++I  N+G+  A+GQKP+T
Sbjct  16   LTLDNMNPNVKRVEYAVRGPIVLRAMQLEKELKEGAKKPFNEVIRANIGDAQAMGQKPIT  75

Query  325  FPR  333
            F R
Sbjct  76   FFR  78



>ref|XP_011127540.1| hypothetical protein AOL_s00215g36 [Arthrobotrys oligospora ATCC 
24927]
 gb|EGX43300.1| hypothetical protein AOL_s00215g36 [Arthrobotrys oligospora ATCC 
24927]
Length=487

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 9/64 (14%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPL  321
            L+Y+N+N +VK  +YAVRGEL ++A  +++E +          +IF N+GNP  L QKP+
Sbjct  10   LNYDNINPHVKAAKYAVRGELAVKAEAIRREIELDPSSHPFDHVIFANIGNPQQLDQKPI  69

Query  322  TFPR  333
            TF R
Sbjct  70   TFFR  73



>gb|AIT69915.1| alanine transaminase [Undaria pinnatifida]
Length=501

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 8/64 (13%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  321
            PLD   +NENVK  +YAVRG +  R+ ELQ+    G+K+ F      N+GNPHA  Q PL
Sbjct  21   PLDGTTINENVKSAKYAVRGAVLERSMELQRRMAAGEKLPFDTIVPCNIGNPHACMQLPL  80

Query  322  TFPR  333
            +F R
Sbjct  81   SFHR  84



>gb|KHN39571.1| Alanine aminotransferase 2, mitochondrial [Glycine soja]
Length=536

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KC+YAVRGE+   A  LQK+ +         +I++ N+GNP +LGQ+P
Sbjct  58   PVTAQNINPKVLKCEYAVRGEVVTLAQNLQKDLQANPGSHPFDEILYCNIGNPQSLGQQP  117

Query  319  LTFPR  333
            +TF R
Sbjct  118  ITFFR  122



>ref|XP_008180133.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Acyrthosiphon 
pisum]
 ref|XP_008180134.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Acyrthosiphon 
pisum]
 ref|XP_008180135.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Acyrthosiphon 
pisum]
Length=481

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 43/63 (68%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  324
            L+ +N+N NV+  +YAVRG L +RA+E++ E KK        ++  N+G+ HA+GQKP+T
Sbjct  8    LNLDNMNPNVRIMEYAVRGPLLIRATEIENELKKGIEKPFKEVLKANIGDCHAMGQKPIT  67

Query  325  FPR  333
            F R
Sbjct  68   FIR  70



>ref|XP_010029516.1| PREDICTED: alanine aminotransferase 2-like [Eucalyptus grandis]
 gb|KCW56436.1| hypothetical protein EUGRSUZ_I02163 [Eucalyptus grandis]
Length=539

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  + +N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  61   PVTLDTINPKVLKCEYAVRGEIVSIAQRLQQELKENPGSHPFDEILYCNIGNPQSLGQQP  120

Query  319  LTFPR  333
            +TF R
Sbjct  121  ITFFR  125



>ref|XP_001948711.2| PREDICTED: alanine aminotransferase 1 isoform X1 [Acyrthosiphon 
pisum]
Length=527

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 43/63 (68%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  324
            L+ +N+N NV+  +YAVRG L +RA+E++ E KK        ++  N+G+ HA+GQKP+T
Sbjct  54   LNLDNMNPNVRIMEYAVRGPLLIRATEIENELKKGIEKPFKEVLKANIGDCHAMGQKPIT  113

Query  325  FPR  333
            F R
Sbjct  114  FIR  116



>ref|XP_003528736.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
1 [Glycine max]
 gb|KHN01474.1| Alanine aminotransferase 2, mitochondrial [Glycine soja]
Length=541

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +N+N  V KC+YAVRGE+   A  LQK+ +         +I++ N+GNP +LGQ+P
Sbjct  63   PVTAQNINPKVLKCEYAVRGEVVTLAQNLQKDLQANPGSHPFDEILYCNIGNPQSLGQQP  122

Query  319  LTFPR  333
            +TF R
Sbjct  123  ITFFR  127



>ref|XP_001966097.1| GF19406 [Drosophila ananassae]
 gb|EDV38506.1| GF19406 [Drosophila ananassae]
Length=244

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  324
            L+ +N+N N    +YAVRG L +RA E++KE +K        +I  N+G+ HA+GQ+PLT
Sbjct  93   LNLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGAKKPFDQVIRANIGDCHAMGQQPLT  152

Query  325  FPR  333
            F R
Sbjct  153  FLR  155



>emb|CDX83914.1| BnaC08g17310D [Brassica napus]
Length=541

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  ++LN  V KC+YAVRGE+   A +LQ++ K         +II+ N+GNP +LGQ+P
Sbjct  63   PVTLDSLNPKVLKCEYAVRGEIVNIAQKLQEDLKINKDAYPFDEIIYCNIGNPQSLGQQP  122

Query  319  LTFPR  333
            +TF R
Sbjct  123  ITFFR  127



>ref|XP_008462239.1| PREDICTED: alanine aminotransferase 1, mitochondrial [Cucumis 
melo]
Length=488

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+   N+N  V KC+YAVRGE+   A ++Q+E          ++I++ N+GNP +LGQ+P
Sbjct  10   PVSIHNINPKVLKCEYAVRGEIVALAQKIQEELLTNPGSRPFEEILYCNIGNPQSLGQQP  69

Query  319  LTFPR  333
            +TF R
Sbjct  70   ITFFR  74



>tpg|DAA46932.1| TPA: hypothetical protein ZEAMMB73_135514, partial [Zea mays]
Length=89

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 9/61 (15%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  330
            ENLN  V KC+YAVRGE+ + A  LQ++           +I+F N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILFCNIGNPQSLGQQPVTFF  67

Query  331  R  333
            R
Sbjct  68   R  68



>ref|XP_007217248.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
 gb|EMJ18447.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
Length=544

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+  +N+N  + KC+YAVRGE+   A  LQ+E           +I++ N+GNP +LGQ P
Sbjct  66   PVTLQNINPKILKCEYAVRGEIVTLAQRLQEELLANPGSHPFDEILYCNIGNPQSLGQHP  125

Query  319  LTFPR  333
            +TF R
Sbjct  126  ITFFR  130



>ref|XP_001622550.1| hypothetical protein NEMVEDRAFT_v1g236165 [Nematostella vectensis]
 gb|EDO30450.1| predicted protein [Nematostella vectensis]
Length=496

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 8/59 (14%)
 Frame = +1

Query  181  NLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLTFPR  333
            ++N  VK+ +YAVRG + +RASEL+KE         K+++  N+G+ HALG KPL FPR
Sbjct  24   SMNPYVKQIEYAVRGAIVIRASELEKELQQGHEKPFKEVVKANIGDAHALGMKPLKFPR  82



>ref|XP_009389580.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=487

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  + +N  V KCQYAVRG +   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  9    PVSIDTINPKVLKCQYAVRGAIVSHAQRLQQELQTSQGSLPFDEILYCNIGNPQSLGQQP  68

Query  319  LTFPR  333
            +TF R
Sbjct  69   ITFFR  73



>emb|CBK19835.2| Alanine aminotransferase 2 [Blastocystis hominis]
 emb|CBK21552.2| Alanine aminotransferase 2 [Blastocystis hominis]
 emb|CBK22764.2| Alanine aminotransferase 2 [Blastocystis hominis]
 emb|CBK21851.2| Alanine aminotransferase 2 [Blastocystis hominis]
Length=489

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  324
            +  +N+N++++   YAVRGE+ +RA+E+  E KK        +++ NVGNP A+ QKP+T
Sbjct  20   ITIDNINQHIRTADYAVRGEVVIRANEIDAEMKKGKKFPFDSLLYCNVGNPQAICQKPIT  79

Query  325  FPR  333
            F R
Sbjct  80   FLR  82



>emb|CDX81815.1| BnaC08g37860D [Brassica napus]
Length=549

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +++N  V KC+YAVRGE+   A  LQ + K         +II+ N+GNP +LGQ+P
Sbjct  71   PVTLDSINPKVLKCEYAVRGEIVSIAQRLQDDLKINKDAYPFDEIIYCNIGNPQSLGQQP  130

Query  319  LTFPR  333
            +TF R
Sbjct  131  ITFFR  135



>ref|XP_004303756.1| PREDICTED: alanine aminotransferase 2 [Fragaria vesca subsp. 
vesca]
Length=541

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 9/61 (15%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  330
            +N+N  V KC+YAVRGE+ + A +LQ++ K         +I++ N+GNP +LGQ+P+T+ 
Sbjct  67   DNINPKVVKCEYAVRGEIVILAGKLQEQLKANPGSLPFDEILYCNIGNPQSLGQQPITYF  126

Query  331  R  333
            R
Sbjct  127  R  127



>emb|CCW65758.1| unnamed protein product [Phytomonas sp. isolate EM1]
Length=499

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 9/60 (15%)
 Frame = +1

Query  181  NLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFPR  333
            ++N  V K QYAVRG +  RA E+QKE           ++++ N+GNP AL QKPLTFPR
Sbjct  18   HVNPRVVKAQYAVRGLIPTRAKEIQKEIMDGSTKYPFSELVWCNIGNPQALSQKPLTFPR  77



>emb|CBN81871.1| Alanine aminotransferase 2-like [Dicentrarchus labrax]
Length=491

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPLT  324
            L  +N+N NVK+ +YAVRG +  RA +++KE K        ++I  N+G+ HA+GQKP+T
Sbjct  16   LTLDNMNPNVKRVEYAVRGPIVQRAVQIEKELKEGVKKPFSEVIKANIGDAHAMGQKPIT  75

Query  325  FPR  333
            F R
Sbjct  76   FLR  78



>ref|XP_002265294.2| PREDICTED: alanine aminotransferase 2 [Vitis vinifera]
Length=526

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  E +N  V +C+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  48   PVTLETINPKVLECEYAVRGEIVTLAQRLQQELQEKPGSLPFDEILYCNIGNPQSLGQQP  107

Query  319  LTFPR  333
            +TF R
Sbjct  108  ITFFR  112



>ref|XP_007239533.1| PREDICTED: alanine aminotransferase 2-like [Astyanax mexicanus]
Length=79

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGK--------KIIFTNVGNPHALGQKPLT  324
            L  +++N NVK+ +YAVRG +  RA +++KE +        ++I  N+G+ HA+GQKP+T
Sbjct  13   LTLDSMNPNVKRVEYAVRGPIVQRAVQIEKELREGVKKPFTEVIKANIGDCHAMGQKPIT  72

Query  325  FPR  333
            F R
Sbjct  73   FFR  75



>ref|NP_001132269.1| uncharacterized protein LOC100193705 [Zea mays]
 gb|ACF81046.1| unknown [Zea mays]
Length=176

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 9/61 (15%)
 Frame = +1

Query  178  ENLNENVKKCQYAVRGELYLRASELQKEG---------KKIIFTNVGNPHALGQKPLTFP  330
            ENLN  V KC+YAVRGE+ + A  LQ++           +I+F N+GNP +LGQ+P+TF 
Sbjct  8    ENLNPKVLKCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILFCNIGNPQSLGQQPVTFF  67

Query  331  R  333
            R
Sbjct  68   R  68



>ref|XP_008228107.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Prunus 
mume]
Length=544

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  318
            P+  +N+N  + KC+YAVRGE+   A  LQ+E           +I++ N+GNP +LGQ P
Sbjct  66   PVTLQNINPKILKCEYAVRGEIVTLAQRLQEELLANPGSHPFDEILYCNIGNPQSLGQHP  125

Query  319  LTFPR  333
            +TF R
Sbjct  126  ITFFR  130



>ref|XP_455940.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAG98648.1| KLLA0F19162p [Kluyveromyces lactis]
Length=528

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 9/64 (14%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPL  321
            L  +++NENV K +YAVRG + +RA EL+ + K         KII  N+GNP  L QKPL
Sbjct  49   LSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPL  108

Query  322  TFPR  333
            TF R
Sbjct  109  TFYR  112



>ref|XP_006307188.1| hypothetical protein CARUB_v10008780mg [Capsella rubella]
 gb|EOA40086.1| hypothetical protein CARUB_v10008780mg [Capsella rubella]
Length=544

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  + +N  V KC+YAVRGE+   A +LQ++ K         +II+ N+GNP +LGQ+P
Sbjct  66   PVTLDTINPKVLKCEYAVRGEIVNIAQKLQEDLKINKDAYPFDEIIYCNIGNPQSLGQQP  125

Query  319  LTFPR  333
            +TF R
Sbjct  126  ITFFR  130



>gb|AAF82782.1|AF275372_1 alanine aminotransferase [Arabidopsis thaliana]
Length=543

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  + +N  V KC+YAVRGE+   A +LQ++ K         +II+ N+GNP +LGQ+P
Sbjct  65   PVTLDTINPKVIKCEYAVRGEIVNIAQKLQEDLKTNKDAYPFDEIIYCNIGNPQSLGQQP  124

Query  319  LTFPR  333
            +TF R
Sbjct  125  ITFFR  129



>ref|NP_173173.3| alanine aminotransferase [Arabidopsis thaliana]
 sp|F4I7I0.1|ALAT1_ARATH RecName: Full=Alanine aminotransferase 1, mitochondrial; Short=AtAlaAT1; 
Short=AtAlaATc; AltName: Full=Alanine-2-oxoglutarate 
aminotransferase 4; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE29570.1| alanine aminotransferase [Arabidopsis thaliana]
Length=543

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  + +N  V KC+YAVRGE+   A +LQ++ K         +II+ N+GNP +LGQ+P
Sbjct  65   PVTLDTINPKVIKCEYAVRGEIVNIAQKLQEDLKTNKDAYPFDEIIYCNIGNPQSLGQQP  124

Query  319  LTFPR  333
            +TF R
Sbjct  125  ITFFR  129



>gb|AAK64147.2| putative alanine aminotransferase [Arabidopsis thaliana]
Length=541

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  + +N  V KC+YAVRGE+   A +LQ++ K         +II+ N+GNP +LGQ+P
Sbjct  63   PVTLDTINPKVIKCEYAVRGEIVNIAQKLQEDLKTNKDAYPFDEIIYCNIGNPQSLGQQP  122

Query  319  LTFPR  333
            +TF R
Sbjct  123  ITFFR  127



>emb|CDY48485.1| BnaC05g13450D [Brassica napus]
Length=540

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +++N NV KC+YAVRGE+   A +LQ + K         +II+ N+GNP +L Q+P
Sbjct  62   PVTIDSINPNVLKCEYAVRGEIVNIAQKLQDDLKINKDAYPFDEIIYCNIGNPQSLSQQP  121

Query  319  LTFPR  333
            +TF R
Sbjct  122  ITFFR  126



>gb|ADB91976.1| alanine aminotransferase [Branchiostoma belcheri]
Length=500

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  324
            L  +++N  VKK +YAVRG +  RA+EL+KE         K++I  N+G+ HA+GQKP+T
Sbjct  26   LTIDSMNPLVKKVEYAVRGPIVARATELEKELERGVPKPFKQVIKANIGDAHAMGQKPIT  85

Query  325  FPR  333
            F R
Sbjct  86   FLR  88



>ref|XP_009149177.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like [Brassica 
rapa]
Length=537

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +++N NV KC+YAVRGE+   A +LQ + K         +II+ N+GNP +L Q+P
Sbjct  59   PVTLDSINPNVLKCEYAVRGEIVNIAQKLQDDLKINKDAYPFDEIIYCNIGNPQSLSQQP  118

Query  319  LTFPR  333
            +TF R
Sbjct  119  ITFFR  123



>emb|CBI35796.3| unnamed protein product [Vitis vinifera]
Length=482

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  E +N  V +C+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  4    PVTLETINPKVLECEYAVRGEIVTLAQRLQQELQEKPGSLPFDEILYCNIGNPQSLGQQP  63

Query  319  LTFPR  333
            +TF R
Sbjct  64   ITFFR  68



>ref|XP_009117710.1| PREDICTED: alanine aminotransferase 1, mitochondrial [Brassica 
rapa]
Length=548

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +++N  V KC+YAVRGE+   A  LQ + K         +II+ N+GNP +LGQ+P
Sbjct  70   PVTLDSINPKVLKCEYAVRGEIVSIAQRLQDDLKTNKDAYPFDEIIYCNIGNPQSLGQQP  129

Query  319  LTFPR  333
            +TF R
Sbjct  130  ITFFR  134



>gb|EWC46913.1| hypothetical protein DRE_03925 [Drechslerella stenobrocha 248]
Length=487

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 43/64 (67%), Gaps = 9/64 (14%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPL  321
            L+Y+N+N +VK+ +YAVRGEL  +A  ++++ ++         +IF N+GNP  L QKP+
Sbjct  10   LNYDNINPHVKEAKYAVRGELANKAESIRRDLEQDPSSHPFDHVIFANIGNPQQLDQKPI  69

Query  322  TFPR  333
            TF R
Sbjct  70   TFFR  73



>ref|XP_002890217.1| alanine aminotransferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66476.1| alanine aminotransferase [Arabidopsis lyrata subsp. lyrata]
Length=542

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +++N  V KC+YAVRGE+   A  LQ++ K         +II+ N+GNP +LGQ+P
Sbjct  64   PVTLDSINPKVIKCEYAVRGEIVNIAQRLQEDLKTNKDAYPFDEIIYCNIGNPQSLGQQP  123

Query  319  LTFPR  333
            +TF R
Sbjct  124  ITFFR  128



>gb|KFK43924.1| hypothetical protein AALP_AA1G191800 [Arabis alpina]
Length=544

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +++N  V KC+YAVRGE+   A  LQ++ K         +II+ N+GNP +LGQ+P
Sbjct  66   PVTIDSINPKVLKCEYAVRGEIVNIAQRLQEDLKTNKDAYPFDEIIYCNIGNPQSLGQQP  125

Query  319  LTFPR  333
            +TF R
Sbjct  126  ITFFR  130



>ref|XP_001769989.1| predicted protein [Physcomitrella patens]
 gb|EDQ65165.1| predicted protein [Physcomitrella patens]
Length=484

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +++N  V   +YAVRGE+ +RA  L +E K         +II+ N+GNP +LGQKP
Sbjct  6    PVSIQSINPKVLNAEYAVRGEIVIRAQALAEELKSNPGSHPFDEIIYCNIGNPQSLGQKP  65

Query  319  LTFPR  333
            +TF R
Sbjct  66   ITFFR  70



>gb|AIT69921.1| alanine transaminase [Sargassum muticum]
Length=501

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 8/64 (13%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEG--------KKIIFTNVGNPHALGQKPL  321
            PLD  ++N NV+  +YAVRG +  R+ ELQ+          KK +  N+GNPHAL Q PL
Sbjct  21   PLDATSINANVRAAEYAVRGNVLERSMELQRRMAAGEMLPFKKFVPCNIGNPHALLQLPL  80

Query  322  TFPR  333
            +F R
Sbjct  81   SFHR  84



>ref|XP_003760591.1| PREDICTED: alanine aminotransferase 1 [Sarcophilus harrisii]
Length=507

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE---GKK-----IIFTNVGNPHALGQKPLT  324
            L  + +N++VK  +YAVRG + LRA EL+KE   G K     II  N+G+ HA+GQ+P+T
Sbjct  32   LTMDTMNQSVKNIEYAVRGPILLRALELEKELQQGAKKPFTEIIRANIGDAHAMGQRPIT  91

Query  325  FPR  333
            F R
Sbjct  92   FMR  94



>gb|KDP40629.1| hypothetical protein JCGZ_24628 [Jatropha curcas]
Length=539

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            PL  + +N  V +C+YAVRGE+   A  LQ E K         +I++ N+GNP +LGQ+P
Sbjct  61   PLTVDTINPKVLECEYAVRGEIVTIAQRLQDELKSKPGSLPFDEILYCNIGNPQSLGQQP  120

Query  319  LTFPR  333
            +TF R
Sbjct  121  ITFFR  125



>ref|XP_008653343.1| PREDICTED: alanine aminotransferase 2 [Zea mays]
Length=541

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  318
            P+    +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  63   PVSVATINPKVLKCEYAVRGEIVTHAQNLQQELQKNPESLPFDEILYCNIGNPQSLGQQP  122

Query  319  LTFPR  333
            +T+ R
Sbjct  123  VTYFR  127



>emb|CDY26256.1| BnaA06g11610D [Brassica napus]
Length=537

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +++N NV KC+YAVRGE+   A +LQ + K         +II+ N+GNP +L Q+P
Sbjct  59   PVTLDSINPNVLKCEYAVRGEIVNIAQKLQDDLKINKDAYPFDEIIYCNIGNPQSLSQQP  118

Query  319  LTFPR  333
            +TF R
Sbjct  119  ITFFR  123



>ref|XP_006775215.1| PREDICTED: alanine aminotransferase 1 [Myotis davidii]
Length=307

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  324
            L  + +N  VK+ +YAVRG + LRA EL++E ++        +I  N+G+ HA+GQKP+T
Sbjct  21   LTLDTMNACVKRVEYAVRGPIVLRALELEQELRQGVKKPFTEVIHANIGDAHAMGQKPIT  80

Query  325  FPR  333
            F R
Sbjct  81   FLR  83



>emb|CDY21752.1| BnaA09g45030D [Brassica napus]
Length=547

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 9/65 (14%)
 Frame = +1

Query  166  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  318
            P+  +++N  V KC+YAVRGE+   A  LQ + K         +II+ N+GNP +LGQ+P
Sbjct  69   PVTLDSINPKVLKCEYAVRGEIVSIAQRLQDDLKTNKDAYPFDEIIYCNIGNPQSLGQQP  128

Query  319  LTFPR  333
            +TF R
Sbjct  129  ITFFR  133



>gb|EFX71233.1| hypothetical protein DAPPUDRAFT_309150 [Daphnia pulex]
Length=485

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIFT-----NVGNPHALGQKPLT  324
            L+ +N+N NVK  +YAVRG L +RA E++KE   G K  FT     N+G+  A+GQKP+T
Sbjct  14   LNVDNINPNVKAMEYAVRGPLVIRAGEIEKELAMGVKKPFTEVIKANIGDAQAMGQKPIT  73

Query  325  FPR  333
            F R
Sbjct  74   FIR  76



>emb|CDO96247.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=528

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 9/64 (14%)
 Frame = +1

Query  169  LDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPL  321
            L  E++NENV K +YAVRG + +RA EL++  +         KII  N+GNP  L QKPL
Sbjct  49   LSLEDVNENVLKAKYAVRGRIPMRAEELKETLRTDPKSLPFSKIISANIGNPQQLDQKPL  108

Query  322  TFPR  333
            TF R
Sbjct  109  TFYR  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562698116640