BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF008O20

Length=247
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006360332.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  75.1    1e-13   Solanum tuberosum [potatoes]
ref|XP_004247828.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  75.1    1e-13   
ref|XP_009784398.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  73.9    3e-13   Nicotiana sylvestris
ref|XP_009619812.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  73.9    3e-13   Nicotiana tomentosiformis
gb|ACV70033.1|  3-ketoacyl CoA thiolase 2                             71.2    2e-12   Petunia x hybrida [garden petunia]
gb|EYU32624.1|  hypothetical protein MIMGU_mgv1a005944mg              70.1    7e-12   Erythranthe guttata [common monkey flower]
gb|AGC59769.1|  3-ketoacyl-CoA thiolase 1                             69.7    8e-12   Rehmannia glutinosa [Chinese foxglove]
gb|AGC24176.1|  3-ketoacyl-CoA thiolase 2                             69.7    8e-12   Rehmannia glutinosa [Chinese foxglove]
ref|XP_011073762.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  66.2    1e-10   Sesamum indicum [beniseed]
emb|CDO99410.1|  unnamed protein product                              65.9    2e-10   Coffea canephora [robusta coffee]
gb|AAQ77242.1|  acetoacetyl CoA thiolase                              63.2    2e-09   Helianthus annuus
gb|KCW57292.1|  hypothetical protein EUGRSUZ_H00090                   60.1    2e-08   Eucalyptus grandis [rose gum]
ref|XP_010069076.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  60.1    2e-08   Eucalyptus grandis [rose gum]
dbj|BAA25250.1|  mutated 3-ketoacyl-CoA thiolase                      56.2    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294172.1|  hypothetical protein CARUB_v10023167mg           57.8    1e-07   Capsella rubella
ref|XP_009132912.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  57.4    2e-07   Brassica rapa
ref|XP_002881265.1|  hypothetical protein ARALYDRAFT_482251           57.4    2e-07   
emb|CAA53078.1|  3-ketoacyl-CoA thiolase B                            57.0    2e-07   Mangifera indica
ref|XP_008457258.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  57.0    2e-07   Cucumis melo [Oriental melon]
ref|XP_010522426.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  57.0    2e-07   Tarenaya hassleriana [spider flower]
gb|AAL25590.1|  At2g33150/F25I18.11                                   56.6    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180873.1|  3-ketoacyl-CoA thiolase 2                           56.6    3e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY37750.1|  BnaA04g19180D                                        56.2    5e-07   Brassica napus [oilseed rape]
gb|EPS68937.1|  hypothetical protein M569_05826                       55.8    6e-07   Genlisea aurea
ref|XP_008372446.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  55.5    7e-07   
ref|XP_009371217.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  55.5    8e-07   Pyrus x bretschneideri [bai li]
ref|XP_010556945.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  55.1    1e-06   Tarenaya hassleriana [spider flower]
gb|KDO43601.1|  hypothetical protein CISIN_1g012506mg                 54.7    1e-06   Citrus sinensis [apfelsine]
gb|KDO43603.1|  hypothetical protein CISIN_1g012506mg                 54.7    1e-06   Citrus sinensis [apfelsine]
gb|KDO43602.1|  hypothetical protein CISIN_1g012506mg                 54.7    1e-06   Citrus sinensis [apfelsine]
gb|KDO43600.1|  hypothetical protein CISIN_1g012506mg                 54.7    1e-06   Citrus sinensis [apfelsine]
gb|KDO43599.1|  hypothetical protein CISIN_1g012506mg                 54.7    2e-06   Citrus sinensis [apfelsine]
ref|XP_006420604.1|  hypothetical protein CICLE_v10004931mg           54.7    2e-06   Citrus clementina [clementine]
ref|NP_001267690.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like      53.9    3e-06   Cucumis sativus [cucumbers]
ref|XP_002299284.2|  hypothetical protein POPTR_0001s14280g           53.5    3e-06   Populus trichocarpa [western balsam poplar]
ref|XP_011002175.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  53.5    4e-06   Populus euphratica
ref|XP_010935683.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  52.0    1e-05   Elaeis guineensis
ref|XP_008349049.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  49.3    1e-05   
ref|XP_010918893.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  51.2    2e-05   Elaeis guineensis
ref|XP_009336051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  51.2    3e-05   
ref|XP_011083116.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  51.2    3e-05   Sesamum indicum [beniseed]
ref|XP_010940650.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  50.8    3e-05   Elaeis guineensis
ref|XP_010509924.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  50.8    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009143894.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  50.8    3e-05   Brassica rapa
ref|XP_010413914.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  50.8    3e-05   Camelina sativa [gold-of-pleasure]
emb|CDY19452.1|  BnaC04g11470D                                        50.4    4e-05   Brassica napus [oilseed rape]
ref|XP_006410451.1|  hypothetical protein EUTSA_v10016622mg           50.4    4e-05   Eutrema salsugineum [saltwater cress]
ref|XP_004290230.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  50.4    4e-05   Fragaria vesca subsp. vesca
emb|CDX79511.1|  BnaC03g18470D                                        50.4    4e-05   
ref|XP_009141289.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  50.4    4e-05   Brassica rapa
emb|CDX84701.1|  BnaA03g15290D                                        50.4    4e-05   
emb|CDY23766.1|  BnaC04g43560D                                        50.1    5e-05   Brassica napus [oilseed rape]
dbj|BAJ85217.1|  predicted protein                                    49.7    6e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011020688.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  49.7    6e-05   Populus euphratica
emb|CAA63598.1|  glyoxysomal beta-ketoacyl-thiolase                   49.7    6e-05   Brassica napus [oilseed rape]
ref|XP_009385864.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  49.7    7e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010933143.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  49.7    7e-05   Elaeis guineensis
gb|AFW74043.1|  hypothetical protein ZEAMMB73_080325                  47.4    8e-05   
ref|XP_007034449.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1  49.7    8e-05   
ref|XP_008804745.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  49.7    8e-05   Phoenix dactylifera
ref|XP_011020687.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  49.7    8e-05   Populus euphratica
ref|XP_010243983.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  49.3    1e-04   Nelumbo nucifera [Indian lotus]
dbj|BAJ87577.1|  predicted protein                                    49.3    1e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009336047.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  48.9    1e-04   
ref|XP_008804452.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  48.9    1e-04   Phoenix dactylifera
ref|XP_010109695.1|  3-ketoacyl-CoA thiolase 2                        48.5    2e-04   Morus notabilis
ref|XP_009796304.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  48.5    2e-04   Nicotiana sylvestris
gb|ACV70032.1|  3-ketoacyl CoA thiolase 1                             48.1    2e-04   Petunia x hybrida [garden petunia]
ref|XP_007225741.1|  hypothetical protein PRUPE_ppa005421mg           48.1    3e-04   
gb|AFW74040.1|  hypothetical protein ZEAMMB73_080325                  47.8    3e-04   
ref|XP_007225742.1|  hypothetical protein PRUPE_ppa005421mg           47.8    3e-04   Prunus persica
ref|XP_006649171.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  47.8    3e-04   Oryza brachyantha
ref|XP_008224585.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  47.8    4e-04   Prunus mume [ume]
gb|AFW74041.1|  hypothetical protein ZEAMMB73_080325                  47.4    4e-04   
ref|NP_001131193.1|  acetyl-CoA C-acyltransferase-like protein        47.4    4e-04   Zea mays [maize]
ref|NP_001241698.1|  3-ketoacyl-CoA thiolase 2, peroxisomal precu...  47.4    5e-04   
ref|XP_006350308.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  46.6    8e-04   Solanum tuberosum [potatoes]
dbj|BAI66423.1|  3-ketoacyl-CoA thiolase-like protein                 46.6    8e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004247103.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  46.6    8e-04   
gb|EMT31542.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                46.6    8e-04   
ref|XP_009629663.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...  46.6    0.001   Nicotiana tomentosiformis



>ref|XP_006360332.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=465

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLLQHLRP+  +SSL++IESS+SASVC+AGDSAAYQ  SV
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSISASVCSAGDSAAYQRTSV  49



>ref|XP_004247828.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=465

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLLQHLRP+  +SSL++IESS+SASVC+AGDSAAYQ  SV
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSISASVCSAGDSAAYQRTSV  49



>ref|XP_009784398.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
sylvestris]
Length=464

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLLQHLRP+  +SSL++IESS++ASVC+AGDSAAYQ  SV
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSIAASVCSAGDSAAYQRTSV  49



>ref|XP_009619812.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
tomentosiformis]
Length=464

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLLQHLRP+  +SSL++IESS++ASVC+AGDSAAYQ  SV
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSIAASVCSAGDSAAYQRTSV  49



>gb|ACV70033.1| 3-ketoacyl CoA thiolase 2 [Petunia x hybrida]
Length=463

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            IERQRVLLQHLRP+  +SSL++++SS+SASVC+AGDSAAYQ  SV
Sbjct  5    IERQRVLLQHLRPSQTSSSLENLDSSISASVCSAGDSAAYQRTSV  49



>gb|EYU32624.1| hypothetical protein MIMGU_mgv1a005944mg [Erythranthe guttata]
Length=464

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            A+ERQRVLLQHLRP+  +SSL+ IESS+SAS+C+AGDSAAY  +SV
Sbjct  4    AVERQRVLLQHLRPSFTSSSLEDIESSLSASICSAGDSAAYHRSSV  49



>gb|AGC59769.1| 3-ketoacyl-CoA thiolase 1 [Rehmannia glutinosa]
Length=464

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            A ERQRVLLQHLRP+  +SSL+ IESSVSAS+C+AGDSAAY  +SV
Sbjct  4    ATERQRVLLQHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRSSV  49



>gb|AGC24176.1| 3-ketoacyl-CoA thiolase 2 [Rehmannia glutinosa]
Length=464

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            A ERQRVLLQHLRP+  +SSL+ IESSVSAS+C+AGDSAAY  +SV
Sbjct  4    ATERQRVLLQHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRSSV  49



>ref|XP_011073762.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Sesamum 
indicum]
Length=464

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AI+RQRVLLQHLRP+  +S+L+ I SSVSAS+C AGDSAAY  +SV
Sbjct  4    AIDRQRVLLQHLRPSFTSSTLEDIGSSVSASICLAGDSAAYHRSSV  49



>emb|CDO99410.1| unnamed protein product [Coffea canephora]
Length=461

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AIERQRV+LQHL+P+  +SSL++++SS+SASVCAAGDSAAY   S
Sbjct  4    AIERQRVVLQHLKPSFTSSSLENLDSSLSASVCAAGDSAAYHRTS  48



>gb|AAQ77242.1| acetoacetyl CoA thiolase [Helianthus annuus]
Length=449

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 4/46 (9%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP++ +SSL+++    S SVCAAGDSAAYQ NSV
Sbjct  4    AIERQRVLLEHLRPSSTSSSLENL----SVSVCAAGDSAAYQRNSV  45



>gb|KCW57292.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=380

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQ  235
            AIERQRVLLQHLRP++++SS+    SS+SAS+CAAGDSAAYQ
Sbjct  4    AIERQRVLLQHLRPSSSSSSVHGDASSLSASICAAGDSAAYQ  45



>ref|XP_010069076.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW57291.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=464

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQ  235
            AIERQRVLLQHLRP++++SS+    SS+SAS+CAAGDSAAYQ
Sbjct  4    AIERQRVLLQHLRPSSSSSSVHGDASSLSASICAAGDSAAYQ  45



>dbj|BAA25250.1| mutated 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
Length=114

 Score = 56.2 bits (134),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NYEASLSASACLAGDSAAYQRTSL  47



>ref|XP_006294172.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
 gb|EOA27070.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
Length=462

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP   ASS  + E+S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRP--CASSSHNFEASLSASACLAGDSAAYQRTSL  47



>ref|XP_009132912.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brassica 
rapa]
Length=460

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 34/46 (74%), Gaps = 4/46 (9%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP    SS  S E S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRP----SSSHSFEGSLSASACLAGDSAAYQRTSL  45



>ref|XP_002881265.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57524.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NFEASLSASACLAGDSAAYQRTSL  47



>emb|CAA53078.1| 3-ketoacyl-CoA thiolase B [Mangifera indica]
Length=430

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AI RQ+VLLQHLRP+N++S   + ES+++ASVCAAGDSAAY   SV
Sbjct  4    AINRQQVLLQHLRPSNSSSH--NYESALAASVCAAGDSAAYHRASV  47



>ref|XP_008457258.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
melo]
Length=461

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AI RQ+VLL HLRP+   SSL S +S +SAS C AGDSAAYQ NSV
Sbjct  4    AINRQKVLLHHLRPS---SSLHSHDSPLSASACLAGDSAAYQRNSV  46



>ref|XP_010522426.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Tarenaya hassleriana]
Length=464

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP+++ S   + E+S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPSSSPSH--NFEASLSASACLAGDSAAYQRTSL  47



>gb|AAL25590.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
Length=390

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NYEASLSASACLAGDSAAYQRTSL  47



>ref|NP_180873.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q56WD9.2|THIK2_ARATH RecName: Full=3-ketoacyl-CoA thiolase 2, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 2; AltName: Full=Beta-ketothiolase 
2; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
2; AltName: Full=Peroxisome defective protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG42910.1|AF327529_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK15577.1|AF349530_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAC04908.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25248.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25249.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK96606.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAL36070.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAM65085.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AEC08791.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=462

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NYEASLSASACLAGDSAAYQRTSL  47



>emb|CDY37750.1| BnaA04g19180D [Brassica napus]
Length=462

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLLQHLRP++++S   S E S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLQHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSL  47



>gb|EPS68937.1| hypothetical protein M569_05826, partial [Genlisea aurea]
Length=457

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 6/46 (13%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            A++RQRVLL+HLRP      +++ ESS+SAS+CAAGDSA Y  +SV
Sbjct  4    AVDRQRVLLRHLRP------IENTESSISASICAAGDSAPYHRSSV  43



>ref|XP_008372446.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=453

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            A+ RQ+VLLQHLRP+++ SS D   +++SAS CAAGDSAAY   S
Sbjct  4    ALNRQKVLLQHLRPSSSVSSPDYESAALSASTCAAGDSAAYHRTS  48



>ref|XP_009371217.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=453

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            A+ RQ+VLLQHLRP+++ SS D   +++SAS CAAGDSAAY   S
Sbjct  4    ALNRQKVLLQHLRPSSSVSSPDYESAALSASTCAAGDSAAYHRTS  48



>ref|XP_010556945.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Tarenaya hassleriana]
Length=463

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSA+YQ  S+
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NFEASLSASACLAGDSASYQRASL  47



>gb|KDO43601.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=437

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY   SV
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSV  47



>gb|KDO43603.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=415

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY   SV
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSV  47



>gb|KDO43602.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=406

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY   SV
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSV  47



>gb|KDO43600.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=438

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY   SV
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSV  47



>gb|KDO43599.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=445

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY   SV
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSV  47



>ref|XP_006420604.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 ref|XP_006489799.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR33844.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 gb|KDO43598.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=462

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY   SV
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSV  47



>ref|NP_001267690.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis sativus]
 emb|CAA47926.1| 3-ketoacyl-CoA thiolase [Cucumis sativus]
 gb|KGN56763.1| hypothetical protein Csa_3G133140 [Cucumis sativus]
Length=462

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AI RQ +LL HLRP+++A +    ESS+SASVCAAGDSA+YQ  SV
Sbjct  4    AINRQSILLHHLRPSSSAYTN---ESSLSASVCAAGDSASYQRTSV  46



>ref|XP_002299284.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
 gb|EEE84089.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
Length=461

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 4/45 (9%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI RQRVLL+HLRP    SS  + ES++SAS C AGDSAAYQ  S
Sbjct  4    AINRQRVLLEHLRP----SSSHNFESTLSASACLAGDSAAYQRTS  44



>ref|XP_011002175.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Populus euphratica]
Length=462

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 3/45 (7%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI RQRVLL HLRP+   SS  + ES++SAS C AGDSAAYQ  S
Sbjct  4    AINRQRVLLDHLRPS---SSSHNFESTLSASACLAGDSAAYQRTS  45



>ref|XP_010935683.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 3/45 (7%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI RQRVLLQHL+P+    SLD   S +SAS+CAAGDS AYQ +S
Sbjct  4    AINRQRVLLQHLQPST--PSLDE-SSMLSASICAAGDSTAYQRSS  45



>ref|XP_008349049.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
Length=129

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQ  235
            A+ RQRVLLQHLRP ++ SS +    ++SAS+CAAG+SAAY 
Sbjct  4    AMNRQRVLLQHLRPNSSVSSSNFESVALSASICAAGNSAAYH  45



>ref|XP_010918893.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 4/45 (9%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI RQRVLLQHLRP++ +        +++ S+CAAGDSAAYQ +S
Sbjct  4    AINRQRVLLQHLRPSSGSDD----RPALTTSICAAGDSAAYQRSS  44



>ref|XP_009336051.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=453

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQ  235
            A+ RQRVLLQHLRP ++ SS +     +SAS+CAAGDSAAY 
Sbjct  4    AMNRQRVLLQHLRPNSSVSSSNYESDPLSASICAAGDSAAYH  45



>ref|XP_011083116.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=463

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQ  235
            A  RQR+LLQHLRPT++ S   S +SS+S S+C AGDSAAY 
Sbjct  4    ATNRQRILLQHLRPTSSVSHQTS-DSSLSPSICLAGDSAAYH  44



>ref|XP_010940650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 3/45 (7%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI RQRVLLQHL+P +++S+   +   +SAS+CAAGDSAAYQ +S
Sbjct  4    AINRQRVLLQHLQPPSSSSNDAPM---LSASICAAGDSAAYQRSS  45



>ref|XP_010509924.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP +++S   S E+S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFEASLSASACLAGDSAAYQRTSL  47



>ref|XP_009143894.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
 emb|CDY17140.1| BnaA05g10480D [Brassica napus]
Length=462

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSL  47



>ref|XP_010413914.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Camelina sativa]
Length=462

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP +++S   S E+S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFEASLSASACLAGDSAAYQRTSL  47



>emb|CDY19452.1| BnaC04g11470D [Brassica napus]
Length=463

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP++++SS  S E S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPSSSSSS-HSFEGSLSASACLAGDSAAYQRTSL  48



>ref|XP_006410451.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
 dbj|BAJ34444.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51904.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
Length=462

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSL  47



>ref|XP_004290230.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Fragaria 
vesca subsp. vesca]
Length=456

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 2/44 (5%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASS-LDSIESSV-SASVCAAGDSAAYQ  235
            A+ RQ+VLLQHLRP ++ SS + + ESSV SA +CAAGDSAAY 
Sbjct  4    ALNRQKVLLQHLRPNSSLSSAIQTHESSVLSAEICAAGDSAAYH  47



>emb|CDX79511.1| BnaC03g18470D [Brassica napus]
Length=462

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSL  47



>ref|XP_009141289.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
Length=462

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSL  47



>emb|CDX84701.1| BnaA03g15290D [Brassica napus]
Length=462

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSL  47



>emb|CDY23766.1| BnaC04g43560D [Brassica napus]
Length=462

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQ  S+
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSL  47



>dbj|BAJ85217.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87964.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQ  235
            A++RQR+LL+HL P   A+  +   S+VSASVCAAGDSAAY 
Sbjct  4    ALDRQRILLRHLEP---AAGANPTASAVSASVCAAGDSAAYH  42



>ref|XP_011020688.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Populus euphratica]
Length=458

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI+RQRVLL HLRP+  + S  + ES++SAS C AGDS AYQ  S
Sbjct  4    AIDRQRVLLDHLRPS--SPSHHNFESTLSASACLAGDSTAYQRTS  46



>emb|CAA63598.1| glyoxysomal beta-ketoacyl-thiolase [Brassica napus]
Length=462

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNSV  247
            A+ERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQ  S+
Sbjct  4    AMERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSL  47



>ref|XP_009385864.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=463

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 2/45 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI+RQRVLL+HLRP+ ++S   S    +SASVCAAGDSAAYQ NS
Sbjct  4    AIDRQRVLLRHLRPSPSSSPNGS--HLISASVCAAGDSAAYQRNS  46



>ref|XP_010933143.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 4/45 (9%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI RQRVLLQH  P++A+        ++S S+CAAGDSAAYQ +S
Sbjct  4    AISRQRVLLQHFHPSSASDD----HPTLSTSICAAGDSAAYQRSS  44



>gb|AFW74043.1| hypothetical protein ZEAMMB73_080325, partial [Zea mays]
Length=145

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 3/45 (7%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQ +S
Sbjct  4    AIDRQRVLLAHLLPSPSAAS---SQPQLAASACAAGDSAAYQRSS  45



>ref|XP_007034449.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOY05375.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=464

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQ  235
            AI RQ++LLQHL P+  +S+  +  S++SAS C AGDSAAYQ
Sbjct  4    AINRQQILLQHLNPSAPSSADQNYNSALSASACLAGDSAAYQ  45



>ref|XP_008804745.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Phoenix dactylifera]
Length=460

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 4/45 (9%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI RQRVLLQHL P++ +        ++S S+CAAGDSAAYQ +S
Sbjct  4    AIGRQRVLLQHLHPSSGSDD----HPTLSTSICAAGDSAAYQRSS  44



>ref|XP_011020687.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Populus euphratica]
Length=460

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI+RQRVLL HLRP+  + S  + ES++SAS C AGDS AYQ  S
Sbjct  4    AIDRQRVLLDHLRPS--SPSHHNFESTLSASACLAGDSTAYQRTS  46



>ref|XP_010243983.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nelumbo nucifera]
Length=460

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 30/42 (71%), Gaps = 4/42 (10%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQ  235
            AI RQRVLL HLRP    SS    +SS+SASVC AGDSAAY 
Sbjct  4    AINRQRVLLDHLRP----SSQTHHQSSLSASVCLAGDSAAYH  41



>dbj|BAJ87577.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 5/45 (11%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI+RQRVLL HL P+ A++      S +SAS CAAGDSAAYQ  S
Sbjct  4    AIDRQRVLLAHLLPSPASAG-----SQLSASACAAGDSAAYQRTS  43



>ref|XP_009336047.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=443

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQ  235
            A+ +Q+VLLQHLRP ++ SS +   + +SAS+CAAGDSAAY 
Sbjct  4    AMNKQKVLLQHLRPNSSVSSSNYESAPLSASICAAGDSAAYH  45



>ref|XP_008804452.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=460

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 4/45 (9%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI RQ VLLQHLRP++          ++SAS+CAAGDSAAYQ +S
Sbjct  4    AINRQSVLLQHLRPSSDFGD----RPALSASICAAGDSAAYQRSS  44



>ref|XP_010109695.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXC24165.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=452

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQ  235
            A ERQRVLLQHL PT   SS  +  +S+SAS+CAAG S AYQ
Sbjct  4    AAERQRVLLQHLSPT---SSQTNDTASLSASICAAGQSGAYQ  42



>ref|XP_009796304.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Nicotiana sylvestris]
Length=486

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQ  235
            AIERQRVLL+HL+P  ++S      SS++ S+C AGDSAAYQ
Sbjct  29   AIERQRVLLEHLQPIRSSSHQ---FSSLTPSICLAGDSAAYQ  67



>gb|ACV70032.1| 3-ketoacyl CoA thiolase 1 [Petunia x hybrida]
Length=462

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 2/42 (5%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQ  235
            AI+RQRVLL+HL+P    +   S  SS++ S+CAAGDSAAYQ
Sbjct  4    AIQRQRVLLEHLQPIRHHTHDHS--SSLTTSICAAGDSAAYQ  43



>ref|XP_007225741.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26940.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=429

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIE-SSVSASVCAAGDSAAYQXNSV  247
            A  RQRVLL HLRP+  +SSL   + SS+SAS C AGDSAAY   +V
Sbjct  4    AFNRQRVLLDHLRPS--SSSLHGTDPSSLSASACVAGDSAAYARKNV  48



>gb|AFW74040.1| hypothetical protein ZEAMMB73_080325 [Zea mays]
Length=378

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 3/45 (7%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQ +S
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSS  45



>ref|XP_007225742.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26941.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=462

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIE-SSVSASVCAAGDSAAYQXNSV  247
            A  RQRVLL HLRP+  +SSL   + SS+SAS C AGDSAAY   +V
Sbjct  4    AFNRQRVLLDHLRPS--SSSLHGTDPSSLSASACVAGDSAAYARKNV  48



>ref|XP_006649171.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=449

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 4/45 (9%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI+RQRVLL HL P++++S+    +  +SAS CAAGDSAAYQ  S
Sbjct  4    AIDRQRVLLAHLLPSSSSSN----QPLLSASACAAGDSAAYQRTS  44



>ref|XP_008224585.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=462

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESS-VSASVCAAGDSAAYQXNSV  247
            A  RQRVLL HLRP+  +SSL   +SS +SAS C AGDSAAY   +V
Sbjct  4    AFNRQRVLLDHLRPS--SSSLHGTDSSSLSASACVAGDSAAYARTNV  48



>gb|AFW74041.1| hypothetical protein ZEAMMB73_080325 [Zea mays]
Length=407

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 3/45 (7%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQ +S
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSS  45



>ref|NP_001131193.1| acetyl-CoA C-acyltransferase-like protein [Zea mays]
 gb|ACF79501.1| unknown [Zea mays]
 gb|AFW74042.1| LOW QUALITY PROTEIN: acetyl-CoA C-acyltransferase-like protein 
[Zea mays]
Length=461

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 3/45 (7%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQ +S
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSS  45



>ref|NP_001241698.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
 gb|ACG36949.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
Length=461

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 3/45 (7%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQ +S
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPHLAASACAAGDSAAYQRSS  45



>ref|XP_006350308.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=456

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 30/45 (67%), Gaps = 8/45 (18%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AIERQRVLL+HL+P  +        SS++ SVC AGDS+AY   S
Sbjct  4    AIERQRVLLEHLQPIRS--------SSITPSVCLAGDSSAYHRTS  40



>dbj|BAI66423.1| 3-ketoacyl-CoA thiolase-like protein [Triticum aestivum]
Length=459

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 6/45 (13%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI+RQRVLL HL P+  ASS    ++ +SAS CAAGDSAAYQ +S
Sbjct  4    AIDRQRVLLAHLLPS--ASS----QTQLSASPCAAGDSAAYQRSS  42



>ref|XP_004247103.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=456

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 30/45 (67%), Gaps = 8/45 (18%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AIERQRVLL+HL+P  +        SS++ SVC AGDS+AY   S
Sbjct  4    AIERQRVLLEHLQPIRS--------SSITPSVCLAGDSSAYHRTS  40



>gb|EMT31542.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Aegilops tauschii]
Length=459

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 6/45 (13%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQXNS  244
            AI+RQRVLL HL P+  ASS    ++ +SAS CAAGDSAAYQ +S
Sbjct  4    AIDRQRVLLAHLLPS--ASS----QTQLSASPCAAGDSAAYQRSS  42



>ref|XP_009629663.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Nicotiana 
tomentosiformis]
Length=494

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  110  AIERQRVLLQHLRPTNAASSLDSIE-SSVSASVCAAGDSAAYQ  235
            AIERQRVLL+HL+P  ++S     + SS++ S+C AGDSAAY+
Sbjct  33   AIERQRVLLEHLQPIRSSSHHTHDQSSSLTPSICLAGDSAAYR  75



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557676237175