BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF009A23

Length=330
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357316.1|  PREDICTED: probable inactive receptor kinase...  80.5    4e-15   Solanum tuberosum [potatoes]
gb|KJB20519.1|  hypothetical protein B456_003G153000                  79.7    5e-15   Gossypium raimondii
gb|KHG05843.1|  hypothetical protein F383_32232                       80.1    7e-15   Gossypium arboreum [tree cotton]
ref|XP_009760496.1|  PREDICTED: probable inactive receptor kinase...  80.1    8e-15   Nicotiana sylvestris
ref|XP_009760490.1|  PREDICTED: probable inactive receptor kinase...  79.7    1e-14   Nicotiana sylvestris
ref|XP_009607538.1|  PREDICTED: probable inactive receptor kinase...  79.7    1e-14   Nicotiana tomentosiformis
ref|XP_010252005.1|  PREDICTED: probable inactive receptor kinase...  79.7    1e-14   Nelumbo nucifera [Indian lotus]
gb|KJB20517.1|  hypothetical protein B456_003G153000                  79.0    2e-14   Gossypium raimondii
ref|XP_002882579.1|  hypothetical protein ARALYDRAFT_478170           78.6    2e-14   
ref|XP_006358156.1|  PREDICTED: probable inactive receptor kinase...  77.8    5e-14   Solanum tuberosum [potatoes]
ref|XP_010463311.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  77.4    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_007033487.1|  Leucine-rich repeat protein kinase family pr...  77.4    6e-14   
gb|AAL09719.1|  AT3g08680/F17O14_15                                   76.3    7e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CBI15804.3|  unnamed protein product                              77.4    7e-14   Vitis vinifera
ref|XP_002276162.3|  PREDICTED: probable inactive receptor kinase...  77.4    7e-14   Vitis vinifera
ref|XP_004139930.1|  PREDICTED: probable inactive receptor kinase...  77.0    1e-13   Cucumis sativus [cucumbers]
ref|NP_187480.1|  leucine-rich repeat protein kinase family protein   76.6    1e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35996.1|  BnaA05g29540D                                        76.6    1e-13   Brassica napus [oilseed rape]
ref|XP_004235218.1|  PREDICTED: probable inactive receptor kinase...  76.3    1e-13   Solanum lycopersicum
gb|KDO64166.1|  hypothetical protein CISIN_1g006747mg                 75.1    3e-13   Citrus sinensis [apfelsine]
ref|XP_006429632.1|  hypothetical protein CICLE_v10011280mg           75.1    4e-13   Citrus clementina [clementine]
ref|XP_006297193.1|  hypothetical protein CARUB_v10013201mg           75.1    4e-13   Capsella rubella
gb|KJB29842.1|  hypothetical protein B456_005G120900                  75.1    4e-13   Gossypium raimondii
ref|XP_009146990.1|  PREDICTED: probable inactive receptor kinase...  74.7    5e-13   Brassica rapa
ref|XP_010464477.1|  PREDICTED: probable inactive receptor kinase...  74.3    6e-13   Camelina sativa [gold-of-pleasure]
gb|KHG17391.1|  hypothetical protein F383_22576                       74.3    7e-13   Gossypium arboreum [tree cotton]
emb|CDY02807.1|  BnaC02g10820D                                        69.7    8e-13   
gb|KJB71491.1|  hypothetical protein B456_011G125200                  73.9    9e-13   Gossypium raimondii
ref|XP_006407752.1|  hypothetical protein EUTSA_v10020278mg           73.9    1e-12   Eutrema salsugineum [saltwater cress]
ref|XP_009123870.1|  PREDICTED: probable inactive receptor kinase...  73.9    1e-12   Brassica rapa
gb|KDP21848.1|  hypothetical protein JCGZ_00635                       73.6    1e-12   Jatropha curcas
emb|CDY27986.1|  BnaC05g43880D                                        73.2    2e-12   Brassica napus [oilseed rape]
ref|XP_004241083.1|  PREDICTED: probable inactive receptor kinase...  73.2    2e-12   
ref|XP_010322111.1|  PREDICTED: probable inactive receptor kinase...  73.2    2e-12   Solanum lycopersicum
ref|XP_007017100.1|  Leucine-rich repeat protein kinase family pr...  73.2    2e-12   
ref|XP_002520893.1|  Receptor protein kinase CLAVATA1 precursor, ...  72.8    2e-12   
ref|XP_011080640.1|  PREDICTED: probable inactive receptor kinase...  72.4    3e-12   Sesamum indicum [beniseed]
gb|EYU35188.1|  hypothetical protein MIMGU_mgv1a002709mg              72.4    3e-12   Erythranthe guttata [common monkey flower]
ref|XP_007011393.1|  Leucine-rich repeat protein kinase family pr...  72.0    4e-12   
ref|XP_007011392.1|  Leucine-rich repeat protein kinase family pr...  72.0    4e-12   Theobroma cacao [chocolate]
ref|XP_006371315.1|  putative plant disease resistance family pro...  72.0    4e-12   
ref|XP_009126766.1|  PREDICTED: probable inactive receptor kinase...  72.0    5e-12   Brassica rapa
ref|XP_006371316.1|  hypothetical protein POPTR_0019s09010g           72.0    5e-12   
ref|XP_010244554.1|  PREDICTED: probable inactive receptor kinase...  71.6    6e-12   Nelumbo nucifera [Indian lotus]
emb|CDY32713.1|  BnaA02g07750D                                        71.6    6e-12   Brassica napus [oilseed rape]
emb|CDX88667.1|  BnaA03g09820D                                        71.6    6e-12   
ref|XP_009132067.1|  PREDICTED: probable inactive receptor kinase...  71.6    7e-12   Brassica rapa
gb|KDP21623.1|  hypothetical protein JCGZ_03294                       71.6    7e-12   Jatropha curcas
ref|XP_010999642.1|  PREDICTED: probable inactive receptor kinase...  71.2    1e-11   Populus euphratica
ref|XP_010999639.1|  PREDICTED: probable inactive receptor kinase...  70.9    1e-11   Populus euphratica
ref|XP_010999638.1|  PREDICTED: probable inactive receptor kinase...  70.9    1e-11   Populus euphratica
ref|XP_006280146.1|  hypothetical protein CARUB_v10026045mg           70.9    1e-11   
gb|KHF99691.1|  hypothetical protein F383_18108                       70.5    2e-11   Gossypium arboreum [tree cotton]
ref|XP_008456255.1|  PREDICTED: probable inactive receptor kinase...  70.1    2e-11   
ref|XP_010483401.1|  PREDICTED: probable inactive receptor kinase...  70.1    2e-11   
ref|XP_006435960.1|  hypothetical protein CICLE_v10030941mg           70.1    2e-11   Citrus clementina [clementine]
gb|KDO67579.1|  hypothetical protein CISIN_1g006886mg                 70.1    2e-11   Citrus sinensis [apfelsine]
ref|XP_006435961.1|  hypothetical protein CICLE_v10030941mg           70.1    2e-11   Citrus clementina [clementine]
emb|CDY58565.1|  BnaC03g12450D                                        69.7    3e-11   Brassica napus [oilseed rape]
gb|KCW50324.1|  hypothetical protein EUGRSUZ_J00100                   69.7    3e-11   Eucalyptus grandis [rose gum]
ref|XP_010031063.1|  PREDICTED: probable inactive receptor kinase...  69.7    3e-11   
ref|NP_200638.1|  leucine-rich repeat protein kinase family protein   69.7    3e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ACA61611.1|  hypothetical protein AP2_E06.2                        69.7    3e-11   Arabidopsis lyrata subsp. petraea
ref|XP_003519295.1|  PREDICTED: probable inactive receptor kinase...  69.7    3e-11   Glycine max [soybeans]
ref|XP_008239856.1|  PREDICTED: probable inactive receptor kinase...  69.3    4e-11   Prunus mume [ume]
ref|XP_002864562.1|  predicted protein                                69.3    4e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_010443551.1|  PREDICTED: probable inactive receptor kinase...  69.3    4e-11   Camelina sativa [gold-of-pleasure]
gb|KDO54913.1|  hypothetical protein CISIN_1g005693mg                 69.3    4e-11   Citrus sinensis [apfelsine]
gb|KDO54914.1|  hypothetical protein CISIN_1g005693mg                 69.3    4e-11   Citrus sinensis [apfelsine]
ref|XP_006432052.1|  hypothetical protein CICLE_v10000513mg           69.3    4e-11   Citrus clementina [clementine]
gb|KDO54912.1|  hypothetical protein CISIN_1g005693mg                 69.3    4e-11   Citrus sinensis [apfelsine]
ref|XP_006432053.1|  hypothetical protein CICLE_v10000513mg           69.3    4e-11   Citrus clementina [clementine]
ref|XP_006401105.1|  hypothetical protein EUTSA_v10012925mg           68.9    5e-11   Eutrema salsugineum [saltwater cress]
ref|XP_003544939.1|  PREDICTED: probable inactive receptor kinase...  68.9    6e-11   
ref|XP_010453493.1|  PREDICTED: probable inactive receptor kinase...  68.9    6e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010683449.1|  PREDICTED: probable inactive receptor kinase...  68.6    7e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010683445.1|  PREDICTED: probable inactive receptor kinase...  68.6    7e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011089537.1|  PREDICTED: probable inactive receptor kinase...  68.6    7e-11   Sesamum indicum [beniseed]
ref|XP_011089538.1|  PREDICTED: probable inactive receptor kinase...  68.6    7e-11   
dbj|BAK08005.1|  predicted protein                                    67.8    8e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT17815.1|  Putative inactive receptor kinase                     68.2    9e-11   
ref|XP_002456542.1|  hypothetical protein SORBIDRAFT_03g038110        68.2    9e-11   Sorghum bicolor [broomcorn]
gb|KJB67957.1|  hypothetical protein B456_010G219700                  68.2    1e-10   Gossypium raimondii
ref|XP_010558411.1|  PREDICTED: probable inactive receptor kinase...  68.2    1e-10   Tarenaya hassleriana [spider flower]
ref|NP_001130388.1|  uncharacterized LOC100191484 precursor           68.2    1e-10   Zea mays [maize]
ref|XP_009374410.1|  PREDICTED: probable inactive receptor kinase...  68.2    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_010541472.1|  PREDICTED: probable inactive receptor kinase...  67.8    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_010541471.1|  PREDICTED: probable inactive receptor kinase...  67.8    1e-10   
ref|XP_010043603.1|  PREDICTED: probable inactive receptor kinase...  67.8    1e-10   Eucalyptus grandis [rose gum]
ref|XP_009798129.1|  PREDICTED: probable inactive receptor kinase...  67.8    1e-10   Nicotiana sylvestris
ref|XP_003564492.1|  PREDICTED: probable inactive receptor kinase...  67.8    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_009410507.1|  PREDICTED: probable inactive receptor kinase...  67.8    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAB62593.1|  putative receptor-like protein kinase                67.4    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008384658.1|  PREDICTED: probable inactive receptor kinase...  67.4    2e-10   
gb|EYU36891.1|  hypothetical protein MIMGU_mgv1a0177022mg             66.2    2e-10   Erythranthe guttata [common monkey flower]
gb|KDP45679.1|  hypothetical protein JCGZ_17286                       67.0    2e-10   Jatropha curcas
ref|XP_010931391.1|  PREDICTED: probable inactive receptor kinase...  67.0    2e-10   Elaeis guineensis
ref|XP_009592168.1|  PREDICTED: probable inactive receptor kinase...  67.0    3e-10   Nicotiana tomentosiformis
ref|XP_006644911.1|  PREDICTED: probable inactive receptor kinase...  67.0    3e-10   Oryza brachyantha
ref|XP_011084790.1|  PREDICTED: probable inactive receptor kinase...  66.6    3e-10   Sesamum indicum [beniseed]
ref|XP_007208318.1|  hypothetical protein PRUPE_ppa002781mg           66.6    3e-10   
ref|XP_010094441.1|  putative inactive receptor kinase                66.6    4e-10   Morus notabilis
ref|XP_009337799.1|  PREDICTED: probable inactive receptor kinase...  66.2    4e-10   
ref|XP_008366817.1|  PREDICTED: probable inactive receptor kinase...  66.2    4e-10   
ref|XP_004302522.1|  PREDICTED: probable inactive receptor kinase...  66.2    4e-10   Fragaria vesca subsp. vesca
ref|XP_007142022.1|  hypothetical protein PHAVU_008G245900g           66.2    5e-10   Phaseolus vulgaris [French bean]
ref|XP_006374053.1|  leucine-rich repeat transmembrane protein ki...  65.9    5e-10   
ref|XP_008788112.1|  PREDICTED: probable inactive receptor kinase...  65.9    5e-10   Phoenix dactylifera
ref|NP_001055854.1|  Os05g0480400                                     65.9    6e-10   
gb|EEE64112.1|  hypothetical protein OsJ_18944                        65.9    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008376328.1|  PREDICTED: probable inactive receptor kinase...  65.9    6e-10   Malus domestica [apple tree]
ref|XP_009363779.1|  PREDICTED: probable inactive receptor kinase...  65.9    7e-10   Pyrus x bretschneideri [bai li]
ref|XP_010543666.1|  PREDICTED: probable leucine-rich repeat rece...  65.9    7e-10   Tarenaya hassleriana [spider flower]
ref|XP_008463277.1|  PREDICTED: probable inactive receptor kinase...  65.9    7e-10   Cucumis melo [Oriental melon]
ref|XP_007141331.1|  hypothetical protein PHAVU_008G186900g           65.9    7e-10   Phaseolus vulgaris [French bean]
ref|XP_010543665.1|  PREDICTED: probable leucine-rich repeat rece...  65.9    7e-10   
ref|XP_004961732.1|  PREDICTED: probable inactive receptor kinase...  65.5    7e-10   Setaria italica
emb|CDP13882.1|  unnamed protein product                              65.5    8e-10   Coffea canephora [robusta coffee]
ref|XP_004970381.1|  PREDICTED: probable inactive receptor kinase...  65.5    9e-10   Setaria italica
ref|XP_009384331.1|  PREDICTED: probable inactive receptor kinase...  65.1    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006842563.1|  hypothetical protein AMTR_s00077p00144650        64.3    1e-09   
ref|XP_010098027.1|  putative inactive receptor kinase                65.1    1e-09   
tpg|DAA57078.1|  TPA: putative leucine-rich repeat receptor-like ...  65.1    1e-09   
gb|EYU42048.1|  hypothetical protein MIMGU_mgv1a003031mg              64.7    1e-09   Erythranthe guttata [common monkey flower]
gb|EPS74415.1|  hypothetical protein M569_00340                       64.7    1e-09   Genlisea aurea
gb|KHN40011.1|  Putative inactive receptor kinase                     64.3    2e-09   Glycine soja [wild soybean]
ref|XP_004172749.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  64.7    2e-09   
ref|XP_004142674.1|  PREDICTED: probable inactive receptor kinase...  64.7    2e-09   Cucumis sativus [cucumbers]
ref|XP_008355739.1|  PREDICTED: probable inactive receptor kinase...  64.7    2e-09   
gb|EYU23390.1|  hypothetical protein MIMGU_mgv1a003016mg              64.7    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_009370892.1|  PREDICTED: probable inactive receptor kinase...  64.7    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_004502808.1|  PREDICTED: probable inactive receptor kinase...  64.7    2e-09   Cicer arietinum [garbanzo]
ref|XP_003518282.1|  PREDICTED: probable inactive receptor kinase...  64.3    2e-09   Glycine max [soybeans]
ref|XP_006654545.1|  PREDICTED: probable inactive receptor kinase...  64.3    2e-09   Oryza brachyantha
ref|XP_009355011.1|  PREDICTED: probable inactive receptor kinase...  64.3    2e-09   
ref|XP_010109178.1|  putative inactive receptor kinase                64.3    2e-09   
ref|XP_007220535.1|  hypothetical protein PRUPE_ppa002812mg           64.3    2e-09   Prunus persica
ref|XP_010922781.1|  PREDICTED: probable inactive receptor kinase...  64.3    2e-09   
ref|XP_003544853.1|  PREDICTED: probable inactive receptor kinase...  63.9    3e-09   Glycine max [soybeans]
ref|XP_002441272.1|  hypothetical protein SORBIDRAFT_09g023570        63.9    3e-09   Sorghum bicolor [broomcorn]
ref|XP_011001675.1|  PREDICTED: probable inactive receptor kinase...  63.5    3e-09   Populus euphratica
ref|XP_009607078.1|  PREDICTED: probable inactive receptor kinase...  63.9    3e-09   
ref|XP_011001674.1|  PREDICTED: probable inactive receptor kinase...  63.9    3e-09   Populus euphratica
ref|XP_011001671.1|  PREDICTED: probable inactive receptor kinase...  63.9    3e-09   Populus euphratica
gb|KEH34523.1|  LRR receptor-like kinase                              63.9    3e-09   Medicago truncatula
ref|XP_003600547.1|  Leucine-rich repeat receptor-like protein ki...  63.9    3e-09   
ref|XP_009386109.1|  PREDICTED: probable inactive receptor kinase...  63.5    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008234182.1|  PREDICTED: probable inactive receptor kinase...  63.5    3e-09   Prunus mume [ume]
ref|XP_004490727.1|  PREDICTED: probable inactive receptor kinase...  63.5    4e-09   Cicer arietinum [garbanzo]
ref|XP_011011771.1|  PREDICTED: probable inactive receptor kinase...  63.5    4e-09   Populus euphratica
ref|XP_009758202.1|  PREDICTED: probable inactive receptor kinase...  62.8    6e-09   Nicotiana sylvestris
ref|XP_003568238.1|  PREDICTED: probable inactive receptor kinase...  62.8    7e-09   Brachypodium distachyon [annual false brome]
ref|XP_008803002.1|  PREDICTED: probable inactive receptor kinase...  62.8    7e-09   Phoenix dactylifera
ref|XP_011073578.1|  PREDICTED: probable inactive receptor kinase...  62.8    8e-09   Sesamum indicum [beniseed]
gb|AAL76166.1|AF348333_1  candidate plant disease resistance protein  60.1    8e-09   Glycine max [soybeans]
gb|KDP25339.1|  hypothetical protein JCGZ_20495                       62.4    9e-09   Jatropha curcas
ref|XP_004500388.1|  PREDICTED: probable inactive receptor kinase...  62.4    1e-08   
gb|AES98409.2|  LRR receptor-like kinase                              62.4    1e-08   Medicago truncatula
ref|XP_003615451.1|  Leucine-rich repeat receptor-like protein ki...  62.4    1e-08   
ref|XP_003523287.1|  PREDICTED: probable inactive receptor kinase...  62.0    1e-08   Glycine max [soybeans]
ref|XP_006602049.1|  PREDICTED: probable inactive receptor kinase...  62.0    1e-08   Glycine max [soybeans]
ref|XP_006602050.1|  PREDICTED: probable inactive receptor kinase...  62.0    1e-08   Glycine max [soybeans]
ref|NP_196135.1|  putative leucine-rich repeat receptor-like prot...  62.0    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009362770.1|  PREDICTED: probable inactive receptor kinase...  62.0    1e-08   
ref|XP_003553192.2|  PREDICTED: probable inactive receptor kinase...  62.0    1e-08   Glycine max [soybeans]
ref|XP_004308997.1|  PREDICTED: probable inactive receptor kinase...  62.0    1e-08   Fragaria vesca subsp. vesca
ref|XP_006398978.1|  hypothetical protein EUTSA_v10012946mg           62.0    1e-08   Eutrema salsugineum [saltwater cress]
ref|XP_006602052.1|  PREDICTED: probable inactive receptor kinase...  62.0    1e-08   Glycine max [soybeans]
ref|XP_008649769.1|  PREDICTED: probable inactive receptor kinase...  61.6    2e-08   
ref|XP_003537367.2|  PREDICTED: probable inactive receptor kinase...  61.6    2e-08   
ref|XP_006591269.1|  PREDICTED: probable inactive receptor kinase...  61.6    2e-08   Glycine max [soybeans]
emb|CDX98821.1|  BnaC09g50140D                                        61.2    2e-08   
gb|KFK24939.1|  hypothetical protein AALP_AA8G045400                  61.2    2e-08   Arabis alpina [alpine rockcress]
gb|KHN25793.1|  Putative inactive receptor kinase                     61.2    2e-08   Glycine soja [wild soybean]
ref|XP_003526789.1|  PREDICTED: probable inactive receptor kinase...  61.2    2e-08   
ref|XP_007140053.1|  hypothetical protein PHAVU_008G080500g           61.2    2e-08   Phaseolus vulgaris [French bean]
ref|XP_010452417.1|  PREDICTED: probable leucine-rich repeat rece...  61.2    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002533837.1|  Nodulation receptor kinase precursor, putative   61.2    2e-08   
ref|XP_007146903.1|  hypothetical protein PHAVU_006G080200g           61.2    2e-08   Phaseolus vulgaris [French bean]
ref|XP_007136405.1|  hypothetical protein PHAVU_009G042300g           61.2    2e-08   Phaseolus vulgaris [French bean]
ref|XP_011041759.1|  PREDICTED: probable inactive receptor kinase...  61.2    3e-08   Populus euphratica
ref|XP_002325632.1|  putative plant disease resistance family pro...  60.8    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_002528709.1|  Nodulation receptor kinase precursor, putative   60.8    3e-08   Ricinus communis
ref|XP_002319979.1|  putative plant disease resistance family pro...  60.8    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010104998.1|  putative inactive receptor kinase                60.8    3e-08   Morus notabilis
ref|XP_003616055.1|  Leucine-rich repeat receptor-like protein ki...  60.8    3e-08   Medicago truncatula
ref|XP_009406050.1|  PREDICTED: probable inactive receptor kinase...  60.5    4e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010670041.1|  PREDICTED: probable inactive receptor kinase...  60.5    4e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010251541.1|  PREDICTED: probable inactive receptor kinase...  60.5    4e-08   
ref|XP_010055829.1|  PREDICTED: probable inactive receptor kinase...  60.5    4e-08   Eucalyptus grandis [rose gum]
gb|KEH35517.1|  receptor-like kinase                                  60.5    4e-08   Medicago truncatula
ref|XP_009122125.1|  PREDICTED: probable leucine-rich repeat rece...  60.1    5e-08   Brassica rapa
ref|XP_002871141.1|  hypothetical protein ARALYDRAFT_325150           60.1    5e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_011080874.1|  PREDICTED: probable inactive receptor kinase...  60.1    5e-08   Sesamum indicum [beniseed]
ref|XP_007207849.1|  hypothetical protein PRUPE_ppa022997mg           60.1    5e-08   
ref|XP_006602721.1|  PREDICTED: probable inactive receptor kinase...  60.1    5e-08   Glycine max [soybeans]
gb|KHN40609.1|  Putative inactive receptor kinase                     60.1    5e-08   Glycine soja [wild soybean]
ref|XP_010323112.1|  PREDICTED: probable inactive receptor kinase...  59.7    7e-08   
ref|XP_008244579.1|  PREDICTED: probable inactive receptor kinase...  59.7    8e-08   
gb|EMT10528.1|  Putative inactive receptor kinase                     59.3    9e-08   
ref|XP_007040424.1|  Leucine-rich repeat protein kinase family pr...  59.3    9e-08   
ref|XP_009362808.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  59.3    1e-07   
ref|XP_010423497.1|  PREDICTED: probable leucine-rich repeat rece...  59.3    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010491047.1|  PREDICTED: probable leucine-rich repeat rece...  59.3    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_008388374.1|  PREDICTED: probable inactive receptor kinase...  59.3    1e-07   
ref|XP_004490516.1|  PREDICTED: probable inactive receptor kinase...  58.9    1e-07   Cicer arietinum [garbanzo]
ref|XP_011026938.1|  PREDICTED: probable inactive receptor kinase...  58.9    1e-07   Populus euphratica
ref|XP_006587908.1|  PREDICTED: probable inactive receptor kinase...  58.9    1e-07   Glycine max [soybeans]
ref|XP_002299495.1|  leucine-rich repeat transmembrane protein ki...  58.9    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010653698.1|  PREDICTED: probable inactive receptor kinase...  58.9    1e-07   
ref|XP_010653700.1|  PREDICTED: probable inactive receptor kinase...  58.9    2e-07   
ref|XP_011026937.1|  PREDICTED: probable inactive receptor kinase...  58.5    2e-07   Populus euphratica
ref|XP_006476438.1|  PREDICTED: probable inactive receptor kinase...  58.5    2e-07   Citrus sinensis [apfelsine]
gb|KDO76442.1|  hypothetical protein CISIN_1g006922mg                 58.5    2e-07   Citrus sinensis [apfelsine]
ref|XP_008388375.1|  PREDICTED: probable inactive receptor kinase...  58.5    2e-07   
ref|XP_011095165.1|  PREDICTED: probable inactive receptor kinase...  58.5    2e-07   Sesamum indicum [beniseed]
ref|XP_006439412.1|  hypothetical protein CICLE_v10019314mg           58.5    2e-07   Citrus clementina [clementine]
ref|XP_009772876.1|  PREDICTED: probable inactive receptor kinase...  58.5    2e-07   Nicotiana sylvestris
ref|XP_007210296.1|  hypothetical protein PRUPE_ppa002579mg           58.2    2e-07   Prunus persica
ref|XP_006356869.1|  PREDICTED: probable inactive receptor kinase...  58.2    3e-07   Solanum tuberosum [potatoes]
ref|XP_008239079.1|  PREDICTED: probable inactive receptor kinase...  57.8    3e-07   Prunus mume [ume]
ref|XP_002509916.1|  ATP binding protein, putative                    57.4    4e-07   
gb|KJB19053.1|  hypothetical protein B456_003G082600                  57.8    4e-07   Gossypium raimondii
ref|XP_010493544.1|  PREDICTED: inactive leucine-rich repeat rece...  57.4    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_011022559.1|  PREDICTED: probable inactive receptor kinase...  57.4    5e-07   Populus euphratica
ref|XP_010421220.1|  PREDICTED: inactive leucine-rich repeat rece...  57.4    5e-07   
ref|XP_009352353.1|  PREDICTED: probable inactive receptor kinase...  57.4    5e-07   Pyrus x bretschneideri [bai li]
ref|XP_008392458.1|  PREDICTED: probable inactive receptor kinase...  57.4    5e-07   
ref|XP_006289209.1|  hypothetical protein CARUB_v10002657mg           56.6    7e-07   Capsella rubella
ref|XP_004246956.1|  PREDICTED: probable inactive receptor kinase...  56.6    8e-07   Solanum lycopersicum
ref|XP_006283317.1|  hypothetical protein CARUB_v10004355mg           56.6    9e-07   
ref|XP_010550530.1|  PREDICTED: inactive leucine-rich repeat rece...  56.2    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_009380537.1|  PREDICTED: probable inactive receptor kinase...  56.2    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP12117.1|  unnamed protein product                              56.2    1e-06   Coffea canephora [robusta coffee]
ref|XP_009590190.1|  PREDICTED: probable inactive receptor kinase...  56.2    1e-06   Nicotiana tomentosiformis
ref|XP_004143879.1|  PREDICTED: probable inactive receptor kinase...  56.2    1e-06   Cucumis sativus [cucumbers]
ref|XP_004167870.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  56.2    1e-06   
ref|XP_010053173.1|  PREDICTED: probable inactive receptor kinase...  55.8    1e-06   Eucalyptus grandis [rose gum]
ref|XP_008437363.1|  PREDICTED: probable inactive receptor kinase...  55.8    1e-06   
gb|EPS58213.1|  hypothetical protein M569_16602                       55.8    1e-06   Genlisea aurea
ref|XP_004294716.1|  PREDICTED: probable inactive receptor kinase...  55.8    1e-06   Fragaria vesca subsp. vesca
ref|XP_009799943.1|  PREDICTED: probable inactive receptor kinase...  55.8    2e-06   Nicotiana sylvestris
ref|XP_002463400.1|  hypothetical protein SORBIDRAFT_02g043090        55.8    2e-06   Sorghum bicolor [broomcorn]
ref|XP_006394667.1|  hypothetical protein EUTSA_v10003837mg           55.8    2e-06   Eutrema salsugineum [saltwater cress]
ref|XP_004492584.1|  PREDICTED: probable inactive receptor kinase...  55.5    2e-06   Cicer arietinum [garbanzo]
ref|XP_002303623.1|  leucine-rich repeat transmembrane protein ki...  55.5    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010541406.1|  PREDICTED: probable inactive receptor kinase...  55.5    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_004300851.1|  PREDICTED: probable inactive receptor kinase...  55.1    2e-06   Fragaria vesca subsp. vesca
ref|XP_004245544.1|  PREDICTED: probable inactive receptor kinase...  55.1    2e-06   Solanum lycopersicum
ref|XP_006343895.1|  PREDICTED: probable inactive receptor kinase...  55.1    3e-06   Solanum tuberosum [potatoes]
ref|XP_010454700.1|  PREDICTED: inactive leucine-rich repeat rece...  54.7    3e-06   Camelina sativa [gold-of-pleasure]
ref|NP_001169737.1|  uncharacterized LOC100383618 precursor           54.7    4e-06   Zea mays [maize]
ref|XP_010658906.1|  PREDICTED: probable inactive receptor kinase...  54.3    4e-06   Vitis vinifera
ref|XP_008810859.1|  PREDICTED: probable inactive receptor kinase...  54.3    4e-06   Phoenix dactylifera
ref|XP_002872091.1|  hypothetical protein ARALYDRAFT_489266           54.3    5e-06   
emb|CDY19849.1|  BnaA09g05020D                                        54.3    5e-06   Brassica napus [oilseed rape]
ref|XP_009141903.1|  PREDICTED: inactive leucine-rich repeat rece...  54.3    5e-06   Brassica rapa
ref|XP_010676354.1|  PREDICTED: probable inactive receptor kinase...  54.3    5e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008810858.1|  PREDICTED: probable inactive receptor kinase...  54.3    5e-06   Phoenix dactylifera
ref|XP_009336254.1|  PREDICTED: probable inactive receptor kinase...  53.5    9e-06   Pyrus x bretschneideri [bai li]
emb|CDX87143.1|  BnaC09g04580D                                        53.1    1e-05   
ref|XP_010921193.1|  PREDICTED: probable inactive receptor kinase...  53.1    1e-05   Elaeis guineensis
ref|XP_009391668.1|  PREDICTED: probable inactive receptor kinase...  53.1    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006287298.1|  hypothetical protein CARUB_v10000491mg           53.1    1e-05   Capsella rubella
ref|XP_009137362.1|  PREDICTED: probable inactive receptor kinase...  53.1    1e-05   Brassica rapa
emb|CDY47625.1|  BnaA01g13400D                                        52.8    1e-05   Brassica napus [oilseed rape]
ref|XP_009413825.1|  PREDICTED: probable inactive receptor kinase...  52.8    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU25187.1|  hypothetical protein MIMGU_mgv1a002923mg              52.4    2e-05   Erythranthe guttata [common monkey flower]
gb|KEH23299.1|  LRR receptor-like kinase                              52.0    2e-05   Medicago truncatula
ref|XP_010938046.1|  PREDICTED: probable inactive receptor kinase...  52.0    3e-05   Elaeis guineensis
ref|XP_004511531.1|  PREDICTED: probable inactive receptor kinase...  51.6    3e-05   Cicer arietinum [garbanzo]
ref|XP_010938045.1|  PREDICTED: probable inactive receptor kinase...  52.0    3e-05   Elaeis guineensis
ref|XP_009629119.1|  PREDICTED: probable inactive receptor kinase...  51.6    4e-05   
ref|NP_197798.1|  Leucine-rich repeat protein kinase family protein   51.6    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004958707.1|  PREDICTED: probable inactive receptor kinase...  51.6    4e-05   Setaria italica
emb|CDY03527.1|  BnaC01g15550D                                        50.8    4e-05   
ref|XP_007160136.1|  hypothetical protein PHAVU_002G295600g           51.6    4e-05   Phaseolus vulgaris [French bean]
ref|XP_009409433.1|  PREDICTED: probable inactive receptor kinase...  51.2    5e-05   
gb|EPS73425.1|  hypothetical protein M569_01324                       51.2    5e-05   Genlisea aurea
gb|EYU19612.1|  hypothetical protein MIMGU_mgv1a026050mg              50.8    6e-05   
gb|EPS62971.1|  hypothetical protein M569_11816                       50.8    6e-05   
ref|XP_006580544.1|  PREDICTED: probable inactive receptor kinase...  50.8    7e-05   
gb|EMT09037.1|  Putative inactive receptor kinase                     50.4    8e-05   
ref|XP_010059849.1|  PREDICTED: probable inactive receptor kinase...  50.4    8e-05   
ref|XP_003557981.1|  PREDICTED: probable inactive receptor kinase...  50.4    9e-05   
ref|XP_009132484.1|  PREDICTED: probable inactive receptor kinase...  50.4    9e-05   
emb|CDY47068.1|  BnaA03g12300D                                        50.1    1e-04   
ref|XP_008813231.1|  PREDICTED: probable inactive receptor kinase...  50.1    1e-04   
emb|CDY10963.1|  BnaA03g46220D                                        49.7    1e-04   
ref|XP_008813233.1|  PREDICTED: probable inactive receptor kinase...  50.1    1e-04   
ref|XP_004149452.1|  PREDICTED: probable inactive receptor kinase...  50.1    1e-04   
ref|XP_009137388.1|  PREDICTED: probable inactive receptor kinase...  49.7    1e-04   
emb|CDP06375.1|  unnamed protein product                              50.1    1e-04   
emb|CDX94213.1|  BnaC07g38470D                                        49.7    1e-04   
ref|XP_006584744.1|  PREDICTED: probable inactive receptor kinase...  49.7    2e-04   
ref|XP_006413522.1|  hypothetical protein EUTSA_v10024674mg           49.7    2e-04   
ref|XP_008439323.1|  PREDICTED: probable inactive receptor kinase...  49.7    2e-04   
gb|EMT12910.1|  Putative inactive receptor kinase                     49.3    2e-04   
ref|NP_194105.1|  Leucine-rich repeat protein kinase family protein   49.3    2e-04   
gb|KDO56147.1|  hypothetical protein CISIN_1g007167mg                 49.3    2e-04   
ref|XP_006490586.1|  PREDICTED: probable inactive receptor kinase...  49.3    2e-04   
ref|XP_006422104.1|  hypothetical protein CICLE_v10004549mg           49.3    2e-04   
gb|AFK45382.1|  unknown                                               49.3    2e-04   
ref|XP_003611028.1|  Probably inactive receptor-like protein kinase   49.3    2e-04   
ref|XP_007038934.1|  Leucine-rich repeat protein kinase family pr...  48.9    3e-04   
ref|XP_006658137.1|  PREDICTED: probable inactive receptor kinase...  48.9    3e-04   
ref|NP_001168611.1|  uncharacterized LOC100382395 precursor           48.9    3e-04   
ref|XP_010538821.1|  PREDICTED: probable inactive receptor kinase...  48.9    3e-04   
ref|XP_011001936.1|  PREDICTED: probable inactive receptor kinase...  48.9    3e-04   
ref|XP_011001931.1|  PREDICTED: probable inactive receptor kinase...  48.9    3e-04   
ref|XP_010662595.1|  PREDICTED: probable inactive receptor kinase...  48.9    3e-04   
ref|XP_002869766.1|  hypothetical protein ARALYDRAFT_914223           48.5    3e-04   
ref|NP_001060650.1|  Os07g0681100                                     48.5    4e-04   
gb|ACC91242.1|  leucine-rich repeat transmembrane protein kinase      48.5    4e-04   
dbj|BAK07296.1|  predicted protein                                    48.5    4e-04   
dbj|BAJ93317.1|  predicted protein                                    48.5    4e-04   
ref|XP_010448663.1|  PREDICTED: probable inactive receptor kinase...  48.1    4e-04   
ref|XP_002317741.1|  hypothetical protein POPTR_0012s01230g           48.1    4e-04   
ref|XP_010445167.1|  PREDICTED: probable inactive receptor kinase...  48.1    5e-04   
gb|EAZ05160.1|  hypothetical protein OsI_27356                        48.1    5e-04   
emb|CBI22555.3|  unnamed protein product                              48.1    5e-04   
ref|XP_010433865.1|  PREDICTED: probable inactive receptor kinase...  48.1    5e-04   
ref|XP_009357339.1|  PREDICTED: probable inactive receptor kinase...  47.8    6e-04   
ref|XP_009368693.1|  PREDICTED: probable inactive receptor kinase...  47.8    6e-04   
gb|KCW46493.1|  hypothetical protein EUGRSUZ_K00318                   47.4    7e-04   
ref|XP_004308019.1|  PREDICTED: probable inactive receptor kinase...  47.4    8e-04   
ref|XP_006829650.1|  hypothetical protein AMTR_s00122p00112840        47.4    8e-04   
ref|XP_009399835.1|  PREDICTED: probable inactive receptor kinase...  47.4    9e-04   
ref|XP_009399834.1|  PREDICTED: probable inactive receptor kinase...  47.4    9e-04   
ref|XP_010035197.1|  PREDICTED: probable inactive receptor kinase...  47.4    0.001   



>ref|XP_006357316.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Solanum 
tuberosum]
Length=592

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P I+A+LDSD  ALL+F+ASVPH RKLNWNS L IC SW GI C+KDG +
Sbjct  21   PHIIANLDSDKHALLQFAASVPHLRKLNWNSALSICNSWIGITCNKDGTR  70



>gb|KJB20519.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
Length=460

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            P IVADL+SD +ALLEF A+VPHRR LNWNST PIC +W GI C++D    L
Sbjct  39   PLIVADLNSDKQALLEFHAAVPHRRNLNWNSTNPICTTWVGITCAQDNSSVL  90



>gb|KHG05843.1| hypothetical protein F383_32232 [Gossypium arboreum]
Length=659

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            P IVADL+SD +ALLEF A+VPHRR LNWNST PIC SW GI C++D    L
Sbjct  39   PLIVADLNSDKQALLEFHAAVPHRRNLNWNSTNPICTSWVGITCTQDNSSVL  90



>ref|XP_009760496.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760502.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760506.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
Length=646

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P +VADLDSD +ALLEF+ SVPH RKLNWN  LPIC SW G+ C+KDG +
Sbjct  31   PHVVADLDSDRQALLEFANSVPHIRKLNWNLALPICYSWAGVTCNKDGTR  80



>ref|XP_009760490.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Nicotiana sylvestris]
Length=717

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P +VADLDSD +ALLEF+ SVPH RKLNWN  LPIC SW G+ C+KDG +
Sbjct  102  PHVVADLDSDRQALLEFANSVPHIRKLNWNLALPICYSWAGVTCNKDGTR  151



>ref|XP_009607538.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607539.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607540.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607541.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=690

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P ++ADLDSD +ALLEF+ SVPH RKLNWN T+PIC SW GI C+KDG +
Sbjct  68   PHVIADLDSDRQALLEFANSVPHIRKLNWNLTIPICKSWAGITCNKDGTR  117



>ref|XP_010252005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252007.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252008.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252009.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252010.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=676

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            ++ADLD+D +ALL+FSA+VPH RKLNWNST PIC +W G+ CS+DG
Sbjct  59   VIADLDTDKQALLDFSAAVPHGRKLNWNSTSPICSTWVGVTCSQDG  104



>gb|KJB20517.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20518.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20520.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20521.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
Length=657

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            P IVADL+SD +ALLEF A+VPHRR LNWNST PIC +W GI C++D    L
Sbjct  39   PLIVADLNSDKQALLEFHAAVPHRRNLNWNSTNPICTTWVGITCAQDNSSVL  90



>ref|XP_002882579.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58838.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
Length=639

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            AD++SD +ALLEF++ VPH RKLNWNST+PICGSWTGI CSK+  +
Sbjct  22   ADIESDKQALLEFASLVPHSRKLNWNSTIPICGSWTGITCSKNNAR  67



>ref|XP_006358156.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358157.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=635

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ++ADLDSD +ALL+F+ SVPH RKLNWN  LPIC SW GI C+KDG +
Sbjct  23   VIADLDSDRQALLDFAESVPHIRKLNWNLALPICKSWAGIACNKDGTR  70



>ref|XP_010463311.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At3g08680 [Camelina sativa]
Length=637

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            AD++SD +ALLEF++ VPH RKLNWNS++PICGSWTGI CSK+  +
Sbjct  24   ADIESDKQALLEFASLVPHSRKLNWNSSIPICGSWTGITCSKNNAR  69



>ref|XP_007033487.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007033488.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04413.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04414.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            P  VADL+SD +ALL+FSA+VPH RKLNW+   P+C SW GI C+KDG + L
Sbjct  19   PETVADLNSDEQALLQFSATVPHGRKLNWSPATPVCASWVGINCTKDGSRVL  70



>gb|AAL09719.1| AT3g08680/F17O14_15 [Arabidopsis thaliana]
 gb|AAN18066.1| At3g08680/F17O14_15 [Arabidopsis thaliana]
Length=382

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            AD++SD +ALLEF++ VPH RKLNWNST+PIC SWTGI CSK+  +
Sbjct  23   ADIESDKQALLEFASLVPHSRKLNWNSTIPICASWTGITCSKNNAR  68



>emb|CBI15804.3| unnamed protein product [Vitis vinifera]
Length=656

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P  +ADLD+D +ALL+F+ +VPHRRKLNWNS+ P+C SW GI C+ DG +
Sbjct  40   PLAIADLDADKQALLDFADAVPHRRKLNWNSSTPVCTSWVGINCTGDGSR  89



>ref|XP_002276162.3| PREDICTED: probable inactive receptor kinase At5g58300 [Vitis 
vinifera]
Length=666

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P  +ADLD+D +ALL+F+ +VPHRRKLNWNS+ P+C SW GI C+ DG +
Sbjct  50   PLAIADLDADKQALLDFADAVPHRRKLNWNSSTPVCTSWVGINCTGDGSR  99



>ref|XP_004139930.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 ref|XP_004154555.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 gb|KGN46766.1| hypothetical protein Csa_6G133750 [Cucumis sativus]
Length=630

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            +ADL+SD +ALL+F++SVPHRR LNWN T PIC SW G+ CS DG   L
Sbjct  23   IADLESDKQALLDFASSVPHRRSLNWNDTTPICTSWVGVTCSADGTHVL  71



>ref|NP_187480.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_974257.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9C9Y8.1|Y3868_ARATH RecName: Full=Probable inactive receptor kinase At3g08680; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51359.1|AC012562_20 putative protein kinase; 49514-51513 [Arabidopsis thaliana]
 gb|ACN59313.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE74662.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AEE74663.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=640

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            AD++SD +ALLEF++ VPH RKLNWNST+PIC SWTGI CSK+  +
Sbjct  23   ADIESDKQALLEFASLVPHSRKLNWNSTIPICASWTGITCSKNNAR  68



>emb|CDY35996.1| BnaA05g29540D [Brassica napus]
Length=635

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            AD+DSD +ALLEF++ VPH RKLNWN+TLPIC SWTGI CSK+
Sbjct  20   ADIDSDKQALLEFASLVPHVRKLNWNTTLPICTSWTGITCSKN  62



>ref|XP_004235218.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318222.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318223.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318224.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=635

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ++ADLDSD +ALL+F+ SVPH RKLNWN  LPIC SW GI C++DG +
Sbjct  23   VIADLDSDRQALLDFAESVPHIRKLNWNLALPICKSWAGIACNEDGTR  70



>gb|KDO64166.1| hypothetical protein CISIN_1g006747mg [Citrus sinensis]
Length=632

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            P ++ADL+SD +ALL+F+A+VPH RKLNWNS+  +C SW GI C+K+G + L
Sbjct  17   PQMIADLNSDKQALLDFAANVPHARKLNWNSSTSVCTSWVGITCTKNGSRVL  68



>ref|XP_006429632.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
 ref|XP_006481232.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 ref|XP_006481233.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006481234.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR42872.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
Length=632

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            P ++ADL+SD +ALL+F+A+VPH RKLNWNS+  +C SW GI C+K+G + L
Sbjct  17   PQMIADLNSDKQALLDFAANVPHARKLNWNSSTSVCTSWVGITCTKNGSRVL  68



>ref|XP_006297193.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 ref|XP_006297194.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30091.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30092.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
Length=633

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            AD++SD +ALLEF++ VPH RKLNWNS++PIC SWTGI CSK+  +
Sbjct  23   ADIESDKQALLEFASLVPHSRKLNWNSSIPICNSWTGITCSKNNAR  68



>gb|KJB29842.1| hypothetical protein B456_005G120900 [Gossypium raimondii]
 gb|KJB29843.1| hypothetical protein B456_005G120900 [Gossypium raimondii]
Length=660

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  169  GIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            G VADLD D +ALL+FSA+VPH RKLNW+   P+C SW GI C+KDG +
Sbjct  46   GTVADLDLDEQALLQFSATVPHGRKLNWSPATPVCTSWVGINCTKDGSR  94



>ref|XP_009146990.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=635

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADL++D +ALLEF++ VPH RKLNWN+TLPIC SWTGI CSK+
Sbjct  20   ADLETDKQALLEFASLVPHVRKLNWNTTLPICTSWTGITCSKN  62



>ref|XP_010464477.1| PREDICTED: probable inactive receptor kinase At3g08680 [Camelina 
sativa]
Length=638

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            AD++SD +ALLEF++ VPH RKLNWNS++PIC SWTGI CSK+  +
Sbjct  25   ADIESDKQALLEFASLVPHSRKLNWNSSIPICDSWTGITCSKNNAR  70



>gb|KHG17391.1| hypothetical protein F383_22576 [Gossypium arboreum]
Length=661

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  169  GIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            G VADLD D +ALL+FSA+VPH RK+NW+   P+C SW GI C+KDG +
Sbjct  47   GTVADLDLDEQALLQFSATVPHGRKINWSPATPVCTSWVGINCTKDGSR  95



>emb|CDY02807.1| BnaC02g10820D [Brassica napus]
Length=103

 Score = 69.7 bits (169),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            +ADL+SD +ALL F+ASVPH RKLNWNST  IC SW G+ C+ DG
Sbjct  35   IADLNSDRQALLSFAASVPHLRKLNWNSTNHICKSWVGVTCTSDG  79



>gb|KJB71491.1| hypothetical protein B456_011G125200 [Gossypium raimondii]
Length=628

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            VADLDSD +ALL FSA VPH RKLNW+S  P+C SW GI C+KD
Sbjct  27   VADLDSDKQALLRFSARVPHGRKLNWSSATPVCTSWVGINCTKD  70



>ref|XP_006407752.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
 gb|ESQ49205.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
Length=639

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            AD+DSD +ALLEF++ VPH RKLNWN+T PIC SWTGI CSK+  +
Sbjct  22   ADIDSDKQALLEFASLVPHSRKLNWNTTNPICTSWTGITCSKNNAR  67



>ref|XP_009123870.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
 ref|XP_009123879.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=618

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            AD+DSD +ALLEF++ VPH RKLNWN+T PIC SWTGI CSK+  +
Sbjct  18   ADIDSDKQALLEFASLVPHARKLNWNTTNPICTSWTGITCSKNNSR  63



>gb|KDP21848.1| hypothetical protein JCGZ_00635 [Jatropha curcas]
Length=657

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            P   ADL+SD +ALL F+A+VPHRRKLNWNST P+C +W GI C+
Sbjct  20   PQTSADLNSDKQALLNFAAAVPHRRKLNWNSTTPVCKTWVGITCN  64



>emb|CDY27986.1| BnaC05g43880D [Brassica napus]
Length=631

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  181  DLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            D+D+D +ALLEF++ VPH RKLNWN+T+PIC SWTGI CSK+  +
Sbjct  21   DIDTDKQALLEFASLVPHVRKLNWNTTIPICTSWTGITCSKNNAR  65



>ref|XP_004241083.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Solanum lycopersicum]
Length=593

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P I+A+LDSD  ALL+F+ S+PH  KLNWNS L IC SW GI C+KD
Sbjct  21   PHIIANLDSDKHALLQFAVSIPHLSKLNWNSALSICNSWIGITCNKD  67



>ref|XP_010322111.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Solanum lycopersicum]
Length=594

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P I+A+LDSD  ALL+F+ S+PH  KLNWNS L IC SW GI C+KD
Sbjct  21   PHIIANLDSDKHALLQFAVSIPHLSKLNWNSALSICNSWIGITCNKD  67



>ref|XP_007017100.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY34719.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=671

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            P  ++DL+SD +AL++F+A+VPHRR LNWN T PIC SW G+KC++D    L
Sbjct  57   PLTISDLNSDKEALVDFAAAVPHRRNLNWNLTNPICTSWIGVKCTQDNSSVL  108



>ref|XP_002520893.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF41602.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=581

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P I+ADL+SD +ALL+F+A+VPH RKLNWN+++ +C SW G+ C+ +G +
Sbjct  21   PQIIADLNSDKQALLDFAAAVPHIRKLNWNTSISVCSSWFGVTCNSNGTR  70



>ref|XP_011080640.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=640

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            P  + DL+SD +ALL FSA+VPH RKLNWN+  PIC SW GI CS+DG
Sbjct  28   PLALGDLNSDRQALLAFSAAVPHGRKLNWNAASPICTSWIGINCSEDG  75



>gb|EYU35188.1| hypothetical protein MIMGU_mgv1a002709mg [Erythranthe guttata]
Length=645

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            +DLDSD +ALLEF A VPH RKLNWNST  IC SW GI C+KD
Sbjct  25   SDLDSDAEALLEFVAKVPHARKLNWNSTNSICNSWIGITCTKD  67



>ref|XP_007011393.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY20203.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=634

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKC  297
            P ++ADL+SD +ALL+F+A+VPH RKLNWN+T P+C SW G+ C
Sbjct  25   PQVLADLNSDRQALLDFAAAVPHARKLNWNATAPVCTSWVGVTC  68



>ref|XP_007011392.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20202.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKC  297
            P ++ADL+SD +ALL+F+A+VPH RKLNWN+T P+C SW G+ C
Sbjct  25   PQVLADLNSDRQALLDFAAAVPHARKLNWNATAPVCTSWVGVTC  68



>ref|XP_006371315.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|ERP49112.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=630

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            P I+ADL+SD +ALL+F+A+VPH RKLNWN++  +C SW GI C+ +G
Sbjct  21   PQIIADLNSDRQALLDFAAAVPHIRKLNWNASTSVCTSWVGITCNTNG  68



>ref|XP_009126766.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brassica 
rapa]
Length=651

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            +ADL+SD +ALL F+ASVPH RKLNWNST  IC SW G+ C+ DG
Sbjct  35   IADLNSDRQALLSFAASVPHLRKLNWNSTNHICKSWVGVTCTSDG  79



>ref|XP_006371316.1| hypothetical protein POPTR_0019s09010g [Populus trichocarpa]
 gb|ERP49113.1| hypothetical protein POPTR_0019s09010g [Populus trichocarpa]
Length=655

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            P I+ADL+SD +ALL+F+A+VPH RKLNWN++  +C SW GI C+ +G
Sbjct  46   PQIIADLNSDRQALLDFAAAVPHIRKLNWNASTSVCTSWVGITCNTNG  93



>ref|XP_010244554.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244555.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244556.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244557.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244558.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=642

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            +ADL+SD +ALL+F  +VPH RKLNWNS+ PIC +W G+ CS+DG +
Sbjct  25   IADLNSDRQALLDFVDAVPHGRKLNWNSSSPICSTWVGVTCSQDGTR  71



>emb|CDY32713.1| BnaA02g07750D [Brassica napus]
Length=651

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            +ADL+SD +ALL F+ASVPH RKLNWNST  IC SW G+ C+ DG
Sbjct  35   IADLNSDRQALLSFAASVPHLRKLNWNSTNHICKSWVGVTCTSDG  79



>emb|CDX88667.1| BnaA03g09820D [Brassica napus]
Length=625

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            VADL+SD +ALL F+ASVPH R+LNWNST  IC SW G+ C+ DG + L
Sbjct  44   VADLNSDKQALLSFAASVPHLRRLNWNSTNHICKSWVGVTCTPDGTRVL  92



>ref|XP_009132067.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brassica 
rapa]
Length=650

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            VADL+SD +ALL F+ASVPH R+LNWNST  IC SW G+ C+ DG + L
Sbjct  44   VADLNSDKQALLSFAASVPHLRRLNWNSTNHICKSWVGVTCTPDGTRVL  92



>gb|KDP21623.1| hypothetical protein JCGZ_03294 [Jatropha curcas]
Length=632

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P I+ADL+SD +AL++F+A+VPH RKLNWNS   IC SW GI C  +G +
Sbjct  23   PQIIADLNSDTQALVDFAAAVPHIRKLNWNSGTSICASWFGISCDSNGTR  72



>ref|XP_010999642.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X3 [Populus euphratica]
Length=630

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            P I+ADL+SD +ALL F+A+VPH RKLNWN++  +C SW GI C+ +G
Sbjct  21   PQIIADLNSDRQALLNFAAAVPHIRKLNWNASTSVCTSWVGITCNTNG  68



>ref|XP_010999639.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999640.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999641.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=655

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            P I+ADL+SD +ALL F+A+VPH RKLNWN++  +C SW GI C+ +G
Sbjct  46   PQIIADLNSDRQALLNFAAAVPHIRKLNWNASTSVCTSWVGITCNTNG  93



>ref|XP_010999638.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=656

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            P I+ADL+SD +ALL F+A+VPH RKLNWN++  +C SW GI C+ +G
Sbjct  47   PQIIADLNSDRQALLNFAAAVPHIRKLNWNASTSVCTSWVGITCNTNG  94



>ref|XP_006280146.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
 gb|EOA13044.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
Length=658

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            +ADL+SD +ALL F+ASVPH R+LNWNST  IC SW G+ C+ DG + L
Sbjct  42   IADLNSDRQALLAFAASVPHLRRLNWNSTNHICKSWVGVTCTSDGTRVL  90



>gb|KHF99691.1| hypothetical protein F383_18108 [Gossypium arboreum]
Length=609

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            +VADLDSD +ALLEF+  VPH +KLNWN   P+C SW GI C+ +G
Sbjct  23   VVADLDSDKQALLEFANGVPHVKKLNWNLATPVCTSWVGITCNTNG  68



>ref|XP_008456255.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008456256.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
Length=630

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            ADL+SD +ALL+F++SVPHRR L+WN T  +C SW G+ CS DG   L
Sbjct  24   ADLESDKQALLDFASSVPHRRSLDWNDTTSVCTSWVGVTCSADGTHVL  71



>ref|XP_010483401.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483402.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483407.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483408.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            ADL+SD +ALL F+ASVPH R+LNWNST  IC SW G+ C+ DG + L
Sbjct  41   ADLNSDRQALLAFAASVPHLRRLNWNSTNQICKSWVGVTCTSDGTRVL  88



>ref|XP_006435960.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486130.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR49200.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=638

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            P +VADL+SD +ALL+F+ +VPH RKLNWN+  P+C SW G+ C+
Sbjct  32   PTVVADLNSDKQALLDFADAVPHARKLNWNAAAPVCSSWIGVTCN  76



>gb|KDO67579.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
 gb|KDO67580.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
Length=627

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            P +VADL+SD +ALL+F+ +VPH RKLNWN+  P+C SW G+ C+
Sbjct  21   PTVVADLNSDKQALLDFADAVPHARKLNWNAAAPVCSSWIGVTCN  65



>ref|XP_006435961.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486131.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486132.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR49201.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=627

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            P +VADL+SD +ALL+F+ +VPH RKLNWN+  P+C SW G+ C+
Sbjct  21   PTVVADLNSDKQALLDFADAVPHARKLNWNAAAPVCSSWIGVTCN  65



>emb|CDY58565.1| BnaC03g12450D [Brassica napus]
Length=653

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            +ADL+SD +ALL F+ASVPH R+LNWNST  IC SW G+ C+ DG + L
Sbjct  42   LADLNSDRQALLSFAASVPHLRRLNWNSTNHICKSWVGVTCTPDGTRVL  90



>gb|KCW50324.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
 gb|KCW50325.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
Length=630

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P +VADL+SD +ALL F+++VPH RKLNW+ ++PIC SW GI C+ D
Sbjct  22   PLVVADLNSDVQALLGFASAVPHARKLNWSPSIPICSSWVGITCNVD  68



>ref|XP_010031063.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031064.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031065.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031066.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 gb|KCW50323.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
Length=633

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P +VADL+SD +ALL F+++VPH RKLNW+ ++PIC SW GI C+ D
Sbjct  22   PLVVADLNSDVQALLGFASAVPHARKLNWSPSIPICSSWVGITCNVD  68



>ref|NP_200638.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_001119458.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9LVM0.1|Y5830_ARATH RecName: Full=Probable inactive receptor kinase At5g58300; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAA96921.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL57654.1| unknown protein [Arabidopsis thaliana]
 gb|AAN64529.1| At5g58299/At5g58299 [Arabidopsis thaliana]
 gb|ACN59396.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97030.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AED97031.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=654

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            +ADL+SD +ALL F+ASVPH R+LNWNST  IC SW G+ C+ DG
Sbjct  42   IADLNSDRQALLAFAASVPHLRRLNWNSTNHICKSWVGVTCTSDG  86



>gb|ACA61611.1| hypothetical protein AP2_E06.2 [Arabidopsis lyrata subsp. petraea]
Length=658

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            +ADL+SD +ALL F+ASVPH R+LNWNST  IC SW G+ C+ DG
Sbjct  42   IADLNSDRQALLAFAASVPHLRRLNWNSTNHICKSWVGVTCTSDG  86



>ref|XP_003519295.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006575457.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_006575458.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=654

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P  +ADL SD +ALL+F+A+VPHRR L WN   PIC SW GI C+ +G +
Sbjct  41   PLAIADLSSDKQALLDFAAAVPHRRNLKWNPATPICSSWVGITCNPNGTR  90



>ref|XP_008239856.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=634

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P + +DL+SD +ALL+F+A+VPHRR L WN   P+C SW GI C+++G +
Sbjct  20   PLVFSDLNSDKQALLDFAAAVPHRRNLTWNPASPVCTSWVGITCNRNGTR  69



>ref|XP_002864562.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40821.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=658

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            +ADL+SD +ALL F+ASVPH R+LNWNST  IC SW G+ C+ DG
Sbjct  42   IADLNSDRQALLAFAASVPHLRRLNWNSTNHICKSWVGVTCTSDG  86



>ref|XP_010443551.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443552.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443553.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=661

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            ADL+SD +ALL F+ASVPH R+LNWNST  IC SW G+ C+ DG + L
Sbjct  46   ADLNSDRQALLAFAASVPHLRRLNWNSTNQICKSWFGVTCTSDGTRVL  93



>gb|KDO54913.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=682

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P   ADL+SD +ALL+F+ +VPH RKLNW+ST PIC SW GI C++D
Sbjct  68   PLAFADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQD  114



>gb|KDO54914.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
 gb|KDO54915.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=635

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P   ADL+SD +ALL+F+ +VPH RKLNW+ST PIC SW GI C++D
Sbjct  21   PLAFADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQD  67



>ref|XP_006432052.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464957.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006464958.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR45292.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=635

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P   ADL+SD +ALL+F+ +VPH RKLNW+ST PIC SW GI C++D
Sbjct  21   PLAFADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQD  67



>gb|KDO54912.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=672

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P   ADL+SD +ALL+F+ +VPH RKLNW+ST PIC SW GI C++D
Sbjct  58   PLAFADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQD  104



>ref|XP_006432053.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464956.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR45293.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=672

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P   ADL+SD +ALL+F+ +VPH RKLNW+ST PIC SW GI C++D
Sbjct  58   PLAFADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQD  104



>ref|XP_006401105.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
 gb|ESQ42558.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
Length=650

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            +ADL+SD +ALL F+AS PH R+LNWNST  IC SW G+ C+ DG + L
Sbjct  36   IADLNSDRQALLAFAASAPHLRRLNWNSTNHICKSWVGVTCTSDGTRVL  84



>ref|XP_003544939.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=656

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            P ++ADL SD +ALL+F+A+VPHRR L WN   PIC SW GI C+
Sbjct  41   PLVIADLSSDKQALLDFAAAVPHRRNLKWNPATPICSSWVGITCN  85



>ref|XP_010453493.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453499.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453515.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            ADL+SD +ALL F++SVPH R+LNWNST  IC SW G+ C+ DG + L
Sbjct  41   ADLNSDRQALLAFASSVPHLRRLNWNSTNQICKSWVGVTCTSDGTRVL  88



>ref|XP_010683449.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=641

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADL++D +ALL+FSA +PH RK+NWNST P+C +W GI CS D
Sbjct  22   ADLENDKQALLQFSALIPHGRKVNWNSTTPVCTAWVGITCSSD  64



>ref|XP_010683445.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683446.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683447.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683448.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=643

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADL++D +ALL+FSA +PH RK+NWNST P+C +W GI CS D
Sbjct  22   ADLENDKQALLQFSALIPHGRKVNWNSTTPVCTAWVGITCSSD  64



>ref|XP_011089537.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Sesamum indicum]
Length=655

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            P    DL SD +ALL FSA+VPH RKLNWN   PIC +W GI CS DG
Sbjct  40   PVACGDLSSDKQALLAFSAAVPHGRKLNWNPASPICTTWIGINCSVDG  87



>ref|XP_011089538.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
 ref|XP_011089539.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
Length=636

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            P    DL SD +ALL FSA+VPH RKLNWN   PIC +W GI CS DG
Sbjct  21   PVACGDLSSDKQALLAFSAAVPHGRKLNWNPASPICTTWIGINCSVDG  68



>dbj|BAK08005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=451

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ADL+SD +ALL F+AS+PH RKLNW+ST P+C SW G+ C+ D  +
Sbjct  25   ADLNSDKQALLAFAASLPHGRKLNWSSTTPVCTSWVGVTCTPDNSR  70



>gb|EMT17815.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=634

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ADL+SD +ALL F+AS+PH RKLNW+ST P+C SW G+ C+ D  +
Sbjct  25   ADLNSDKQALLAFAASLPHGRKLNWSSTTPVCTSWVGVTCTPDNSR  70



>ref|XP_002456542.1| hypothetical protein SORBIDRAFT_03g038110 [Sorghum bicolor]
 gb|EES01662.1| hypothetical protein SORBIDRAFT_03g038110 [Sorghum bicolor]
Length=635

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADL+SD +ALL F+AS+PH RKLNW+ST P+C SW G+ C+ D
Sbjct  25   ADLNSDKQALLAFAASLPHGRKLNWSSTTPVCTSWVGVTCTPD  67



>gb|KJB67957.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
 gb|KJB67958.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
 gb|KJB67959.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
Length=609

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            +VADLDSD +ALLEF+  VPH +KLNWN   P+C SW GI C+ +
Sbjct  23   VVADLDSDKQALLEFANGVPHVKKLNWNLATPVCTSWVGITCNTN  67



>ref|XP_010558411.1| PREDICTED: probable inactive receptor kinase At3g08680 [Tarenaya 
hassleriana]
Length=603

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            +AD+ SD +ALLEF++ VPH RKLNWN + PIC SWTG+ CS++
Sbjct  18   MADIQSDSEALLEFASLVPHGRKLNWNPSNPICDSWTGVTCSQN  61



>ref|NP_001130388.1| uncharacterized LOC100191484 precursor [Zea mays]
 gb|ACF78585.1| unknown [Zea mays]
 gb|AFW84760.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=637

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADL+SD +ALL F+AS+PH RKLNW+ST P+C SW G+ C+ D
Sbjct  25   ADLNSDKQALLAFAASLPHGRKLNWSSTTPVCTSWVGVTCTPD  67



>ref|XP_009374410.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=634

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P + +DL SD +ALL+F+ +VPHRRKL+WN   P+C SW GI C+ +G +
Sbjct  20   PLVFSDLTSDKQALLDFANAVPHRRKLSWNPATPVCTSWVGITCTPNGTR  69



>ref|XP_010541472.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010541473.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
Length=628

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            ADL SD +ALL F A+VPHRR+LNWNST  +C SW G+ C+ DG + L
Sbjct  29   ADLVSDQQALLAFVAAVPHRRRLNWNSTNHVCKSWVGVTCTPDGARVL  76



>ref|XP_010541471.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Tarenaya hassleriana]
Length=652

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            ADL SD +ALL F A+VPHRR+LNWNST  +C SW G+ C+ DG + L
Sbjct  53   ADLVSDQQALLAFVAAVPHRRRLNWNSTNHVCKSWVGVTCTPDGARVL  100



>ref|XP_010043603.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 gb|KCW88397.1| hypothetical protein EUGRSUZ_A00785 [Eucalyptus grandis]
Length=613

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADLDSD +ALL+F+ ++PH RKLNW ++ PIC SW GI CSK+
Sbjct  23   ADLDSDKQALLQFANAIPHGRKLNWTASSPICTSWVGITCSKN  65



>ref|XP_009798129.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798130.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798131.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=625

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            P  + DL+SD +ALL F+A+VPH  K+NWN   PIC SW GI CS DG
Sbjct  21   PLSLGDLNSDRQALLNFAAAVPHGLKINWNPATPICSSWVGITCSTDG  68



>ref|XP_003564492.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
Length=633

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ADL+SD +ALL F+AS+PH RKLNW+ST P+C SW G+ C+ D  +
Sbjct  24   ADLNSDKQALLAFAASLPHGRKLNWSSTTPLCTSWVGVTCTPDNSR  69



>ref|XP_009410507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P   ADL SD +ALL F+ASVPH RKLNW+S  PIC SW G+ C+ D
Sbjct  21   PLTTADLSSDEEALLAFAASVPHGRKLNWSSQNPICSSWVGVTCTPD  67



>dbj|BAB62593.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB93368.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAY76289.1| hypothetical protein OsI_04221 [Oryza sativa Indica Group]
Length=637

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P   ADL+SD +ALL F+AS+PH RKLNW+S  P+C SW G+ C+ D  +
Sbjct  21   PAKSADLNSDKQALLAFAASLPHGRKLNWSSAAPVCTSWVGVTCTPDNSR  70



>ref|XP_008384658.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=634

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P + +DL SD +ALL+F+ +VPHRRKL+WN   P+C SW GI C+ +G +
Sbjct  20   PLVFSDLTSDRQALLDFADAVPHRRKLSWNPATPVCTSWVGITCTPNGTR  69



>gb|EYU36891.1| hypothetical protein MIMGU_mgv1a0177022mg, partial [Erythranthe 
guttata]
Length=369

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            P   ADL S+ +ALL FS + PH RKLNW+  LP+C SW GI CS DG
Sbjct  6    PLSYADLSSETQALLAFSTATPHGRKLNWSPALPVCTSWIGINCSTDG  53



>gb|KDP45679.1| hypothetical protein JCGZ_17286 [Jatropha curcas]
Length=634

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADL+SD +ALL FSA+VPHRR LNWNST  +C SW G+ C  +
Sbjct  22   ADLNSDKQALLNFSAAVPHRRLLNWNSTSSVCNSWVGVTCDSN  64



>ref|XP_010931391.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931392.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931393.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=636

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADL+SD +ALL F A++PH RKLNW+S  PIC SW G+ C+ D
Sbjct  25   ADLNSDKQALLAFVAAIPHERKLNWSSKTPICSSWVGVTCTPD  67



>ref|XP_009592168.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=652

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            P  + DLDSD +ALL F+++VPH  K+NW+   PIC SW GI CS+DG
Sbjct  42   PLTLGDLDSDKQALLAFASAVPHGPKINWSPATPICSSWVGITCSEDG  89



>ref|XP_006644911.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=630

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ADL+SD +ALL F+AS+PH RKLNW+S+ P+C SW G+ C+ D  +
Sbjct  25   ADLNSDKQALLAFAASLPHGRKLNWSSSAPVCTSWVGVTCTPDNSR  70



>ref|XP_011084790.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084791.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084792.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084793.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084794.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084795.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084796.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084797.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084800.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=635

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  181  DLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            DL++D +ALL+F+A+VPH RKLNW ST  IC SW GI C+KD
Sbjct  27   DLNTDARALLDFAAAVPHVRKLNWESTNSICTSWIGITCTKD  68



>ref|XP_007208318.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
 gb|EMJ09517.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
Length=634

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P + +DL SD +ALL+F+A+VPHRR L WN   P+C SW GI C+ +G +
Sbjct  20   PLVFSDLHSDKQALLDFAAAVPHRRNLTWNPASPVCTSWVGITCNLNGTR  69



>ref|XP_010094441.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB56022.1| putative inactive receptor kinase [Morus notabilis]
Length=634

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            P  +ADLDSD +ALL+F+A+VPH R L W+   P+C SW G+ C++D  + L
Sbjct  20   PLAIADLDSDKQALLKFAAAVPHLRNLKWDPATPVCTSWIGVNCTEDHTRVL  71



>ref|XP_009337799.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=636

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            +AD+DSD +ALL+F +SVPH R++NW+   P+C SW GI C+ DG + L
Sbjct  20   IADIDSDKQALLDFISSVPHGRRVNWDPANPVCKSWVGITCTLDGTRVL  68



>ref|XP_008366817.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
 ref|XP_008366818.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=636

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            +AD+DSD KALL+F ++VPH R++NW+   P+C SW GI C+ DG +
Sbjct  20   IADIDSDKKALLDFISAVPHGRRVNWDPANPVCKSWVGITCTLDGTR  66



>ref|XP_004302522.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466405.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=633

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            +ADL SD +ALL+F + VPH RK+NW+ST P+C +W GI C+ +G + L
Sbjct  20   IADLSSDKQALLDFISVVPHGRKVNWDSTTPVCNTWVGITCTLNGTRVL  68



>ref|XP_007142022.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 ref|XP_007142023.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14016.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14017.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
Length=655

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P + ADL SD +ALL+F+A+VPHRR L WN    IC SW G+ C+ +G +
Sbjct  41   PMVFADLSSDKQALLDFAAAVPHRRDLKWNPATSICTSWVGVTCNPNGTR  90



>ref|XP_006374053.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP51850.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            VA L SD +ALLEF+++VPH  KLNWNS+ PIC SW GI C+ +G +
Sbjct  22   VAALLSDRQALLEFASAVPHSPKLNWNSSTPICTSWVGIACNTEGSR  68



>ref|XP_008788112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=636

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            +ADL+SD +ALL F A++PH RKLNW+S  PIC SW GI C+ +  + L
Sbjct  24   IADLNSDKQALLAFLAAIPHGRKLNWSSKTPICSSWVGITCTPNQTRVL  72



>ref|NP_001055854.1| Os05g0480400 [Oryza sativa Japonica Group]
 gb|AAT01376.1| putative phytosulfokine receptor kinase [Oryza sativa Japonica 
Group]
 dbj|BAF17768.1| Os05g0480400 [Oryza sativa Japonica Group]
 gb|EAY98442.1| hypothetical protein OsI_20356 [Oryza sativa Indica Group]
 dbj|BAG99879.1| unnamed protein product [Oryza sativa Japonica Group]
Length=638

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            ADL+SD +ALL F+ASVPH RKLNW  T  +C SW GI C+ DG
Sbjct  25   ADLNSDRQALLAFAASVPHGRKLNWTLTTQVCTSWVGITCTPDG  68



>gb|EEE64112.1| hypothetical protein OsJ_18944 [Oryza sativa Japonica Group]
Length=638

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            ADL+SD +ALL F+ASVPH RKLNW  T  +C SW GI C+ DG
Sbjct  25   ADLNSDRQALLAFAASVPHGRKLNWTLTTQVCTSWVGITCTPDG  68



>ref|XP_008376328.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=635

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            +++DL+SDG+ALL F+ +V H RKLNWN+++P+C SW GI C+
Sbjct  23   VLSDLNSDGQALLNFAGTVVHTRKLNWNASIPVCTSWVGITCN  65



>ref|XP_009363779.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=635

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            +++DL+SDG+ALL F+ +V H RKLNWN+++P+C SW GI C+
Sbjct  23   VLSDLNSDGQALLNFAGTVVHTRKLNWNASIPVCTSWVGITCN  65



>ref|XP_010543666.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 isoform X2 [Tarenaya hassleriana]
Length=675

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            +VA+L SD +ALL F A+ PH RKLNWNS LPIC SW G+ C+
Sbjct  68   VVANLVSDQQALLNFVAAFPHPRKLNWNSGLPICASWIGVTCN  110



>ref|XP_008463277.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463278.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463279.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463281.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463282.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463283.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
Length=640

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            I ADL+SD KALL+F ++VPH RK+NW+ + P+C +W GI C+ D
Sbjct  22   IAADLNSDQKALLDFISTVPHGRKINWDPSTPVCTTWVGITCTSD  66



>ref|XP_007141331.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 ref|XP_007141332.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 gb|ESW13325.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 gb|ESW13326.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
Length=644

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            IVADL+SD +ALLEF ++VPH  +LNW+ + PIC SW G+ C+K+
Sbjct  23   IVADLNSDRQALLEFFSNVPHAPRLNWSESTPICTSWAGVTCNKN  67



>ref|XP_010543665.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 isoform X1 [Tarenaya hassleriana]
Length=712

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            +VA+L SD +ALL F A+ PH RKLNWNS LPIC SW G+ C+
Sbjct  105  VVANLVSDQQALLNFVAAFPHPRKLNWNSGLPICASWIGVTCN  147



>ref|XP_004961732.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Setaria 
italica]
Length=632

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ADL+SD +ALL F+AS+PH RKLNW ST  +C SW GI C+ +G +
Sbjct  25   ADLNSDKQALLAFAASLPHGRKLNWTSTTQVCTSWVGITCTPNGKR  70



>emb|CDP13882.1| unnamed protein product [Coffea canephora]
Length=639

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            I+ADL+SD +ALL+F+ SVPH RKLNW+S   IC SW GI C+KD
Sbjct  23   IIADLNSDRQALLDFAKSVPHLRKLNWSSGAQICRSWNGITCNKD  67



>ref|XP_004970381.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Setaria 
italica]
Length=635

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADL+SD +ALL F+AS+PH +KLNW+ST P+C +W G+ C+ D
Sbjct  25   ADLNSDKQALLAFAASLPHGKKLNWSSTTPVCTTWVGVTCTPD  67



>ref|XP_009384331.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384332.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384333.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384334.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384335.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADL SD +ALL F+ SVPH RKLNW S  PIC SW G+ C+ D
Sbjct  25   ADLSSDEQALLAFAMSVPHGRKLNWTSQSPICSSWVGVTCTPD  67



>ref|XP_006842563.1| hypothetical protein AMTR_s00077p00144650 [Amborella trichopoda]
 gb|ERN04238.1| hypothetical protein AMTR_s00077p00144650 [Amborella trichopoda]
Length=399

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADL+SD +ALL F+  VPH RKLNW+  +PIC SWTGI C+ +
Sbjct  28   ADLNSDEQALLAFAKEVPHGRKLNWSPLIPICPSWTGITCNPE  70



>ref|XP_010098027.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB74410.1| putative inactive receptor kinase [Morus notabilis]
Length=711

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            +AD+DSD +ALL+F ++VPH RK+NWN   P+C +W GI C+ +G
Sbjct  100  IADIDSDKEALLDFISAVPHGRKVNWNPATPVCKTWVGITCNLNG  144



>tpg|DAA57078.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=637

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADL+SD +ALL F+AS+P  RKLNW+ST P+C SW G+ C+ D
Sbjct  24   ADLNSDKQALLAFAASLPRGRKLNWSSTTPVCTSWVGVTCTPD  66



>gb|EYU42048.1| hypothetical protein MIMGU_mgv1a003031mg [Erythranthe guttata]
Length=614

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P I ADL+SD ++LL+F++SVPH  +LNW +T  IC SW+G+ C+ D  +
Sbjct  23   PKITADLNSDRESLLDFASSVPHAPRLNWKNTSSICSSWSGVTCTPDATR  72



>gb|EPS74415.1| hypothetical protein M569_00340 [Genlisea aurea]
Length=629

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  184  LDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            L+SD  ALLEF+A+VPH RKLNW S   IC SW+GI CS+DG  
Sbjct  24   LNSDASALLEFAAAVPHVRKLNWQSANSICTSWSGITCSRDGTH  67



>gb|KHN40011.1| Putative inactive receptor kinase [Glycine soja]
Length=449

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            I ADL+SD +ALLEF ++VPH  +LNW+ + PIC SW G+ C+++G
Sbjct  23   IEADLNSDRQALLEFFSNVPHAPRLNWSDSTPICTSWAGVTCNQNG  68



>ref|XP_004172749.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At5g58300-like [Cucumis sativus]
Length=638

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            I ADL+SD +ALL+F +SVPH RK+NW+ + P+C +W G+ C+ D
Sbjct  22   IAADLNSDQEALLDFISSVPHGRKINWDPSTPVCTTWVGVTCTSD  66



>ref|XP_004142674.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 gb|KGN54462.1| hypothetical protein Csa_4G334730 [Cucumis sativus]
Length=638

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            I ADL+SD +ALL+F +SVPH RK+NW+ + P+C +W G+ C+ D
Sbjct  22   IAADLNSDQEALLDFISSVPHGRKINWDPSTPVCTTWVGVTCTSD  66



>ref|XP_008355739.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=639

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            +AD++SD +ALL+F ++VPH RK+NW+   P+C SW GI C+ DG + L
Sbjct  20   IADINSDKQALLDFISAVPHGRKVNWDPANPVCKSWAGITCTLDGTRVL  68



>gb|EYU23390.1| hypothetical protein MIMGU_mgv1a003016mg [Erythranthe guttata]
Length=615

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  184  LDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            L++D +ALL+FS ++ H R LNWNS LP+C +WTGI CS+DG +
Sbjct  30   LETDKQALLDFSYNLRHSRPLNWNSQLPVCKNWTGITCSEDGSR  73



>ref|XP_009370892.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009370912.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=639

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            +AD++SD +ALL+F ++VPH RK+NW+   P+C SW GI C+ DG + L
Sbjct  20   IADINSDKQALLDFISAVPHGRKVNWDPANPVCKSWAGITCTLDGTRVL  68



>ref|XP_004502808.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004502809.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
 ref|XP_004502810.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Cicer arietinum]
Length=644

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADL+SD +ALLEF+++VPH  +LNWN + PIC SW G+ C+ +
Sbjct  27   ADLNSDRQALLEFASAVPHAPRLNWNDSFPICTSWVGVTCNSN  69



>ref|XP_003518282.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=648

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            I ADL+SD +ALLEF ++VPH  +LNW+ + PIC SW G+ C+++G
Sbjct  23   IEADLNSDKQALLEFFSNVPHAPRLNWSESTPICTSWAGVTCNQNG  68



>ref|XP_006654545.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=638

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ADL+SD +ALL F+AS+PH RKLNW  T  +C SW G+ C+ DG +
Sbjct  25   ADLNSDRQALLTFAASLPHGRKLNWTLTTQVCTSWVGVTCTTDGKR  70



>ref|XP_009355011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009355020.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=623

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            P + +DL SD +ALL+F+ +VPHRR  +WN   P+C SW G+ C+ +G
Sbjct  20   PVVFSDLTSDKQALLDFADAVPHRRNFSWNPATPVCTSWVGVNCTPNG  67



>ref|XP_010109178.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXC21107.1| putative inactive receptor kinase [Morus notabilis]
Length=635

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ++ADL SD +ALL FSAS+ H ++LNWN++ P+C SW G+ C+  G +
Sbjct  23   VLADLKSDRQALLNFSASIIHTKRLNWNASTPVCSSWIGVTCNAKGTR  70



>ref|XP_007220535.1| hypothetical protein PRUPE_ppa002812mg [Prunus persica]
 gb|EMJ21734.1| hypothetical protein PRUPE_ppa002812mg [Prunus persica]
Length=631

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            ++ADL+SD +ALL+F+A+V H +KLNWN+  P+C SW GI C+
Sbjct  23   VIADLNSDRQALLKFAAAVGHTQKLNWNAAAPVCASWVGITCN  65



>ref|XP_010922781.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922782.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922783.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922784.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922785.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922786.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=635

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            +ADL+SD +ALL F+ ++PH  KLNW+S  PIC SW G+ C+ D
Sbjct  24   IADLNSDKEALLAFAVAIPHGHKLNWSSNTPICSSWVGVACTPD  67



>ref|XP_003544853.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=650

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            I ADL+SD +ALLEF ++VPH  +LNW+ + PIC SW G+ C+++G
Sbjct  23   IEADLNSDRQALLEFFSNVPHAPRLNWSDSTPICTSWAGVTCNQNG  68



>ref|XP_002441272.1| hypothetical protein SORBIDRAFT_09g023570 [Sorghum bicolor]
 gb|EES19702.1| hypothetical protein SORBIDRAFT_09g023570 [Sorghum bicolor]
Length=633

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            +DL++D +ALL F+AS+PH RK+NW ST  +C SW GI C+ DG +
Sbjct  25   SDLNTDKQALLAFAASLPHGRKVNWTSTTQVCTSWVGITCTLDGTR  70



>ref|XP_011001675.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X3 [Populus euphratica]
Length=586

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            VA L SD +ALLEF+++VPH  KLNW S++PIC SW GI C+  G +
Sbjct  23   VAALLSDRQALLEFASAVPHSPKLNWKSSIPICTSWVGITCNTKGSR  69



>ref|XP_009607078.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=625

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
            P  + D++S+ +ALL+F+A++PH  K+NWN   PIC SW GI CS DG
Sbjct  21   PLSLGDINSEKQALLDFAAALPHGWKINWNPATPICSSWVGITCSTDG  68



>ref|XP_011001674.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=631

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            VA L SD +ALLEF+++VPH  KLNW S++PIC SW GI C+  G +
Sbjct  23   VAALLSDRQALLEFASAVPHSPKLNWKSSIPICTSWVGITCNTKGSR  69



>ref|XP_011001671.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011001672.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=632

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            VA L SD +ALLEF+++VPH  KLNW S++PIC SW GI C+  G +
Sbjct  23   VAALLSDRQALLEFASAVPHSPKLNWKSSIPICTSWVGITCNTKGSR  69



>gb|KEH34523.1| LRR receptor-like kinase [Medicago truncatula]
Length=650

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P  +ADL+SD +ALL+F   VPHR+ L WN +  IC SW GI C++DG +
Sbjct  32   PLAIADLNSDKQALLDFINVVPHRKNLMWNPSTSICTSWVGITCNQDGTR  81



>ref|XP_003600547.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES70798.1| LRR receptor-like kinase [Medicago truncatula]
Length=660

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P  +ADL+SD +ALL+F   VPHR+ L WN +  IC SW GI C++DG +
Sbjct  42   PLAIADLNSDKQALLDFINVVPHRKNLMWNPSTSICTSWVGITCNQDGTR  91



>ref|XP_009386109.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386110.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386111.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=633

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
             +L SD +ALL+F+ASVPH RKLNW+S  P+C SW GI C+ D
Sbjct  25   GNLTSDMQALLKFAASVPHGRKLNWSSRTPVCTSWVGITCTPD  67



>ref|XP_008234182.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=601

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            ++ADL+SD +ALL F+A+V H +KLNWN+  P+C SW GI C+
Sbjct  23   VIADLNSDRQALLNFAAAVGHTQKLNWNAAAPVCASWVGITCN  65



>ref|XP_004490727.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004490728.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
Length=653

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P ++ADL+SD +ALL+F++++PHRR L W+S   IC +W GI C+ +
Sbjct  41   PLVIADLNSDKQALLDFASAIPHRRNLKWDSATSICTAWVGITCNPN  87



>ref|XP_011011771.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011772.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011773.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011774.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011775.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
Length=635

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P  ++DL SD +ALL+F+A VPH RKLNWN    +C SW G+ C+ +G +
Sbjct  20   PFAISDLKSDKQALLDFAAVVPHSRKLNWNPASLVCKSWVGVTCNSNGTR  69



>ref|XP_009758202.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=652

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P  + DLDSD + LL F+++VPH  K+NW+   PIC SW GI CS+D
Sbjct  42   PLALGDLDSDKQVLLAFASAVPHGPKINWSPATPICSSWVGITCSED  88



>ref|XP_003568238.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
Length=634

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ADL+SD +ALL F+AS+PH +K+NW  T  +C SW G+ C+ DG +
Sbjct  25   ADLNSDKQALLAFAASLPHGKKINWTRTTQVCTSWVGVTCTPDGKR  70



>ref|XP_008803002.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803003.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803004.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=635

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            ADL+SD +ALL F+A++PH  KLNW+S  PIC SW G+ C+ +  + L
Sbjct  25   ADLNSDKEALLAFAAAIPHGHKLNWSSKTPICSSWVGVTCTPNHSRVL  72



>ref|XP_011073578.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=631

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +1

Query  169  GIVAD--LDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            G VA+  L+SD  ALL+F   +PH R LNW+  LP+C +WTGI CS+DG +
Sbjct  24   GSVAETLLESDKNALLDFVNKLPHLRSLNWSEELPVCRNWTGISCSEDGSR  74



>gb|AAL76166.1|AF348333_1 candidate plant disease resistance protein [Glycine max]
Length=228

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P  +ADL SD +ALL F+ +VPHRR L WN +  +C SW GI C+++
Sbjct  52   PLAIADLSSDKQALLNFANAVPHRRNLMWNPSTSVCSSWVGITCNEN  98



>gb|KDP25339.1| hypothetical protein JCGZ_20495 [Jatropha curcas]
Length=627

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            AD   D +ALL+F++++PH R LNWN + P+C +WTGI CS+D
Sbjct  22   ADPVEDMRALLDFASNLPHSRSLNWNESYPVCNNWTGITCSED  64



>ref|XP_004500388.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cicer 
arietinum]
Length=647

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P  ++DL+SD +ALL+F+ +VPHRR L W+ +  IC SW GI C+++G +
Sbjct  29   PLAISDLNSDKQALLDFANAVPHRRNLMWDPSTSICTSWIGITCNQNGTR  78



>gb|AES98409.2| LRR receptor-like kinase [Medicago truncatula]
Length=604

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            +ADL SD  +LLEFS+++PH  +LNWN++ PIC SW GI C+++
Sbjct  24   LADLISDKYSLLEFSSTLPHALRLNWNNSTPICTSWIGITCNQN  67



>ref|XP_003615451.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
Length=658

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            +ADL SD  +LLEFS+++PH  +LNWN++ PIC SW GI C+++
Sbjct  24   LADLISDKYSLLEFSSTLPHALRLNWNNSTPICTSWIGITCNQN  67



>ref|XP_003523287.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006578848.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_006578849.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
 ref|XP_006578850.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X4 [Glycine max]
 ref|XP_006578851.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X5 [Glycine max]
Length=640

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNW-NSTLPICGSWTGIKCSKDGXQ  315
            IVADL+SD  ALLEF++SVPH  +LNW N +  IC SW G+ C+ +G +
Sbjct  23   IVADLNSDQHALLEFASSVPHAPRLNWKNDSASICTSWVGVTCNSNGTR  71



>ref|XP_006602049.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=668

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P  +ADL SD +ALL+F+ +VPHRR L WN +  +C SW GI C+++
Sbjct  57   PLAIADLSSDKQALLDFANAVPHRRNLMWNPSTSVCTSWVGITCNEN  103



>ref|XP_006602050.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=667

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P  +ADL SD +ALL+F+ +VPHRR L WN +  +C SW GI C+++
Sbjct  56   PLAIADLSSDKQALLDFANAVPHRRNLMWNPSTSVCTSWVGITCNEN  102



>ref|NP_196135.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 sp|Q9FHK7.1|Y5516_ARATH RecName: Full=Probable leucine-rich repeat receptor-like protein 
kinase At5g05160; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09692.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59361.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED90835.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=640

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSK  303
            + ADL SD +ALL F+ASVPH  KLNWN  L +C SW GI C +
Sbjct  25   VSADLASDEQALLNFAASVPHPPKLNWNKNLSLCSSWIGITCDE  68



>ref|XP_009362770.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=654

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 53/83 (64%), Gaps = 7/83 (8%)
 Frame = +1

Query  64   SSIIIWQPRLLAAIKKIAMRIHlllaavasvfflP----GIVADLDSDGKALLEFSASVP  231
            S I  W  +LL ++ KI M++ +    +  +F +P     + +DL+SD +ALL F+A+V 
Sbjct  5    SQITSW--KLLGSLHKI-MKLQVSFCTLIFLFLIPPFPSSVFSDLNSDRQALLNFAATVV  61

Query  232  HRRKLNWNSTLPICGSWTGIKCS  300
            H +KLNWN++ P+C SW GI CS
Sbjct  62   HIKKLNWNASTPVCTSWVGITCS  84



>ref|XP_003553192.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006602051.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X4 [Glycine max]
Length=654

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P  +ADL SD +ALL+F+ +VPHRR L WN +  +C SW GI C+++
Sbjct  43   PLAIADLSSDKQALLDFANAVPHRRNLMWNPSTSVCTSWVGITCNEN  89



>ref|XP_004308997.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011470006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=643

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            ++ADL+SD +ALL+F+A+V H +KLNWN + P+C SW GI C+
Sbjct  24   VIADLNSDKQALLDFAANVFHTQKLNWNGSTPVCSSWIGITCN  66



>ref|XP_006398978.1| hypothetical protein EUTSA_v10012946mg [Eutrema salsugineum]
 gb|ESQ40431.1| hypothetical protein EUTSA_v10012946mg [Eutrema salsugineum]
Length=639

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKC  297
            + ADL SD +ALL F+ASVPH  KLNWN  L +C SW GI C
Sbjct  27   VSADLASDEQALLNFAASVPHPPKLNWNKNLSLCSSWIGITC  68



>ref|XP_006602052.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X5 [Glycine max]
Length=640

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P  +ADL SD +ALL+F+ +VPHRR L WN +  +C SW GI C+++
Sbjct  29   PLAIADLSSDKQALLDFANAVPHRRNLMWNPSTSVCTSWVGITCNEN  75



>ref|XP_008649769.1| PREDICTED: probable inactive receptor kinase At5g58300 [Zea mays]
 ref|XP_008649770.1| PREDICTED: probable inactive receptor kinase At5g58300 [Zea mays]
 gb|AFW78394.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=634

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            +DL++D +ALL F+AS+PH RK+NW ST  +C SW GI C+ D
Sbjct  25   SDLNTDKQALLAFAASLPHGRKVNWTSTTQVCTSWVGITCTPD  67



>ref|XP_003537367.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006591268.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=671

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P  +ADL SD +ALL F+ +VPHRR L WN +  +C SW GI C+++
Sbjct  57   PLAIADLSSDKQALLNFANAVPHRRNLMWNPSTSVCSSWVGITCNEN  103



>ref|XP_006591269.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=670

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P  +ADL SD +ALL F+ +VPHRR L WN +  +C SW GI C+++
Sbjct  56   PLAIADLSSDKQALLNFANAVPHRRNLMWNPSTSVCSSWVGITCNEN  102



>emb|CDX98821.1| BnaC09g50140D [Brassica napus]
Length=628

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKC  297
            ADL SD +ALL F+ASVPH  KLNWN  L +C SW GI C
Sbjct  23   ADLASDEQALLSFAASVPHPPKLNWNKNLSLCSSWIGITC  62



>gb|KFK24939.1| hypothetical protein AALP_AA8G045400 [Arabis alpina]
Length=630

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKC  297
            + ADL SD +ALL F+ASVPH  KLNWN  L +C SW GI C
Sbjct  23   VSADLASDEQALLNFAASVPHPPKLNWNKNLSLCTSWIGITC  64



>gb|KHN25793.1| Putative inactive receptor kinase [Glycine soja]
Length=642

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNS-TLPICGSWTGIKCSKDGXQ  315
            IVADL+SD +ALLEF++SVPH  +LNW   ++ IC SW G+ C+ +G +
Sbjct  23   IVADLNSDQQALLEFASSVPHAPRLNWKKDSVSICTSWVGVTCNSNGTR  71



>ref|XP_003526789.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoformX1 
[Glycine max]
 ref|XP_003526790.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoformX2 
[Glycine max]
 ref|XP_006581706.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=642

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNS-TLPICGSWTGIKCSKDGXQ  315
            IVADL+SD +ALLEF++SVPH  +LNW   ++ IC SW G+ C+ +G +
Sbjct  23   IVADLNSDQQALLEFASSVPHAPRLNWKKDSVSICTSWVGVTCNSNGTR  71



>ref|XP_007140053.1| hypothetical protein PHAVU_008G080500g [Phaseolus vulgaris]
 gb|ESW12047.1| hypothetical protein PHAVU_008G080500g [Phaseolus vulgaris]
Length=607

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            P   ADL S+ +ALL+F+A++ H  +LNWNS+  IC SW G+ CS DG   L
Sbjct  20   PQTRADLHSEKQALLDFAAALHHAPRLNWNSSTSICTSWMGVACSHDGSHVL  71



>ref|XP_010452417.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 [Camelina sativa]
Length=638

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKC  297
            + ADL SD +ALL F+ASVPH  KLNWN  L +C SW GI C
Sbjct  24   VSADLASDEQALLNFAASVPHPPKLNWNKNLSLCTSWIGITC  65



>ref|XP_002533837.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF28551.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=635

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            +ADL+SD +ALL FSA++PH R LNWN    IC SW G+ C+
Sbjct  22   IADLNSDKQALLNFSAAIPHYRLLNWNPASSICKSWVGVTCN  63



>ref|XP_007146903.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
 gb|ESW18897.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
Length=657

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P ++ DL SD +ALL+F+ ++PHRR L WN +  +C SW GI C+++
Sbjct  43   PLVIGDLSSDKQALLDFANAIPHRRNLMWNPSTSVCESWVGITCNEN  89



>ref|XP_007136405.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 ref|XP_007136406.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 gb|ESW08399.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 gb|ESW08400.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
Length=640

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNW-NSTLPICGSWTGIKCSKDGXQ  315
            IVADL SD +ALLEF++SVPH  +LNW N +  IC SW G+ C+ +G +
Sbjct  23   IVADLKSDQQALLEFASSVPHAPRLNWKNDSASICTSWVGVTCNSNGTR  71



>ref|XP_011041759.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041760.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041761.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041762.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=636

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P   ADL SD +ALL+F+ +VPH RKLNWN    +C SW G+ C+ +
Sbjct  20   PFAFADLKSDKQALLDFATAVPHLRKLNWNPASSVCNSWVGVTCNSN  66



>ref|XP_002325632.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEF00014.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=636

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P   ADL SD +ALL+F+ +VPH RKLNWN    +C SW G+ C+ +
Sbjct  20   PFAFADLKSDKQALLDFATAVPHLRKLNWNPASSVCNSWVGVTCNSN  66



>ref|XP_002528709.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF33698.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=633

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            P  +A+L SD +ALL F A+VPH +KLNW+ST  +C SW GI C+
Sbjct  20   PQTIANLYSDKQALLNFVAAVPHSQKLNWSSTTSVCTSWIGITCN  64



>ref|XP_002319979.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEE95902.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=635

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P  ++DL SD +ALL+F+A VPH RKLNWN    +C SW G+ C+ +
Sbjct  20   PFAISDLKSDKQALLDFAAVVPHSRKLNWNPASLVCKSWVGVTCNSN  66



>ref|XP_010104998.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXC02955.1| putative inactive receptor kinase [Morus notabilis]
Length=646

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            +D   D +ALL+F   +PH R LNWN T P+CG WTGI CS D  + L
Sbjct  22   SDPLEDKQALLDFMTKLPHSRPLNWNETSPVCGHWTGITCSDDKSRVL  69



>ref|XP_003616055.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES99013.1| receptor-like kinase [Medicago truncatula]
Length=651

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P  +ADL+SD +ALL+F++++PHRR L W+    IC SW GI C+ +  +
Sbjct  40   PLAIADLNSDKQALLDFASAIPHRRNLKWDPATSICTSWIGITCNPNSTR  89



>ref|XP_009406050.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406051.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406052.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=631

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            + +L SD +ALL+F+AS+PH RKLNW+S   +C SW G+ C+ D
Sbjct  23   IGNLTSDMQALLKFAASIPHGRKLNWSSRTSVCSSWVGVTCTPD  66



>ref|XP_010670041.1| PREDICTED: probable inactive receptor kinase At5g58300 [Beta 
vulgaris subsp. vulgaris]
Length=635

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P I ADL+SD +ALL F+A+VPH RKLNWN    IC +W G+ C+ +
Sbjct  21   PLICADLNSDRQALLNFAANVPHGRKLNWNVASEICTTWAGVTCNTE  67



>ref|XP_010251541.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
 ref|XP_010251542.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
 ref|XP_010251543.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
Length=636

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            PG  AD   D +ALL+F  S+PH R LNWN T P+C  WTG+ C+ D
Sbjct  19   PG-AADPVEDKQALLDFVNSIPHSRYLNWNQTCPVCDCWTGVTCNSD  64



>ref|XP_010055829.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055830.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055831.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055832.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW72378.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
 gb|KCW72379.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
 gb|KCW72380.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
Length=634

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ADL  D +ALL+F+ ++PH R LNW  + P+C +W G+ C KDG +
Sbjct  26   ADLAGDKQALLDFADNLPHSRYLNWTESSPVCSNWVGVTCDKDGSR  71



>gb|KEH35517.1| receptor-like kinase [Medicago truncatula]
Length=635

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ADL+SD +ALLEF+++VPH  +LNWN +  IC SW G+ C+ +
Sbjct  27   ADLNSDRQALLEFASAVPHAPRLNWNESSSICTSWVGVTCNSN  69



>ref|XP_009122125.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 [Brassica rapa]
 emb|CDX70172.1| BnaA10g25210D [Brassica napus]
Length=624

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKC  297
            ADL SD +ALL F++SVPH  KLNWN  L +C SW GI C
Sbjct  20   ADLASDEQALLSFASSVPHPPKLNWNKNLSLCSSWIGITC  59



>ref|XP_002871141.1| hypothetical protein ARALYDRAFT_325150 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47400.1| hypothetical protein ARALYDRAFT_325150 [Arabidopsis lyrata subsp. 
lyrata]
Length=638

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKC  297
            + ADL SD +ALL F+ASVPH  KLNWN    +C SW GI C
Sbjct  25   VSADLASDEEALLNFAASVPHPPKLNWNKNFSLCSSWIGITC  66



>ref|XP_011080874.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=631

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  184  LDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            L+SD +ALL+F++   H R LNWN   P+C +WTG+ CS+DG +
Sbjct  31   LESDKQALLDFASKFAHLRPLNWNEQYPVCKNWTGVTCSEDGNR  74



>ref|XP_007207849.1| hypothetical protein PRUPE_ppa022997mg, partial [Prunus persica]
 gb|EMJ09048.1| hypothetical protein PRUPE_ppa022997mg, partial [Prunus persica]
Length=623

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            +ADL+SD +ALL F + VPH RK+NW+    +C SW GI C+ DG + L
Sbjct  10   IADLNSDKQALLGFISVVPHGRKVNWDPANAVCSSWVGITCTLDGTRVL  58



>ref|XP_006602721.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_003551618.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
Length=607

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            ADL S+ +ALL+F+A++ H  K+NWNS+  IC SW G+ CS DG   L
Sbjct  24   ADLQSEKQALLDFAAALHHGPKVNWNSSTSICTSWVGVTCSHDGSHVL  71



>gb|KHN40609.1| Putative inactive receptor kinase [Glycine soja]
Length=607

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            ADL S+ +ALL+F+A++ H  K+NWNS+  IC SW G+ CS DG   L
Sbjct  24   ADLQSEKQALLDFAAALHHGPKVNWNSSTSICTSWVGVTCSHDGSHVL  71



>ref|XP_010323112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=627

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
             DL+ D +ALL+F+A+VPH  K+NW+   PIC SW G+ CS D
Sbjct  25   GDLNLDRQALLDFAAAVPHGWKINWDPATPICSSWVGVTCSND  67



>ref|XP_008244579.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244587.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244595.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244604.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244609.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
Length=633

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            +ADL+SD +ALL F + VPH RK+NW+    +C SW GI C+ DG + L
Sbjct  20   IADLNSDRQALLGFISVVPHGRKVNWDPANAVCSSWVGITCTLDGTRVL  68



>gb|EMT10528.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=640

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ADL+SD +ALL F++S+P  RK+NW  T  +C SW G+ C+ DG +
Sbjct  25   ADLNSDKQALLAFASSLPRARKINWTLTTQVCTSWVGVTCTPDGKR  70



>ref|XP_007040424.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040425.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040426.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24925.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24926.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24927.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=626

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ADL  D +ALL+F  ++ H R LNWN T P+C +WTG+ C+ DG +
Sbjct  22   ADLIEDKQALLDFVNNLRHSRSLNWNETSPVCNNWTGVTCNADGSR  67



>ref|XP_009362808.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At3g08680 [Pyrus x bretschneideri]
Length=530

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  184  LDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            L+SD +ALL F+A+V H RKLNWN++ P+C SW GI C+
Sbjct  27   LNSDRQALLNFAATVVHIRKLNWNASTPVCTSWVGITCN  65



>ref|XP_010423497.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 [Camelina sativa]
Length=639

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  181  DLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKC  297
            DL SD +ALL F+ASVPH  KLNWN  L +C SW GI C
Sbjct  27   DLASDEQALLNFAASVPHPPKLNWNKNLSLCTSWIGITC  65



>ref|XP_010491047.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 [Camelina sativa]
Length=639

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  181  DLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKC  297
            DL SD +ALL F+ASVPH  KLNWN  L +C SW GI C
Sbjct  27   DLASDEQALLNFAASVPHPPKLNWNKNLSLCTSWIGITC  65



>ref|XP_008388374.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=627

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            + +DL+SD +ALL F+A+V H  KLNWN++ P+C SW GI C+
Sbjct  23   VFSDLNSDRQALLNFAATVVHIXKLNWNASTPVCXSWVGITCN  65



>ref|XP_004490516.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004490517.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
 ref|XP_004490518.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Cicer arietinum]
Length=624

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            I+ADL+SD K+LLEFS+++ H  +LNWN + PIC +W G+ C+++
Sbjct  24   IIADLNSDRKSLLEFSSTLQHAPRLNWNGSTPIC-TWIGVTCNQN  67



>ref|XP_011026938.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Populus euphratica]
 ref|XP_011026939.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Populus euphratica]
Length=626

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            +D   D +ALL+F  ++PH R LNWN + P+C +WTG+ CS DG +
Sbjct  22   SDPVEDKQALLDFVNNLPHSRSLNWNESSPVCNNWTGVICSGDGTR  67



>ref|XP_006587908.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
 gb|KHN29485.1| Putative inactive receptor kinase [Glycine soja]
Length=607

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQKL  321
            P   A+L S+ +ALL+F+A++ H  K+NWNS+  IC SW G+ CS DG   L
Sbjct  20   PHTKANLHSEKQALLDFAAALHHGPKVNWNSSTSICTSWVGVTCSHDGSHVL  71



>ref|XP_002299495.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE84300.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            +D   D +ALL+F  ++PH R LNWN + P+C +WTG+ CS DG +
Sbjct  22   SDPVEDKQALLDFVNNLPHSRSLNWNESSPVCNNWTGVICSGDGTR  67



>ref|XP_010653698.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Vitis vinifera]
 ref|XP_010653699.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Vitis vinifera]
Length=667

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKC  297
            +ADL+SD +ALLEF+  VPH R +NW+    IC SW GIKC
Sbjct  54   IADLESDKQALLEFAFVVPHVRTINWSPATAICISWVGIKC  94



>ref|XP_010653700.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Vitis vinifera]
 emb|CBI32886.3| unnamed protein product [Vitis vinifera]
Length=634

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKC  297
            +ADL+SD +ALLEF+  VPH R +NW+    IC SW GIKC
Sbjct  21   IADLESDKQALLEFAFVVPHVRTINWSPATAICISWVGIKC  61



>ref|XP_011026937.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Populus euphratica]
Length=652

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            +D   D +ALL+F  ++PH R LNWN + P+C +WTG+ CS DG +
Sbjct  48   SDPVEDKQALLDFVNNLPHSRSLNWNESSPVCNNWTGVICSGDGTR  93



>ref|XP_006476438.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Citrus 
sinensis]
Length=625

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  DGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            D +ALL+F  ++PH R LNWN +  +C  WTG+KCS+DG +
Sbjct  27   DKEALLDFVNNLPHSRSLNWNESTSVCNHWTGVKCSEDGKR  67



>gb|KDO76442.1| hypothetical protein CISIN_1g006922mg [Citrus sinensis]
Length=625

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  DGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            D +ALL+F  ++PH R LNWN +  +C  WTG+KCS+DG +
Sbjct  27   DKEALLDFVNNLPHSRSLNWNESTSVCNHWTGVKCSEDGKR  67



>ref|XP_008388375.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=635

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCS  300
            + +DL+SD +ALL F+A+V H  KLNWN + P+C SW GI C+
Sbjct  23   VFSDLNSDRQALLNFAATVVHIXKLNWNXSTPVCXSWVGITCN  65



>ref|XP_011095165.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011095166.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=643

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  VADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            +ADL SD +ALL+F+++V H  KLNW +T  +C SW G+ C+ D  +
Sbjct  30   IADLKSDTQALLDFASAVAHAPKLNWKNTSSVCSSWVGVSCTSDATR  76



>ref|XP_006439412.1| hypothetical protein CICLE_v10019314mg [Citrus clementina]
 gb|ESR52652.1| hypothetical protein CICLE_v10019314mg [Citrus clementina]
Length=625

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  DGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            D +ALL+F  ++PH R LNWN +  +C  WTG+KCS+DG +
Sbjct  27   DKEALLDFVNNLPHSRSLNWNESASVCNHWTGVKCSEDGKR  67



>ref|XP_009772876.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=648

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ++ADL SD +ALL+F+++VPH RK  WN+   IC +W G+ C+ DG +
Sbjct  22   VIADLSSDRQALLDFASAVPHLRKFTWNTNSSIC-TWHGVSCNSDGTR  68



>ref|XP_007210296.1| hypothetical protein PRUPE_ppa002579mg [Prunus persica]
 gb|EMJ11495.1| hypothetical protein PRUPE_ppa002579mg [Prunus persica]
Length=656

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            AD   D +ALL+F  ++PH R LNWN + P+C  WTG+ CS+D
Sbjct  49   ADPVEDKQALLDFVNNLPHSRSLNWNESSPVCDHWTGVTCSED  91



>ref|XP_006356869.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006356870.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=653

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            ++ADL SD +ALL+F+++VPH R   WN+   IC +W G+ CS DG +
Sbjct  25   VIADLSSDRQALLDFASAVPHLRNFKWNTNSSIC-TWHGVSCSSDGTR  71



>ref|XP_008239079.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
 ref|XP_008239080.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
Length=629

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            AD   D +ALL+F  ++PH R LNWN + P+C  WTG+ CS+D
Sbjct  22   ADPVEDKQALLDFVNNLPHSRSLNWNVSSPVCDHWTGVTCSED  64



>ref|XP_002509916.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51303.1| ATP binding protein, putative [Ricinus communis]
Length=536

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            AD   D +ALL+F   + H R LNWN + P+C +WTG+ CSKDG +
Sbjct  22   ADPVEDKQALLDFVNKLHHSRLLNWNESSPVCSNWTGVTCSKDGSR  67



>gb|KJB19053.1| hypothetical protein B456_003G082600 [Gossypium raimondii]
 gb|KJB19054.1| hypothetical protein B456_003G082600 [Gossypium raimondii]
Length=630

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            AD   D +ALL+F   +PH R LNWN T P+C +WTG+ C+  G +
Sbjct  22   ADPVEDKQALLDFVNKMPHSRALNWNQTSPVCNNWTGVTCNAGGSR  67



>ref|XP_010493544.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
 ref|XP_010493545.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
 ref|XP_010493546.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
 ref|XP_010493547.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
Length=613

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            +  DL  D +ALL+F  ++ H R L WN++ P+C +W G+ C KDG +
Sbjct  25   VTGDLAGDRQALLDFLNNITHPRSLTWNASTPVCATWPGVTCDKDGTR  72



>ref|XP_011022559.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=622

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            AD   D +ALL+F   +PH R LNWN + P+C +W+G+ CS DG +
Sbjct  22   ADPVEDKQALLDFVNYLPHSRSLNWNESSPVCKNWSGVICSGDGTR  67



>ref|XP_010421220.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
Length=614

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            +  DL  D +ALL+F  ++ H R L WN++ P+C +W G+ C KDG +
Sbjct  25   VTGDLAGDRQALLDFLNNITHPRSLTWNASTPVCATWPGVTCDKDGTR  72



>ref|XP_009352353.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
 ref|XP_009352354.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=629

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            AD   D +ALL+F  ++PH R LNWN + P+C  WTG+ CS+D
Sbjct  22   ADPVEDKQALLDFLNNLPHSRTLNWNESGPVCDHWTGVTCSED  64



>ref|XP_008392458.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
Length=629

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            AD   D +ALL+F  ++PH R LNWN + P+C  WTG+ CS+D
Sbjct  22   ADPVEDKQALLDFLNNLPHSRTLNWNESGPVCDHWTGVTCSED  64



>ref|XP_006289209.1| hypothetical protein CARUB_v10002657mg [Capsella rubella]
 gb|EOA22107.1| hypothetical protein CARUB_v10002657mg [Capsella rubella]
Length=635

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKC  297
            + AD  SD +ALL F+ASVPH  KLNWN  L  C SW GI C
Sbjct  24   VSADSASDEQALLNFAASVPHPPKLNWNKNLSPCTSWIGITC  65



>ref|XP_004246956.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=633

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P ++ADL SD +ALL+F+++V H R   WN+   IC +W G+ CS DG +
Sbjct  22   PYVIADLTSDRQALLDFASAVAHLRNFKWNTNSSIC-TWHGVSCSSDGTR  70



>ref|XP_006283317.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
 gb|EOA16215.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
Length=635

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +1

Query  169  GIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            G  AD   D +ALLEF   +   R LNWN+T P+C  WTG+ C+KDG +
Sbjct  19   GANADPSEDKRALLEFLTIMRPTRSLNWNATSPVCNIWTGVTCNKDGSR  67



>ref|XP_010550530.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Tarenaya hassleriana]
 ref|XP_010550531.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Tarenaya hassleriana]
Length=625

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            +  DL  D +ALL+F  ++ H R L WN+T P+C +W G+ C +DG +
Sbjct  24   VTGDLAGDRQALLDFLNNITHSRSLVWNATTPVCATWQGVVCDRDGSR  71



>ref|XP_009380537.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=639

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +1

Query  184  LDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            L  D +ALL+F A+ PH R LNW+    +CG WTGI CS DG +
Sbjct  27   LAKDKQALLDFLAAAPHGRGLNWSRATTVCGLWTGITCSADGSR  70



>emb|CDP12117.1| unnamed protein product [Coffea canephora]
Length=635

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  190  SDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            +D +ALL+F   +PH R LNW+   P+C +WTG+ C++DG +
Sbjct  31   NDKQALLDFEKKLPHLRSLNWDENSPVCKNWTGVSCNEDGSR  72



>ref|XP_009590190.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009590191.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=645

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            ++ADL SD +ALL+F+++VPH RK  WN+   IC +W G+ C+ D
Sbjct  22   VIADLSSDRQALLDFASAVPHLRKFTWNTNSSIC-TWHGVSCNSD  65



>ref|XP_004143879.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
 gb|KGN50039.1| hypothetical protein Csa_5G151550 [Cucumis sativus]
Length=628

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            I  D   D  ALL+F  ++PH R LNWN+  P+C  WTGI CS+D
Sbjct  20   INGDPVEDKLALLDFVKNLPHSRSLNWNAASPVCHYWTGITCSQD  64



>ref|XP_004167870.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At4g23740-like [Cucumis sativus]
Length=628

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            I  D   D  ALL+F  ++PH R LNWN+  P+C  WTGI CS+D
Sbjct  20   INGDPVEDKLALLDFVKNLPHSRSLNWNAASPVCHYWTGITCSQD  64



>ref|XP_010053173.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010053174.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW77437.1| hypothetical protein EUGRSUZ_D01777 [Eucalyptus grandis]
Length=634

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  DGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            D +ALL+F  ++PH R LNW+   P+CG W G+ CS DG +
Sbjct  27   DKRALLDFVNNLPHSRNLNWSEDSPVCGHWAGVTCSGDGSR  67



>ref|XP_008437363.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437364.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437365.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437367.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
Length=628

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            I  D   D  ALL+F  ++PH R LNWN+  P+C  WTGI CS+D
Sbjct  20   INGDPVEDKLALLDFVKNLPHSRSLNWNAASPVCHYWTGITCSQD  64



>gb|EPS58213.1| hypothetical protein M569_16602, partial [Genlisea aurea]
Length=493

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDG  309
             DL+ D +ALL+FS++VPH RKLNW+    +C +W G+ CS DG
Sbjct  20   GDLNLDKQALLDFSSAVPHGRKLNWDPFSGVCSNWVGVICSSDG  63



>ref|XP_004294716.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=630

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            P + +DL+SD +ALL+F+ +VPHRR L W+ +  +C SW GI CS +
Sbjct  20   PLVFSDLNSDKQALLDFANAVPHRRNLTWDPSTSVC-SWVGIICSPN  65



>ref|XP_009799943.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
Length=649

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  184  LDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            +++D +ALL+F   +PH   LNW++  PIC +WTG+ CS+DG +
Sbjct  40   VENDKQALLDFVNKLPHLHPLNWDANSPICKNWTGVTCSEDGSR  83



>ref|XP_002463400.1| hypothetical protein SORBIDRAFT_02g043090 [Sorghum bicolor]
 gb|EER99921.1| hypothetical protein SORBIDRAFT_02g043090 [Sorghum bicolor]
Length=639

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P +VADL S+ +ALL+F ++V H  KLNW+    IC SW G+KCS D  Q
Sbjct  25   PLVVADLASEKQALLDFVSAVYHGNKLNWDKNASIC-SWHGVKCSADQSQ  73



>ref|XP_006394667.1| hypothetical protein EUTSA_v10003837mg [Eutrema salsugineum]
 gb|ESQ31953.1| hypothetical protein EUTSA_v10003837mg [Eutrema salsugineum]
Length=615

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  172  IVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            +  DL  D +ALL+F  ++ H R L WN++ PIC +W G+ C +DG +
Sbjct  25   VTGDLAGDRQALLDFLNNITHPRSLAWNASSPICATWPGVTCDRDGTR  72



>ref|XP_004492584.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cicer 
arietinum]
Length=611

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  PGIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            P   ADL+S+ +ALL+F  +V H  K+NW+ +  IC SW GI CS DG  
Sbjct  20   PQTKADLNSEKQALLDFIDAVHHGEKVNWSFSTSICTSWVGISCSPDGSH  69



>ref|XP_002303623.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE78602.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            AD   D +ALL+F   +PH R LNW  + P+C +W+G+ CS DG +
Sbjct  22   ADPVEDKQALLDFVHYLPHSRSLNWKESSPVCNNWSGVICSGDGTR  67



>ref|XP_010541406.1| PREDICTED: probable inactive receptor kinase At4g23740 [Tarenaya 
hassleriana]
Length=621

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            AD   D +ALLEF   +   R LNWN + P+C  WTG+ CS+DG Q
Sbjct  25   ADPVEDKRALLEFQTIMNPTRTLNWNESSPVCNIWTGVTCSQDGSQ  70



>ref|XP_004300851.1| PREDICTED: probable inactive receptor kinase At4g23740 [Fragaria 
vesca subsp. vesca]
Length=635

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +1

Query  178  ADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKD  306
            AD   D +ALL+F  + PH R LNW+S  P+C  WTG+ CS D
Sbjct  23   ADPVEDKQALLDFLNNHPHSRSLNWDSNTPVCDHWTGVTCSAD  65



>ref|XP_004245544.1| PREDICTED: probable inactive receptor kinase At4g23740 [Solanum 
lycopersicum]
Length=642

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  169  GIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            G VA L++D +ALL+F   +PH   LNW++   +C +WTG+ C++DG +
Sbjct  28   GTVALLENDKQALLDFVNQLPHLHPLNWDANSSVCKNWTGVGCNEDGSR  76



>ref|XP_006343895.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Solanum 
tuberosum]
Length=642

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  169  GIVADLDSDGKALLEFSASVPHRRKLNWNSTLPICGSWTGIKCSKDGXQ  315
            G VA L++D +ALL+F   +PH   LNW++   +C +WTG+ C++DG +
Sbjct  28   GTVALLENDKQALLDFVNQLPHLHPLNWDANSSVCKNWTGVGCNEDGSR  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564723838400