BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF008O12

Length=277
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB55588.1|  hypothetical protein B456_009G083700                    114   1e-29   Gossypium raimondii
ref|XP_009587811.1|  PREDICTED: photosystem I subunit O-like            113   2e-29   Nicotiana tomentosiformis
ref|XP_006361086.1|  PREDICTED: uncharacterized protein LOC102602224    108   1e-27   Solanum tuberosum [potatoes]
ref|XP_004241330.1|  PREDICTED: photosystem I subunit O                 108   2e-27   Solanum lycopersicum
ref|XP_008361123.1|  PREDICTED: uncharacterized protein LOC103424...    106   9e-27   Malus domestica [apple tree]
gb|KJB09105.1|  hypothetical protein B456_001G123200                    105   1e-26   Gossypium raimondii
ref|XP_009344568.1|  PREDICTED: photosystem I subunit O-like isof...    105   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_010102022.1|  hypothetical protein L484_016312                   105   2e-26   Morus notabilis
ref|XP_007015746.1|  Photosystem I subunit O                            105   3e-26   
gb|KJB09104.1|  hypothetical protein B456_001G123200                    105   3e-26   Gossypium raimondii
ref|XP_002523852.1|  conserved hypothetical protein                     102   5e-25   Ricinus communis
ref|XP_008361116.1|  PREDICTED: uncharacterized protein LOC103424...    102   5e-25   Malus domestica [apple tree]
ref|XP_009118377.1|  PREDICTED: uncharacterized protein LOC103843400    102   6e-25   Brassica rapa
ref|XP_009344567.1|  PREDICTED: photosystem I subunit O-like isof...    101   8e-25   Pyrus x bretschneideri [bai li]
ref|XP_011088934.1|  PREDICTED: photosystem I subunit O                 101   1e-24   Sesamum indicum [beniseed]
emb|CDP06878.1|  unnamed protein product                                101   1e-24   Coffea canephora [robusta coffee]
ref|XP_010488808.1|  PREDICTED: photosystem I subunit O-like            100   2e-24   Camelina sativa [gold-of-pleasure]
gb|KFK43159.1|  hypothetical protein AALP_AA1G087600                    100   3e-24   Arabis alpina [alpine rockcress]
ref|XP_010694990.1|  PREDICTED: photosystem I subunit O               99.4    5e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009609016.1|  PREDICTED: photosystem I subunit O-like          99.4    5e-24   Nicotiana tomentosiformis
ref|XP_010475635.1|  PREDICTED: photosystem I subunit O-like          99.0    7e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006417699.1|  hypothetical protein EUTSA_v10009047mg           99.0    9e-24   Eutrema salsugineum [saltwater cress]
emb|CDX95064.1|  BnaC05g06070D                                        99.0    9e-24   
ref|XP_010262927.1|  PREDICTED: photosystem I subunit O               99.0    1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_009148097.1|  PREDICTED: uncharacterized protein LOC103871585  98.6    1e-23   Brassica rapa
ref|XP_006305762.1|  hypothetical protein CARUB_v10010597mg           98.6    1e-23   Capsella rubella
gb|KCW87339.1|  hypothetical protein EUGRSUZ_B03824                   97.4    1e-23   Eucalyptus grandis [rose gum]
ref|XP_007206116.1|  hypothetical protein PRUPE_ppa013064mg           98.2    2e-23   Prunus persica
gb|KHG06613.1|  DNA mismatch repair mutL                              98.2    2e-23   Gossypium arboreum [tree cotton]
ref|NP_563815.1|  photosystem I subunit O                             97.4    3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458074.1|  PREDICTED: photosystem I subunit O               97.4    3e-23   Camelina sativa [gold-of-pleasure]
emb|CDY22686.1|  BnaC08g43200D                                        97.1    4e-23   Brassica napus [oilseed rape]
ref|XP_010045182.1|  PREDICTED: photosystem I subunit O               96.7    6e-23   Eucalyptus grandis [rose gum]
ref|XP_004139499.1|  PREDICTED: uncharacterized protein LOC101209111  96.7    6e-23   Cucumis sativus [cucumbers]
ref|XP_002892455.1|  hypothetical protein ARALYDRAFT_470899           96.3    7e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_009793460.1|  PREDICTED: photosystem I subunit O-like          96.3    7e-23   Nicotiana sylvestris
gb|AAM97011.1|  expressed protein                                     95.9    1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AEQ39072.1|  putative chloroplast photosystem I subunit O          95.9    1e-22   Wolffia arrhiza
ref|XP_008463649.1|  PREDICTED: uncharacterized protein LOC103501744  95.5    2e-22   Cucumis melo [Oriental melon]
ref|XP_008229763.1|  PREDICTED: uncharacterized protein LOC103329109  95.5    2e-22   Prunus mume [ume]
gb|ADB77878.1|  chloroplast photosystem I subunit O                   94.7    3e-22   Wolffia arrhiza
ref|XP_002273037.1|  PREDICTED: photosystem I subunit O               95.1    3e-22   Vitis vinifera
ref|XP_010912341.1|  PREDICTED: photosystem I subunit O               94.4    5e-22   Elaeis guineensis
gb|ACZ54009.1|  PsaO                                                  94.0    6e-22   Wolffia arrhiza
ref|XP_010557432.1|  PREDICTED: photosystem I subunit O               94.0    6e-22   Tarenaya hassleriana [spider flower]
ref|XP_002313603.1|  hypothetical protein POPTR_0009s16240g           93.2    1e-21   Populus trichocarpa [western balsam poplar]
gb|ADI45881.1|  sex-linked protein 9                                  92.4    1e-21   Silene latifolia
emb|CDX93566.1|  BnaA06g04820D                                        92.8    2e-21   
ref|XP_008784066.1|  PREDICTED: uncharacterized protein LOC103703121  91.7    5e-21   Phoenix dactylifera
ref|XP_009789385.1|  PREDICTED: photosystem I subunit O-like isof...  91.7    5e-21   Nicotiana sylvestris
emb|CAN83522.1|  hypothetical protein VITISV_019056                   90.9    1e-20   Vitis vinifera
emb|CDY31154.1|  BnaA08g27040D                                        89.7    2e-20   Brassica napus [oilseed rape]
gb|KDO37001.1|  hypothetical protein CISIN_1g032156mg                 88.2    7e-20   Citrus sinensis [apfelsine]
gb|KDO58276.1|  hypothetical protein CISIN_1g032153mg                 88.2    9e-20   Citrus sinensis [apfelsine]
gb|ADI45844.1|  sex-linked protein 9                                  88.2    1e-19   Silene vulgaris [maiden's-tears]
gb|EYU28533.1|  hypothetical protein MIMGU_mgv1a023828mg              87.4    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_006481510.1|  PREDICTED: uncharacterized protein LOC102626023  87.8    2e-19   Citrus sinensis [apfelsine]
ref|XP_006424153.1|  hypothetical protein CICLE_v10029515mg           87.4    2e-19   Citrus clementina [clementine]
ref|XP_009789384.1|  PREDICTED: photosystem I subunit O-like isof...  87.0    3e-19   Nicotiana sylvestris
ref|XP_006384771.1|  hypothetical protein POPTR_0004s20960g           86.3    3e-19   
ref|XP_009340874.1|  PREDICTED: photosystem I subunit O-like          86.7    4e-19   Pyrus x bretschneideri [bai li]
ref|XP_009340870.1|  PREDICTED: photosystem I subunit O-like          85.9    6e-19   Pyrus x bretschneideri [bai li]
gb|AGU28452.1|  photosystem I subunit O                               85.9    8e-19   Sinapis alba [bai jie]
ref|XP_009374967.1|  PREDICTED: photosystem I subunit O-like          85.9    8e-19   Pyrus x bretschneideri [bai li]
ref|XP_006384772.1|  hypothetical protein POPTR_0004s20960g           85.9    8e-19   Populus trichocarpa [western balsam poplar]
ref|XP_011006585.1|  PREDICTED: photosystem I subunit O-like          85.9    9e-19   Populus euphratica
gb|ADH43621.1|  sex-linked protein 9                                  85.9    1e-18   Silene latifolia
ref|XP_006417697.1|  hypothetical protein EUTSA_v10009047mg           84.7    1e-18   
ref|XP_009403671.1|  PREDICTED: photosystem I subunit O isoform X2    85.1    2e-18   
gb|KDP24032.1|  hypothetical protein JCGZ_26726                       84.7    3e-18   Jatropha curcas
gb|AEC10974.1|  16kda membrane protein                                84.7    3e-18   Camellia sinensis [black tea]
gb|AFK44563.1|  unknown                                               83.6    5e-18   Lotus japonicus
ref|XP_011459420.1|  PREDICTED: photosystem I subunit O               83.2    7e-18   Fragaria vesca subsp. vesca
gb|ACJ86143.1|  unknown                                               82.4    2e-17   Medicago truncatula
ref|XP_004506203.1|  PREDICTED: uncharacterized protein LOC101500027  80.5    9e-17   Cicer arietinum [garbanzo]
ref|XP_006846460.1|  hypothetical protein AMTR_s00018p00092490        80.5    1e-16   Amborella trichopoda
ref|XP_006854748.1|  hypothetical protein AMTR_s00030p00247800        79.7    1e-16   
ref|XP_011004353.1|  PREDICTED: photosystem I subunit O-like          80.1    2e-16   Populus euphratica
ref|XP_009403670.1|  PREDICTED: photosystem I subunit O isoform X1    80.1    2e-16   
gb|ADI45826.1|  sex-linked protein 9                                  77.0    9e-16   Silene dioica [morning campion]
gb|AFK38505.1|  unknown                                               77.8    9e-16   Medicago truncatula
gb|ADI45857.1|  sex-linked protein 9                                  76.6    1e-15   Silene latifolia
gb|ADI45862.1|  sex-linked protein 9                                  76.3    1e-15   Silene latifolia
gb|ADI45880.1|  sex-linked protein 9                                  76.3    1e-15   Silene latifolia
gb|ADI45869.1|  sex-linked protein 9                                  76.3    2e-15   Silene latifolia
ref|XP_001778960.1|  PsaO subunit of photosystem I                    77.0    2e-15   
gb|ADI45879.1|  sex-linked protein 9                                  75.9    2e-15   Silene latifolia
gb|ADI45877.1|  sex-linked protein 9                                  75.9    2e-15   Silene latifolia
gb|ADI45849.1|  sex-linked protein 9                                  75.9    2e-15   Silene latifolia
gb|ADI45848.1|  sex-linked protein 9                                  75.5    3e-15   Silene latifolia
ref|XP_007132467.1|  hypothetical protein PHAVU_011G096400g           75.9    4e-15   Phaseolus vulgaris [French bean]
gb|ADI45882.1|  sex-linked protein 9                                  75.1    5e-15   Silene latifolia
gb|ADI45847.1|  sex-linked protein 9                                  74.7    5e-15   Silene latifolia
ref|XP_003579709.1|  PREDICTED: photosystem I subunit O               75.9    5e-15   Brachypodium distachyon [annual false brome]
dbj|BAJ90625.1|  predicted protein                                    74.7    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAH66420.1|  H0622F05.3                                           74.3    2e-14   Oryza sativa [red rice]
gb|ABG75753.1|  salt stress-responsive protein                        74.3    2e-14   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ85402.1|  predicted protein                                    73.9    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADI45845.1|  sex-linked protein 9                                  72.8    3e-14   Silene latifolia
gb|ABB90549.1|  putative membrane protein                             73.9    3e-14   Triticum aestivum [Canadian hard winter wheat]
gb|EMT23727.1|  hypothetical protein F775_30776                       73.6    3e-14   
gb|ABK25454.1|  unknown                                               73.2    6e-14   Picea sitchensis
gb|ADI45883.1|  sex-linked protein 9                                  71.6    7e-14   Silene latifolia
ref|NP_001052755.1|  Os04g0414700                                     72.8    7e-14   
ref|XP_006652269.1|  PREDICTED: uncharacterized protein LOC102704139  72.0    2e-13   
ref|XP_006592347.1|  PREDICTED: uncharacterized protein LOC100809697  70.1    5e-13   Glycine max [soybeans]
gb|KHN21168.1|  hypothetical protein glysoja_006647                   70.5    5e-13   Glycine soja [wild soybean]
ref|XP_004975583.1|  PREDICTED: uncharacterized protein LOC101771677  69.7    9e-13   Setaria italica
gb|ACU20009.1|  unknown                                               69.7    9e-13   Glycine max [soybeans]
emb|CDY68716.1|  BnaAnng28120D                                        69.3    1e-12   Brassica napus [oilseed rape]
gb|ABK21270.1|  unknown                                               68.9    2e-12   Picea sitchensis
ref|NP_001150218.1|  LOC100283848                                     68.6    3e-12   Zea mays [maize]
gb|AHB79078.1|  16 kDa membrane protein                               68.2    4e-12   Saccharum hybrid cultivar [sugarcane]
gb|KHN08815.1|  hypothetical protein glysoja_046343                   67.8    5e-12   Glycine soja [wild soybean]
ref|NP_001236146.1|  uncharacterized protein LOC100305746             67.8    5e-12   
gb|ABK26506.1|  unknown                                               66.2    2e-11   Picea sitchensis
gb|ABK21819.1|  unknown                                               65.9    3e-11   Picea sitchensis
ref|XP_002446437.1|  hypothetical protein SORBIDRAFT_06g016090        64.7    6e-11   Sorghum bicolor [broomcorn]
gb|ACG27280.1|  16kDa membrane protein                                60.8    1e-09   Zea mays [maize]
gb|EMS65275.1|  hypothetical protein TRIUR3_34121                     58.2    1e-08   Triticum urartu
gb|ADI45889.1|  sex-linked protein 9                                  56.2    4e-08   Silene latifolia
gb|ADI45888.1|  sex-linked protein 9                                  46.6    8e-05   Silene latifolia
ref|XP_002976132.1|  hypothetical protein SELMODRAFT_104218           47.0    8e-05   
ref|XP_006417696.1|  hypothetical protein EUTSA_v10009047mg           46.6    1e-04   



>gb|KJB55588.1| hypothetical protein B456_009G083700 [Gossypium raimondii]
Length=148

 Score =   114 bits (284),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT  + STVVGL  ++    S P K  L+S FLK  V+ARNPL+L  AC GKFTCFER
Sbjct  1    MAATFASPSTVVGLGGTATSMSSPPMKTRLSSGFLKSGVTARNPLRLAGACGGKFTCFER  60

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RD NVIGFGLIGWIAPSS+P I
Sbjct  61   DWLRRDFNVIGFGLIGWIAPSSIPAI  86



>ref|XP_009587811.1| PREDICTED: photosystem I subunit O-like [Nicotiana tomentosiformis]
Length=143

 Score =   113 bits (282),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 65/86 (76%), Gaps = 3/86 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAA +   STVVGL  SSL   SSP +  L S FLK  V+ARNPLK+ +A  GKFTCFER
Sbjct  1    MAARMATTSTVVGLVNSSL---SSPKRTSLNSGFLKSQVTARNPLKIAQASGGKFTCFER  57

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDLNVIGFGLIGW+APSS+P I
Sbjct  58   DWLRRDLNVIGFGLIGWLAPSSIPAI  83



>ref|XP_006361086.1| PREDICTED: uncharacterized protein LOC102602224 [Solanum tuberosum]
Length=145

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT+   S+VVGLA SSL   SS  K  L+SDF++  V+ARNPL++ +A  G+ TCF+R
Sbjct  1    MAATM---SSVVGLANSSLSGFSSAKKTSLSSDFVRSPVTARNPLRVAKASGGRVTCFQR  57

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDLNVIGFGLIGW+APSSVP+I
Sbjct  58   DWLRRDLNVIGFGLIGWLAPSSVPVI  83



>ref|XP_004241330.1| PREDICTED: photosystem I subunit O [Solanum lycopersicum]
Length=145

 Score =   108 bits (269),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 3/86 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT+   S+VVGLA SSL   SS  K  L+SDF++  V+ARNPL++ +A  G+ TCF+R
Sbjct  1    MAATM---SSVVGLANSSLSGFSSAKKTSLSSDFMRSPVTARNPLRVAKASGGRVTCFQR  57

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDLNVIGFGLIGW+APSSVP I
Sbjct  58   DWLRRDLNVIGFGLIGWLAPSSVPAI  83



>ref|XP_008361123.1| PREDICTED: uncharacterized protein LOC103424798 isoform X2 [Malus 
domestica]
Length=143

 Score =   106 bits (265),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 66/86 (77%), Gaps = 5/86 (6%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MA ++  ASTV+GL +SSL    SPN+  LTS F+KP V   NPL+  RA  G+FTCF+R
Sbjct  1    MAVSMATASTVIGLGSSSL----SPNRTCLTSGFVKPIVVG-NPLRQVRASGGRFTCFQR  55

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  56   DWLRRDLNVIGFGLIGWLAPSSIPLI  81



>gb|KJB09105.1| hypothetical protein B456_001G123200 [Gossypium raimondii]
Length=116

 Score =   105 bits (262),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT  + STVV L  S+    S PN   L+S FLK +V  RNPL+L  AC GKFTCFER
Sbjct  1    MAATFSSPSTVVRLG-SATSFSSPPNNTCLSSGFLKSSVRGRNPLRLAGACGGKFTCFER  59

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RD NVIGFGLIGWIAPSS+P I
Sbjct  60   DWLRRDFNVIGFGLIGWIAPSSIPAI  85



>ref|XP_009344568.1| PREDICTED: photosystem I subunit O-like isoform X2 [Pyrus x bretschneideri]
Length=143

 Score =   105 bits (263),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 5/86 (6%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAA++  ASTV+GL +SSL    SPN+  L+S F+KP V   NPL+  RA  G+FTCF+R
Sbjct  1    MAASMATASTVMGLGSSSL----SPNRTCLSSGFVKPIVVG-NPLRQVRASGGRFTCFQR  55

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  56   DWLRRDLNVIGFGLIGWLAPSSIPLI  81



>ref|XP_010102022.1| hypothetical protein L484_016312 [Morus notabilis]
 gb|EXB91242.1| hypothetical protein L484_016312 [Morus notabilis]
Length=143

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MA T+  ASTV GL +SSL    S  +  L+S FLK +V+ RNPLK   A  GKFTCFER
Sbjct  1    MATTIATASTVAGLGSSSL---CSTKRTSLSSGFLKSSVAVRNPLKQVSASGGKFTCFER  57

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RD NVIGFGLIGW+APSS+P+I
Sbjct  58   DWLRRDFNVIGFGLIGWLAPSSIPVI  83



>ref|XP_007015746.1| Photosystem I subunit O [Theobroma cacao]
 gb|EOY33365.1| Photosystem I subunit O [Theobroma cacao]
Length=145

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSP-NKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFE  194
            MAAT  + STVVGL +++L  LS+P  K FL+S FLK  V+ARNPL L  A  GKFTCFE
Sbjct  1    MAATFASPSTVVGLRSTTL--LSTPAKKAFLSSGFLKSRVAARNPLMLAGASGGKFTCFE  58

Query  195  RDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            RDWL  D NVIGFGLIGW+APSS+P I
Sbjct  59   RDWLRTDFNVIGFGLIGWLAPSSIPAI  85



>gb|KJB09104.1| hypothetical protein B456_001G123200 [Gossypium raimondii]
Length=145

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT  + STVV L  S+    S PN   L+S FLK +V  RNPL+L  AC GKFTCFER
Sbjct  1    MAATFSSPSTVVRLG-SATSFSSPPNNTCLSSGFLKSSVRGRNPLRLAGACGGKFTCFER  59

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RD NVIGFGLIGWIAPSS+P I
Sbjct  60   DWLRRDFNVIGFGLIGWIAPSSIPAI  85



>ref|XP_002523852.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38578.1| conserved hypothetical protein [Ricinus communis]
Length=143

 Score =   102 bits (253),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT   +STV+GL +SSL   SSP K+ L S F+K  V ARNPL+   A  GKF CFER
Sbjct  1    MAATFATSSTVIGLCSSSL---SSPKKICLGSGFVKSPVPARNPLRQTGANGGKFVCFER  57

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL +DLNVIGFGLIGW+APS++P I
Sbjct  58   NWLRKDLNVIGFGLIGWLAPSTIPAI  83



>ref|XP_008361116.1| PREDICTED: uncharacterized protein LOC103424798 isoform X1 [Malus 
domestica]
Length=144

 Score =   102 bits (253),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 66/87 (76%), Gaps = 6/87 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  194
            MA ++  ASTV+GL +SSL    SPN+  LTS F+KP V   NPL+  RA  G+FTC F+
Sbjct  1    MAVSMATASTVIGLGSSSL----SPNRTCLTSGFVKPIVVG-NPLRQVRASGGRFTCSFQ  55

Query  195  RDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            RDWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  56   RDWLRRDLNVIGFGLIGWLAPSSIPLI  82



>ref|XP_009118377.1| PREDICTED: uncharacterized protein LOC103843400 [Brassica rapa]
 emb|CDY06311.1| BnaA09g48920D [Brassica napus]
Length=145

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT  A STV+GL  SS+  + +     L+S FLKP + A+NPLK+  A  G+FTCFER
Sbjct  1    MAATFAAPSTVIGLGGSSVSPIKAKA---LSSSFLKPTLRAKNPLKVAGASGGRFTCFER  57

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+GFGL+GW+APSS+P I
Sbjct  58   NWLRRDLNVVGFGLVGWLAPSSIPAI  83



>ref|XP_009344567.1| PREDICTED: photosystem I subunit O-like isoform X1 [Pyrus x bretschneideri]
Length=144

 Score =   101 bits (252),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 6/87 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  194
            MAA++  ASTV+GL +SSL    SPN+  L+S F+KP V   NPL+  RA  G+FTC F+
Sbjct  1    MAASMATASTVMGLGSSSL----SPNRTCLSSGFVKPIVVG-NPLRQVRASGGRFTCSFQ  55

Query  195  RDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            RDWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  56   RDWLRRDLNVIGFGLIGWLAPSSIPLI  82



>ref|XP_011088934.1| PREDICTED: photosystem I subunit O [Sesamum indicum]
Length=147

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 3/79 (4%)
 Frame = +3

Query  42   STVVGLATSSLPRLSSPNK-LFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLXRDL  218
            + VVGL TS+    +SPNK L L+S FLK  V+ RNPL++ +A  GKFTCFERDWL RDL
Sbjct  11   THVVGLGTSTFS--NSPNKPLNLSSGFLKSPVTTRNPLRVAQASGGKFTCFERDWLRRDL  68

Query  219  NVIGFGLIGWIAPSSVPLI  275
            NVIGFGLIGWIAPSS+P I
Sbjct  69   NVIGFGLIGWIAPSSIPAI  87



>emb|CDP06878.1| unnamed protein product [Coffea canephora]
Length=151

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 62/89 (70%), Gaps = 3/89 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSS---PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC  188
            MA T   ASTVVGL TSSL   S    P K+ L S FLK  V+ RNPL L +   GKFTC
Sbjct  1    MATTFATASTVVGLGTSSLSSPSRASSPKKVCLNSGFLKSPVTTRNPLSLAQISGGKFTC  60

Query  189  FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            FERDWL  D NVIGFGLIGWIAPSS+P+I
Sbjct  61   FERDWLRTDFNVIGFGLIGWIAPSSIPVI  89



>ref|XP_010488808.1| PREDICTED: photosystem I subunit O-like [Camelina sativa]
Length=140

 Score =   100 bits (248),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 6/86 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT    STV+GL  SS+   + P     +S FLKP +SA+NPL+L  A  G+FTCFER
Sbjct  1    MAATFATPSTVIGLGGSSIT--TKP----FSSSFLKPTLSAKNPLRLAGASGGRFTCFER  54

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+GFGLIGW+APSS+P I
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAI  80



>gb|KFK43159.1| hypothetical protein AALP_AA1G087600 [Arabis alpina]
Length=145

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 64/87 (74%), Gaps = 5/87 (6%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSL-PRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFE  194
            MAAT    STV+GLA SS+ P  + P     +S FLKP +SA+NPL+L  A  G+ TCFE
Sbjct  1    MAATFATPSTVIGLAGSSVSPITTKP----FSSSFLKPTLSAKNPLRLAGASGGRVTCFE  56

Query  195  RDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            R+WL RDLNV+GFGLIGW+APSS+P I
Sbjct  57   RNWLRRDLNVVGFGLIGWLAPSSIPAI  83



>ref|XP_010694990.1| PREDICTED: photosystem I subunit O [Beta vulgaris subsp. vulgaris]
Length=147

 Score = 99.4 bits (246),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = +3

Query  21   AATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMG-KFTCFER  197
            A +  A+STVVGL TS L R S      LTS FLK  V+ARNPL+L  A  G KFTCFER
Sbjct  3    ANSFAASSTVVGLGTSHLHR-SLSKSTNLTSGFLKSTVAARNPLRLACASSGGKFTCFER  61

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL  DLNVIGFGLIGW+APSSVP I
Sbjct  62   NWLRTDLNVIGFGLIGWLAPSSVPAI  87



>ref|XP_009609016.1| PREDICTED: photosystem I subunit O-like [Nicotiana tomentosiformis]
Length=145

 Score = 99.4 bits (246),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 3/86 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT+  ASTV          LSSP K+ L+S FLK  V+ARNPL++ +A  GKFTCFER
Sbjct  1    MAATMSTASTV---LGLVSSSLSSPKKVCLSSGFLKSPVTARNPLRVAQASGGKFTCFER  57

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDLNVIGFGLIGW+APSS+P+I
Sbjct  58   DWLRRDLNVIGFGLIGWLAPSSIPVI  83



>ref|XP_010475635.1| PREDICTED: photosystem I subunit O-like [Camelina sativa]
Length=140

 Score = 99.0 bits (245),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 6/86 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT    STV+GL  SS+   S       +S FLKP +SA+NPL+L  A  G+ TCFER
Sbjct  1    MAATFATPSTVIGLGGSSITTKS------FSSSFLKPTLSAKNPLRLAGASGGRVTCFER  54

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+GFGLIGW+APSS+P I
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAI  80



>ref|XP_006417699.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
 dbj|BAJ33638.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36052.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
Length=142

 Score = 99.0 bits (245),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT    STV+GL  SS+    SP     +S FLKP + A+NPL+L  A  G+FTCFER
Sbjct  1    MAATFTTPSTVIGLGGSSV----SPRPF--SSSFLKPTLRAKNPLRLAGASGGRFTCFER  54

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+GFGLIGW+APSS+P I
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAI  80



>emb|CDX95064.1| BnaC05g06070D [Brassica napus]
Length=145

 Score = 99.0 bits (245),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT    STVVGL  SS+   S  N   L+S FLKP   A+NPL++  A  G+FTCFE 
Sbjct  1    MAATFATPSTVVGLGGSSV---SPINTKALSSSFLKPTTRAKNPLRVAGASGGRFTCFES  57

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+GFGLIGW+APSS+P I
Sbjct  58   NWLRRDLNVVGFGLIGWLAPSSIPAI  83



>ref|XP_010262927.1| PREDICTED: photosystem I subunit O [Nelumbo nucifera]
Length=150

 Score = 99.0 bits (245),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 2/78 (3%)
 Frame = +3

Query  48   VVGLATSSLP--RLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLN  221
            V GL +S+L   R++SP +  L SDF++  V+ RNPLK   +  G+FTCFERDWL RD N
Sbjct  13   VTGLGSSTLSPSRITSPKRTSLRSDFVRSPVATRNPLKQTLSSGGRFTCFERDWLRRDFN  72

Query  222  VIGFGLIGWIAPSSVPLI  275
            VIGFGLIGWIAPSSVPLI
Sbjct  73   VIGFGLIGWIAPSSVPLI  90



>ref|XP_009148097.1| PREDICTED: uncharacterized protein LOC103871585 [Brassica rapa]
Length=145

 Score = 98.6 bits (244),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT    STVVGL  SS+   S  N   L+S FLKP   A+NPL++  A  G+FTCFE 
Sbjct  1    MAATFATPSTVVGLGGSSV---SPINTKALSSSFLKPTTRAKNPLRVAGASGGRFTCFES  57

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+GFGLIGW+APSS+P I
Sbjct  58   NWLRRDLNVVGFGLIGWLAPSSIPAI  83



>ref|XP_006305762.1| hypothetical protein CARUB_v10010597mg [Capsella rubella]
 gb|EOA38660.1| hypothetical protein CARUB_v10010597mg [Capsella rubella]
Length=140

 Score = 98.6 bits (244),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT    STV+GL  SS+   + P     +S FLKP +SA+NPLKL  A  G+ TCFER
Sbjct  1    MAATFATPSTVIGLGGSSIT--TKP----FSSSFLKPTLSAKNPLKLAGASGGRVTCFER  54

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+GFGLIGW+APSS+P I
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAI  80



>gb|KCW87339.1| hypothetical protein EUGRSUZ_B03824 [Eucalyptus grandis]
Length=113

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 4/86 (5%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAA++ A S+V+GL +S+L   +SP K  L SDF++  V ARNP+K  RA  G+FTCF+R
Sbjct  1    MAASM-ATSSVIGLGSSAL---TSPKKASLVSDFVRSPVRARNPMKPVRASGGRFTCFQR  56

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL  D +VIGFGLIGW+APSSVP I
Sbjct  57   DWLRADYSVIGFGLIGWLAPSSVPAI  82



>ref|XP_007206116.1| hypothetical protein PRUPE_ppa013064mg [Prunus persica]
 gb|EMJ07315.1| hypothetical protein PRUPE_ppa013064mg [Prunus persica]
Length=142

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 66/87 (76%), Gaps = 6/87 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  194
            MAA +  ASTV+GL++SSL    SP +  L+S F+KP ++  NPL+  RA  G+FTC F+
Sbjct  1    MAANMATASTVIGLSSSSL----SPKRTCLSSGFVKP-IAVGNPLRQARASGGRFTCNFQ  55

Query  195  RDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            RDWL RDLNVIGFGLIGW+APSS+P I
Sbjct  56   RDWLRRDLNVIGFGLIGWLAPSSIPAI  82



>gb|KHG06613.1| DNA mismatch repair mutL [Gossypium arboreum]
Length=145

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT  + STVVGL  ++    S P K  L+S FLK  V+ARNPL+L  AC G F   ER
Sbjct  1    MAATFVSPSTVVGLGGTATCMSSPPMKTRLSSGFLKSGVTARNPLRLAGACGGNF---ER  57

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RD NVIGFGLIGWIAPSS+P I
Sbjct  58   DWLRRDFNVIGFGLIGWIAPSSIPAI  83



>ref|NP_563815.1| photosystem I subunit O [Arabidopsis thaliana]
 sp|Q949Q5.1|PSAO_ARATH RecName: Full=Photosystem I subunit O; Short=PSI-O; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93637.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14284.1| unknown protein [Arabidopsis thaliana]
 gb|AAM64918.1| putative 16kDa membrane protein [Arabidopsis thaliana]
 emb|CAD37939.1| photosystem I subunit O [Arabidopsis thaliana]
 gb|AEE28283.1| photosystem I subunit O [Arabidopsis thaliana]
Length=140

 Score = 97.4 bits (241),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT    STV+GL  SS+   + P     +S FLKP +SA+NPL+L  A  G+ TCFER
Sbjct  1    MAATFATPSTVIGLGGSSIT--TKP----FSSSFLKPTLSAKNPLRLAGASGGRVTCFER  54

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+GFGLIGW+APSS+P I
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAI  80



>ref|XP_010458074.1| PREDICTED: photosystem I subunit O [Camelina sativa]
Length=140

 Score = 97.4 bits (241),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT    STV+GL  SS+   + P     +S FLKP +SA+NPL+L  A  G+ TCFER
Sbjct  1    MAATFATPSTVIGLGGSSIT--TKP----FSSSFLKPTLSAKNPLRLAGASGGRVTCFER  54

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+GFGLIGW+APSS+P I
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAI  80



>emb|CDY22686.1| BnaC08g43200D [Brassica napus]
Length=145

 Score = 97.1 bits (240),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 3/86 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT    STV+GL  SS+  + +     L+S FLKP + A+N LK+  A  G+FTCFER
Sbjct  1    MAATFGTPSTVIGLGGSSVSPIKAKA---LSSSFLKPTLRAKNALKVAGASGGRFTCFER  57

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+GFGL+GW+APSS+P I
Sbjct  58   NWLRRDLNVVGFGLVGWLAPSSIPAI  83



>ref|XP_010045182.1| PREDICTED: photosystem I subunit O [Eucalyptus grandis]
 gb|KCW87338.1| hypothetical protein EUGRSUZ_B03824 [Eucalyptus grandis]
Length=142

 Score = 96.7 bits (239),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 4/86 (5%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAA++ A S+V+GL +S+L   +SP K  L SDF++  V ARNP+K  RA  G+FTCF+R
Sbjct  1    MAASM-ATSSVIGLGSSAL---TSPKKASLVSDFVRSPVRARNPMKPVRASGGRFTCFQR  56

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL  D +VIGFGLIGW+APSSVP I
Sbjct  57   DWLRADYSVIGFGLIGWLAPSSVPAI  82



>ref|XP_004139499.1| PREDICTED: uncharacterized protein LOC101209111 [Cucumis sativus]
 gb|KGN64958.1| hypothetical protein Csa_1G168350 [Cucumis sativus]
Length=146

 Score = 96.7 bits (239),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +3

Query  24   ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  203
            AT  A S+V GL T+SL   SS +   L S F+KP V+ARNPL +  A  GKFTCFERDW
Sbjct  2    ATAFATSSVAGLGTASLSSPSSRSPR-LVSGFIKPPVAARNPLSVAGASGGKFTCFERDW  60

Query  204  LXRDLNVIGFGLIGWIAPSSVPLI  275
            L RDLNVIGFGLIGWIAPSS+P+I
Sbjct  61   LRRDLNVIGFGLIGWIAPSSIPVI  84



>ref|XP_002892455.1| hypothetical protein ARALYDRAFT_470899 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68714.1| hypothetical protein ARALYDRAFT_470899 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score = 96.3 bits (238),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT    STV+GL  SS+   + P     +S FLKP +SA+NPL+L  A  G+ TCFER
Sbjct  1    MAATFATPSTVIGLGGSSI--TTKP----FSSPFLKPTLSAKNPLRLAGASGGRVTCFER  54

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+GFGLIGW+APSS+P I
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAI  80



>ref|XP_009793460.1| PREDICTED: photosystem I subunit O-like [Nicotiana sylvestris]
Length=143

 Score = 96.3 bits (238),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 62/86 (72%), Gaps = 3/86 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAA +   STVVGL +SSL      +     S FLK  V+ARNPL++ +A  GKFTCFER
Sbjct  1    MAARMATTSTVVGLVSSSLSSSKKTSL---NSGFLKSPVTARNPLRIAQASGGKFTCFER  57

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDLNVIGFGLIGW+APSS+P I
Sbjct  58   DWLRRDLNVIGFGLIGWLAPSSIPAI  83



>gb|AAM97011.1| expressed protein [Arabidopsis thaliana]
 gb|AAN15510.1| expressed protein [Arabidopsis thaliana]
Length=140

 Score = 95.9 bits (237),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 6/86 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            M AT    STV+GL  SS+   + P     +S FLKP +SA+NPL+L  A  G+ TCFER
Sbjct  1    MVATFATPSTVIGLGGSSIT--TKP----FSSSFLKPTLSAKNPLRLAGASGGRVTCFER  54

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+GFGLIGW+APSS+P I
Sbjct  55   NWLRRDLNVVGFGLIGWLAPSSIPAI  80



>gb|AEQ39072.1| putative chloroplast photosystem I subunit O [Wolffia arrhiza]
Length=143

 Score = 95.9 bits (237),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +3

Query  24   ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  203
            A +  ++TV GL  + L R  S  KL L+S F+K   SARNPL    +  G+FTCFER+W
Sbjct  2    AAMATSATVAGLGAAPLSR--SSGKLLLSSGFVKSQSSARNPLSQRLSSGGRFTCFERNW  59

Query  204  LXRDLNVIGFGLIGWIAPSSVPLI  275
            L RD NVIGFGLIGWIAPSS+P I
Sbjct  60   LRRDFNVIGFGLIGWIAPSSIPAI  83



>ref|XP_008463649.1| PREDICTED: uncharacterized protein LOC103501744 [Cucumis melo]
Length=146

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +3

Query  24   ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  203
            AT  A S+V GL T+SL   SS +   + S F+K  V+ARNPL + RA  G+FTCFERDW
Sbjct  2    ATAFATSSVAGLGTASLSSPSSRSPRLV-SGFIKSPVAARNPLNVGRASRGRFTCFERDW  60

Query  204  LXRDLNVIGFGLIGWIAPSSVPLI  275
            L RDLNVIGFGLIGWIAPSS+P+I
Sbjct  61   LRRDLNVIGFGLIGWIAPSSIPVI  84



>ref|XP_008229763.1| PREDICTED: uncharacterized protein LOC103329109 [Prunus mume]
Length=142

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 64/87 (74%), Gaps = 6/87 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  194
            MAA +  ASTV+GL++SSL    SP +  L+S F+KP  +  NPL+  RA  G+FTC F+
Sbjct  1    MAANMATASTVIGLSSSSL----SPKRTCLSSGFVKP-TAVGNPLRQARASGGRFTCNFQ  55

Query  195  RDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            RDWL RDLNVIGFGLIGW+ PSS+P I
Sbjct  56   RDWLRRDLNVIGFGLIGWLVPSSIPAI  82



>gb|ADB77878.1| chloroplast photosystem I subunit O [Wolffia arrhiza]
Length=143

 Score = 94.7 bits (234),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +3

Query  24   ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  203
            A +  ++TV GL  + L R S   KL L+S F KP  SARNP     +  G+FTCFER+W
Sbjct  2    AAMATSATVAGLGAAPLSRPS--GKLLLSSGFAKPQSSARNPFSQRLSSGGRFTCFERNW  59

Query  204  LXRDLNVIGFGLIGWIAPSSVPLI  275
            L RD NVIGFGLIGWIAPSS+P I
Sbjct  60   LRRDFNVIGFGLIGWIAPSSIPAI  83



>ref|XP_002273037.1| PREDICTED: photosystem I subunit O [Vitis vinifera]
 emb|CBI28282.3| unnamed protein product [Vitis vinifera]
Length=148

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSP--NKLFLTSDFLKPAVSARNPLKLPRACMGKFTCF  191
            MA T+ AASTV+GL +SSL    S    +  L S F+K  V+ RNPL   +AC GKFTCF
Sbjct  1    MATTMAAASTVIGLGSSSLSPTRSSSSKRTHLASGFVKAPVAPRNPLMQAKACGGKFTCF  60

Query  192  ERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            ERDWL  DLNVIGFGLI W+APSS+P I
Sbjct  61   ERDWLRTDLNVIGFGLIAWLAPSSIPAI  88



>ref|XP_010912341.1| PREDICTED: photosystem I subunit O [Elaeis guineensis]
Length=145

 Score = 94.4 bits (233),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +3

Query  24   ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  203
            AT+   S+V     S LP +   +K  LTS F +P V++R+PL L  A  G+FTCFERDW
Sbjct  2    ATMATTSSVAAGLASPLPLVRRSSKPTLTSGFTRPQVASRSPLNLKLASGGRFTCFERDW  61

Query  204  LXRDLNVIGFGLIGWIAPSSVPLI  275
            L  DLNVIGFGLIGW+APSSVP+I
Sbjct  62   LRTDLNVIGFGLIGWLAPSSVPVI  85



>gb|ACZ54009.1| PsaO [Wolffia arrhiza]
Length=143

 Score = 94.0 bits (232),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +3

Query  24   ATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  203
            A +  ++TV GL  + L R S   KL L+S F+K   SARNPL    +  G+FTCFER+W
Sbjct  2    AAMATSATVAGLGAAPLSRPS--GKLLLSSGFVKSQSSARNPLSQRLSSGGRFTCFERNW  59

Query  204  LXRDLNVIGFGLIGWIAPSSVPLI  275
            L RD NVIGFGLIGWIAPSS+P I
Sbjct  60   LRRDFNVIGFGLIGWIAPSSIPAI  83



>ref|XP_010557432.1| PREDICTED: photosystem I subunit O [Tarenaya hassleriana]
Length=144

 Score = 94.0 bits (232),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 63/87 (72%), Gaps = 4/87 (5%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSL-PRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFE  194
            MAA +   STV+GL  SSL P+   PN  F +S FLKP + A+NP K+  +  G+ TCFE
Sbjct  1    MAAAISNPSTVLGLRGSSLSPK--RPNDGF-SSSFLKPTMRAKNPFKVAGSSGGRVTCFE  57

Query  195  RDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            R+WL RDLNV+GFGLIGWIAPSS+P I
Sbjct  58   RNWLRRDLNVVGFGLIGWIAPSSIPAI  84



>ref|XP_002313603.1| hypothetical protein POPTR_0009s16240g [Populus trichocarpa]
 gb|EEE87558.1| hypothetical protein POPTR_0009s16240g [Populus trichocarpa]
Length=149

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 3/89 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSS---PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC  188
            MAAT  ++S V GL +SSL   S    P K+ L+S F+K  V+AR+PL+L     GKF C
Sbjct  1    MAATFASSSAVTGLGSSSLSSPSRASSPKKICLSSGFVKSPVAARSPLRLAGTHGGKFMC  60

Query  189  FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            FERDWL +DLNVIGFGLIGW+APSS+P I
Sbjct  61   FERDWLRKDLNVIGFGLIGWLAPSSIPAI  89



>gb|ADI45881.1| sex-linked protein 9 [Silene latifolia]
Length=127

 Score = 92.4 bits (228),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  21   AATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACM---GKFTC-  188
            A++  A+STVVGL TS+L R S      L+S FLK  V+A NPL+  +AC    G+FTC 
Sbjct  1    ASSFAASSTVVGLGTSTLSR-SYAKSTTLSSGFLKSKVAAVNPLR--QACGTSGGRFTCS  57

Query  189  FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            F+RDWL RDLNVIGFGLIGW+APSS+P I
Sbjct  58   FQRDWLRRDLNVIGFGLIGWLAPSSIPAI  86



>emb|CDX93566.1| BnaA06g04820D [Brassica napus]
Length=144

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT  A  +VVGL  SS+   S  N   L+S FLKP   A+NPL++  A  G+FTCFE 
Sbjct  1    MAATF-ATPSVVGLGGSSV---SPINTKALSSSFLKPTTRAKNPLRVAGASGGRFTCFES  56

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+GFGLIGW+APSS+P I
Sbjct  57   NWLRRDLNVVGFGLIGWLAPSSIPAI  82



>ref|XP_008784066.1| PREDICTED: uncharacterized protein LOC103703121 [Phoenix dactylifera]
Length=147

 Score = 91.7 bits (226),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLP--RLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCF  191
            MAA    +S   GL  S LP  R  S     +TS F++P V+++NPL L  A  G+FTCF
Sbjct  1    MAAMATTSSVAAGLG-SPLPLVRRRSSKPTLITSGFIRPQVASKNPLNLNLASGGRFTCF  59

Query  192  ERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            ERDWL  DLNVIGFGLIGW+APSSVP I
Sbjct  60   ERDWLRTDLNVIGFGLIGWLAPSSVPAI  87



>ref|XP_009789385.1| PREDICTED: photosystem I subunit O-like isoform X2 [Nicotiana 
sylvestris]
Length=142

 Score = 91.7 bits (226),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  90   PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVP  269
            P K  L+S  LK  V+ARNPL++ +A  GKFTCF+RDWL RDLNVIGFGLIGW+APSS+P
Sbjct  19   PKKACLSSGLLKSPVTARNPLRVAQASGGKFTCFQRDWLRRDLNVIGFGLIGWLAPSSIP  78

Query  270  LI  275
            +I
Sbjct  79   VI  80



>emb|CAN83522.1| hypothetical protein VITISV_019056 [Vitis vinifera]
Length=144

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = +3

Query  30   LCAASTVVGLATSSLPRLSSP--NKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDW  203
            + AASTV+GL +SSL    S    +  L S F+K  V+ RNPL+  +AC GKFTCFERDW
Sbjct  1    MAAASTVIGLGSSSLSPARSSSSKRTHLASGFVKAPVAPRNPLRQAKACGGKFTCFERDW  60

Query  204  LXRDLNVIGFGLIGWIAPSSVPLI  275
            L  DLNVIGFGLI W+APSS+P I
Sbjct  61   LRTDLNVIGFGLIAWLAPSSIPAI  84



>emb|CDY31154.1| BnaA08g27040D [Brassica napus]
Length=134

 Score = 89.7 bits (221),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 3/75 (4%)
 Frame = +3

Query  51   VGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLNVIG  230
            +GL  SS+ R+   N    +S FLKP + A NPL++  A  G+FTCFER+WL RDLNV+G
Sbjct  1    MGLGGSSVSRI---NTKAFSSSFLKPTLRANNPLRVAGASGGRFTCFERNWLRRDLNVVG  57

Query  231  FGLIGWIAPSSVPLI  275
            FGLIGW+APSS+P I
Sbjct  58   FGLIGWLAPSSIPAI  72



>gb|KDO37001.1| hypothetical protein CISIN_1g032156mg [Citrus sinensis]
Length=121

 Score = 88.2 bits (217),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  90   PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVP  269
            P +  L S F+K  V+ARNPL++  AC GK TCFERDWL  DLNVIGFGLIGW+APSS+P
Sbjct  23   PKRTALGSSFVKSPVAARNPLRVAGACGGKVTCFERDWLRTDLNVIGFGLIGWLAPSSIP  82

Query  270  LI  275
             I
Sbjct  83   AI  84



>gb|KDO58276.1| hypothetical protein CISIN_1g032153mg [Citrus sinensis]
Length=141

 Score = 88.2 bits (217),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  90   PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVP  269
            P +  L S F+K  V+ARNPL++  AC GK TCFERDWL  DLNVIGFGLIGW+APSS+P
Sbjct  23   PKRTALGSSFVKSPVAARNPLRVAGACGGKVTCFERDWLRTDLNVIGFGLIGWLAPSSIP  82

Query  270  LI  275
             I
Sbjct  83   AI  84



>gb|ADI45844.1| sex-linked protein 9 [Silene vulgaris]
Length=143

 Score = 88.2 bits (217),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 62/87 (71%), Gaps = 3/87 (3%)
 Frame = +3

Query  21   AATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMG-KFTC-FE  194
            A++  A++TVVGL TS++ R S      L+S FLK  V+A NPL+      G +FTC F+
Sbjct  1    ASSFAASATVVGLGTSTISR-SYAKSTPLSSGFLKSKVAAVNPLRQAWGTSGGRFTCSFQ  59

Query  195  RDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            RDWL RDLNVIGFGLIGW+APSS+P I
Sbjct  60   RDWLRRDLNVIGFGLIGWLAPSSIPAI  86



>gb|EYU28533.1| hypothetical protein MIMGU_mgv1a023828mg, partial [Erythranthe 
guttata]
Length=113

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  117  FLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            FLK  V+ARNPLKL +A  GK TCF+RDWL RDLNVIGFGLIGWIAPSS+P I
Sbjct  1    FLKSPVAARNPLKLAQASGGKSTCFQRDWLRRDLNVIGFGLIGWIAPSSIPAI  53



>ref|XP_006481510.1| PREDICTED: uncharacterized protein LOC102626023 [Citrus sinensis]
Length=151

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  90   PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVP  269
            P +  L S F+K  V+ARNPL++  AC GK TCFERDWL  DLNVIGFGLIGW+APSS+P
Sbjct  23   PKRTALGSSFVKSPVAARNPLRVAGACGGKVTCFERDWLRTDLNVIGFGLIGWLAPSSIP  82

Query  270  LI  275
             I
Sbjct  83   AI  84



>ref|XP_006424153.1| hypothetical protein CICLE_v10029515mg [Citrus clementina]
 gb|ESR37393.1| hypothetical protein CICLE_v10029515mg [Citrus clementina]
 gb|KDO37000.1| hypothetical protein CISIN_1g032156mg [Citrus sinensis]
 gb|KDO58275.1| hypothetical protein CISIN_1g032153mg [Citrus sinensis]
Length=146

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  90   PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVP  269
            P +  L S F+K  V+ARNPL++  AC GK TCFERDWL  DLNVIGFGLIGW+APSS+P
Sbjct  23   PKRTALGSSFVKSPVAARNPLRVAGACGGKVTCFERDWLRTDLNVIGFGLIGWLAPSSIP  82

Query  270  LI  275
             I
Sbjct  83   AI  84



>ref|XP_009789384.1| PREDICTED: photosystem I subunit O-like isoform X1 [Nicotiana 
sylvestris]
 emb|CAB75430.1| putative 16kDa membrane protein [Nicotiana tabacum]
Length=143

 Score = 87.0 bits (214),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +3

Query  90   PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FERDWLXRDLNVIGFGLIGWIAPSSV  266
            P K  L+S  LK  V+ARNPL++ +A  GKFTC F+RDWL RDLNVIGFGLIGW+APSS+
Sbjct  19   PKKACLSSGLLKSPVTARNPLRVAQASGGKFTCNFQRDWLRRDLNVIGFGLIGWLAPSSI  78

Query  267  PLI  275
            P+I
Sbjct  79   PVI  81



>ref|XP_006384771.1| hypothetical protein POPTR_0004s20960g [Populus trichocarpa]
 gb|ERP62568.1| hypothetical protein POPTR_0004s20960g [Populus trichocarpa]
Length=120

 Score = 86.3 bits (212),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 61/89 (69%), Gaps = 3/89 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSS---PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC  188
            MAAT  + S VVGL + SL   S    P K+ L+S F+K  V+ARNPL L     GKF C
Sbjct  1    MAATFASPSAVVGLGSGSLSSPSRISSPKKICLSSGFVKSPVTARNPLGLAGTGGGKFMC  60

Query  189  FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            F+ DWL +DLNVIGFGLIGW+APSSVP I
Sbjct  61   FQGDWLRKDLNVIGFGLIGWLAPSSVPAI  89



>ref|XP_009340874.1| PREDICTED: photosystem I subunit O-like [Pyrus x bretschneideri]
Length=144

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 64/87 (74%), Gaps = 6/87 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  194
            MAAT+  ASTV+GL +SSL    +     L+S F+KP V   NPL+  RA  G+FTC F+
Sbjct  1    MAATMATASTVMGLRSSSLSPSRTC----LSSAFVKPIVVG-NPLRQVRASGGRFTCSFQ  55

Query  195  RDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            RDWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  56   RDWLRRDLNVIGFGLIGWLAPSSIPLI  82



>ref|XP_009340870.1| PREDICTED: photosystem I subunit O-like [Pyrus x bretschneideri]
Length=129

 Score = 85.9 bits (211),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 64/87 (74%), Gaps = 6/87 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  194
            MAAT+  ASTV+GL +SSL    +     L+S F+KP V   NPL+  RA  G+FTC F+
Sbjct  1    MAATMATASTVMGLRSSSLSPSRTC----LSSAFVKPIVVG-NPLRQVRASGGRFTCSFQ  55

Query  195  RDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            RDWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  56   RDWLRRDLNVIGFGLIGWLAPSSIPLI  82



>gb|AGU28452.1| photosystem I subunit O (chloroplast) [Sinapis alba]
Length=144

 Score = 85.9 bits (211),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 4/86 (5%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFER  197
            MAAT  A STV+GL  SS+  + +     L+S F+KP + A+NPL++  A  G+FTCFER
Sbjct  1    MAATFAAPSTVIGLGGSSVSPIKAKA---LSSSFIKPTLRAKNPLRVAGASGGRFTCFER  57

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL RDLNV+    IGW+APSS+P I
Sbjct  58   NWLRRDLNVVVLA-IGWLAPSSIPAI  82



>ref|XP_009374967.1| PREDICTED: photosystem I subunit O-like [Pyrus x bretschneideri]
Length=144

 Score = 85.9 bits (211),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 64/87 (74%), Gaps = 6/87 (7%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC-FE  194
            MAAT+  ASTV+GL +SSL    +     ++S F+KP V   NPL+  RA  G+FTC F+
Sbjct  1    MAATMATASTVMGLRSSSLSPSRTC----ISSAFVKPIVVG-NPLRQVRASGGRFTCSFQ  55

Query  195  RDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            RDWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  56   RDWLRRDLNVIGFGLIGWLAPSSIPLI  82



>ref|XP_006384772.1| hypothetical protein POPTR_0004s20960g [Populus trichocarpa]
 gb|ERP62569.1| hypothetical protein POPTR_0004s20960g [Populus trichocarpa]
Length=151

 Score = 85.9 bits (211),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 61/89 (69%), Gaps = 3/89 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSS---PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC  188
            MAAT  + S VVGL + SL   S    P K+ L+S F+K  V+ARNPL L     GKF C
Sbjct  1    MAATFASPSAVVGLGSGSLSSPSRISSPKKICLSSGFVKSPVTARNPLGLAGTGGGKFMC  60

Query  189  FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            F+ DWL +DLNVIGFGLIGW+APSSVP I
Sbjct  61   FQGDWLRKDLNVIGFGLIGWLAPSSVPAI  89



>ref|XP_011006585.1| PREDICTED: photosystem I subunit O-like [Populus euphratica]
Length=151

 Score = 85.9 bits (211),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 60/89 (67%), Gaps = 3/89 (3%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSS---PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC  188
            MAAT  + S VVGL + SL   S    P K+ L S F+K  V+ARNPL L     GKF C
Sbjct  1    MAATFASPSAVVGLGSGSLSSPSRISSPKKICLGSGFVKSPVTARNPLGLAGTGGGKFMC  60

Query  189  FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            F+ DWL +DLNVIGFGLIGWIAPSS+P I
Sbjct  61   FQGDWLRKDLNVIGFGLIGWIAPSSIPAI  89



>gb|ADH43621.1| sex-linked protein 9 [Silene latifolia]
Length=148

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 59/81 (73%), Gaps = 7/81 (9%)
 Frame = +3

Query  45   TVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLXR  212
            TVVGL TS+L R S      L+S FLK  V+A NPL+  +AC    G+FTC F+RDWL R
Sbjct  11   TVVGLGTSTLSR-SYAKSTTLSSGFLKLKVAAVNPLR--QACGTSGGRFTCSFQRDWLRR  67

Query  213  DLNVIGFGLIGWIAPSSVPLI  275
            DLNVIGFGLIGW+APSS+P I
Sbjct  68   DLNVIGFGLIGWLAPSSIPAI  88



>ref|XP_006417697.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
 ref|XP_006417698.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
 gb|ESQ36050.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
 gb|ESQ36051.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
Length=119

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  117  FLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            FLKP + A+NPL+L  A  G+FTCFER+WL RDLNV+GFGLIGW+APSS+P I
Sbjct  5    FLKPTLRAKNPLRLAGASGGRFTCFERNWLRRDLNVVGFGLIGWLAPSSIPAI  57



>ref|XP_009403671.1| PREDICTED: photosystem I subunit O isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 59/87 (68%), Gaps = 7/87 (8%)
 Frame = +3

Query  18   MAATLCAASTVVGLATS-SLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFE  194
            MAAT C    V GL +  SL R SS  K  L S F+    +ARNPLKL  A  G+FTCFE
Sbjct  1    MAATSC----VAGLGSPLSLARPSS--KPSLASGFIGTRGAARNPLKLKLASGGRFTCFE  54

Query  195  RDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            R+WL  DLNVIGFGLIGW+APSS+P I
Sbjct  55   RNWLRTDLNVIGFGLIGWLAPSSIPAI  81



>gb|KDP24032.1| hypothetical protein JCGZ_26726 [Jatropha curcas]
Length=148

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSP--NKLFLTSDFLKPAVSARNPLKLPRACMGKFTCF  191
            MAA    +STV+GL +SSL    S    +  L+S F+K   +ARNPL+   +  GKF CF
Sbjct  1    MAAAFATSSTVIGLGSSSLSSPRSCSCRRTCLSSGFVKSVATARNPLRQAGSNGGKFMCF  60

Query  192  ERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            ERDWL RDLNVIGFGLIGW+APSS+P I
Sbjct  61   ERDWLRRDLNVIGFGLIGWLAPSSIPAI  88



>gb|AEC10974.1| 16kda membrane protein [Camellia sinensis]
Length=150

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 52/79 (66%), Gaps = 3/79 (4%)
 Frame = +3

Query  48   VVGLATSSLPRLSS---PNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLXRDL  218
            VVGL TSSL   S    P    L S FLK  V  RNPL    A  GKFTCFERDWL  DL
Sbjct  12   VVGLGTSSLSLSSRVSSPKTTSLNSAFLKSPVRVRNPLVQAHASGGKFTCFERDWLRTDL  71

Query  219  NVIGFGLIGWIAPSSVPLI  275
            NVIGFGLIGW+APSSVP I
Sbjct  72   NVIGFGLIGWLAPSSVPAI  90



>gb|AFK44563.1| unknown [Lotus japonicus]
Length=141

 Score = 83.6 bits (205),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACM--GKFTCF  191
            MA T    +TV GL  +SL    SP    LTSDF+K  VSARNPL+   A    G+  CF
Sbjct  1    MATTF---ATVAGLGGASL----SPASSRLTSDFVKSPVSARNPLRQAVAMGNGGRVKCF  53

Query  192  ERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            ER+WL  D NVIGFGLIGWIAPSS+P I
Sbjct  54   ERNWLRTDFNVIGFGLIGWIAPSSIPAI  81



>ref|XP_011459420.1| PREDICTED: photosystem I subunit O [Fragaria vesca subsp. vesca]
Length=141

 Score = 83.2 bits (204),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 60/88 (68%), Gaps = 9/88 (10%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC--F  191
            MA +   ASTVVGL  SSL + +      L+SDF+KP V  R+PL+  +A   KFTC  F
Sbjct  1    MATSFATASTVVGLG-SSLSKTAC-----LSSDFVKP-VMVRSPLRQAQASRRKFTCMSF  53

Query  192  ERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            + DWL RDLNVIGFGLIGW+ PSSVP I
Sbjct  54   QSDWLRRDLNVIGFGLIGWLVPSSVPAI  81



>gb|ACJ86143.1| unknown [Medicago truncatula]
 gb|AFK39295.1| unknown [Medicago truncatula]
 gb|KEH29824.1| photosystem I subunit O [Medicago truncatula]
Length=138

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 57/88 (65%), Gaps = 14/88 (16%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACM--GKFTCF  191
            MAAT     TV+G+A +S           LTS F+KP V ARNPLK   A    G+ TCF
Sbjct  1    MAAT--TFPTVLGMAGASR----------LTSGFVKPQVIARNPLKQAMALGNGGRVTCF  48

Query  192  ERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +RDWL RD NVIGFGLIGW+APSS+P I
Sbjct  49   QRDWLRRDFNVIGFGLIGWLAPSSIPAI  76



>ref|XP_004506203.1| PREDICTED: uncharacterized protein LOC101500027 [Cicer arietinum]
Length=136

 Score = 80.5 bits (197),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 55/88 (63%), Gaps = 14/88 (16%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLK--LPRACMGKFTCF  191
            MA T  A  TVVG+  +S           L S F+KP V ARN L+  + R   G+ TCF
Sbjct  1    MATTTFA--TVVGMGGASR----------LASGFVKPQVMARNRLRQAMARGNGGRVTCF  48

Query  192  ERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +RDWL RD NVIGFGLIGW+APSS+P I
Sbjct  49   QRDWLRRDFNVIGFGLIGWLAPSSIPAI  76



>ref|XP_006846460.1| hypothetical protein AMTR_s00018p00092490 [Amborella trichopoda]
 gb|ERN08135.1| hypothetical protein AMTR_s00018p00092490 [Amborella trichopoda]
Length=143

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  48   VVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLNVI  227
            V GL TSS     +P KL L+S FL    +A NP        G+F+CF+ DWL  DLNVI
Sbjct  10   VAGLGTSSFSPSRNPTKLNLSSGFLSSRATA-NPFSRATRSKGRFSCFKGDWLRTDLNVI  68

Query  228  GFGLIGWIAPSSVPLI  275
            GFGLIGWIAPSSVP+I
Sbjct  69   GFGLIGWIAPSSVPVI  84



>ref|XP_006854748.1| hypothetical protein AMTR_s00030p00247800 [Amborella trichopoda]
 gb|ERN16215.1| hypothetical protein AMTR_s00030p00247800 [Amborella trichopoda]
Length=123

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +3

Query  48   VVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLNVI  227
            V GL T SL    SP KL L+S FL  +  A NP    ++  G+F+C++ DWL  DLNVI
Sbjct  10   VAGLGTPSLSPSRSPTKLNLSSGFLSSSAIA-NPFSRAKSSKGRFSCYKGDWLRTDLNVI  68

Query  228  GFGLIGWIAPSSVPLI  275
            GFGLIGW+APSS+P I
Sbjct  69   GFGLIGWLAPSSIPAI  84



>ref|XP_011004353.1| PREDICTED: photosystem I subunit O-like, partial [Populus euphratica]
Length=159

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  108  TSDFLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVP  269
            +S F+K  V+A +PL+L  A  GKF CFERDWL +DLNVIGFGLIGW+APSS+P
Sbjct  44   SSGFVKSPVAAGSPLRLAGAHGGKFMCFERDWLRKDLNVIGFGLIGWLAPSSIP  97



>ref|XP_009403670.1| PREDICTED: photosystem I subunit O isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=162

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +3

Query  108  TSDFLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            ++ F+    +ARNPLKL  A  G+FTCFER+WL  DLNVIGFGLIGW+APSS+P I
Sbjct  46   STGFIGTRGAARNPLKLKLASGGRFTCFERNWLRTDLNVIGFGLIGWLAPSSIPAI  101



>gb|ADI45826.1| sex-linked protein 9, partial [Silene dioica]
 gb|ADI45842.1| sex-linked protein 9, partial [Silene dioica]
 gb|ADI45846.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45861.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45866.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45871.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45873.1| sex-linked protein 9 [Silene latifolia]
Length=99

 Score = 77.0 bits (188),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 6/61 (10%)
 Frame = +3

Query  105  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNVIGFGLIGWIAPSSVPL  272
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNVIGFGLIGW+APSS+P 
Sbjct  11   LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  68

Query  273  I  275
            I
Sbjct  69   I  69



>gb|AFK38505.1| unknown [Medicago truncatula]
 gb|KEH29825.1| photosystem I subunit O [Medicago truncatula]
Length=139

 Score = 77.8 bits (190),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 57/89 (64%), Gaps = 15/89 (17%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACM--GKFTC-  188
            MAAT     TV+G+A +S           LTS F+KP V ARNPLK   A    G+ TC 
Sbjct  1    MAAT--TFPTVLGMAGASR----------LTSGFVKPQVIARNPLKQAMALGNGGRVTCS  48

Query  189  FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            F+RDWL RD NVIGFGLIGW+APSS+P I
Sbjct  49   FQRDWLRRDFNVIGFGLIGWLAPSSIPAI  77



>gb|ADI45857.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45859.1| sex-linked protein 9 [Silene latifolia]
Length=98

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 6/61 (10%)
 Frame = +3

Query  105  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNVIGFGLIGWIAPSSVPL  272
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNVIGFGLIGW+APSS+P 
Sbjct  10   LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  67

Query  273  I  275
            I
Sbjct  68   I  68



>gb|ADI45862.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45885.1| sex-linked protein 9 [Silene latifolia]
Length=92

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 6/61 (10%)
 Frame = +3

Query  105  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNVIGFGLIGWIAPSSVPL  272
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNVIGFGLIGW+APSS+P 
Sbjct  4    LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  61

Query  273  I  275
            I
Sbjct  62   I  62



>gb|ADI45880.1| sex-linked protein 9 [Silene latifolia]
Length=93

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 6/61 (10%)
 Frame = +3

Query  105  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNVIGFGLIGWIAPSSVPL  272
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNVIGFGLIGW+APSS+P 
Sbjct  5    LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  62

Query  273  I  275
            I
Sbjct  63   I  63



>gb|ADI45869.1| sex-linked protein 9 [Silene latifolia]
Length=104

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 6/61 (10%)
 Frame = +3

Query  105  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNVIGFGLIGWIAPSSVPL  272
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNVIGFGLIGW+APSS+P 
Sbjct  11   LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  68

Query  273  I  275
            I
Sbjct  69   I  69



>ref|XP_001778960.1| PsaO subunit of photosystem I [Physcomitrella patens]
 gb|EDQ56215.1| PsaO subunit of photosystem I [Physcomitrella patens]
Length=144

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 58/88 (66%), Gaps = 7/88 (8%)
 Frame = +3

Query  18   MAATLCAAST--VVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCF  191
            MAA + + +T  V GL  S+L    + +K+ LTS F+  AV    PL     C+ + TCF
Sbjct  1    MAAAMASMTTPVVAGLGGSALLANRTSSKVQLTSAFVPRAVQVNKPL-----CVSRVTCF  55

Query  192  ERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
             RDWL +DL+VIGFGLIGW+APSS+P+I
Sbjct  56   NRDWLRKDLSVIGFGLIGWLAPSSLPVI  83



>gb|ADI45879.1| sex-linked protein 9 [Silene latifolia]
Length=98

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 6/61 (10%)
 Frame = +3

Query  105  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNVIGFGLIGWIAPSSVPL  272
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNVIGFGLIGW+APSS+P 
Sbjct  5    LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  62

Query  273  I  275
            I
Sbjct  63   I  63



>gb|ADI45877.1| sex-linked protein 9 [Silene latifolia]
Length=96

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 6/61 (10%)
 Frame = +3

Query  105  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNVIGFGLIGWIAPSSVPL  272
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNVIGFGLIGW+APSS+P 
Sbjct  5    LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  62

Query  273  I  275
            I
Sbjct  63   I  63



>gb|ADI45849.1| sex-linked protein 9 [Silene latifolia]
Length=106

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 6/61 (10%)
 Frame = +3

Query  105  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNVIGFGLIGWIAPSSVPL  272
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNVIGFGLIGW+APSS+P 
Sbjct  11   LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  68

Query  273  I  275
            I
Sbjct  69   I  69



>gb|ADI45848.1| sex-linked protein 9 [Silene latifolia]
Length=101

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 6/61 (10%)
 Frame = +3

Query  105  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNVIGFGLIGWIAPSSVPL  272
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNVIGFGLIGW+APSS+P 
Sbjct  5    LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  62

Query  273  I  275
            I
Sbjct  63   I  63



>ref|XP_007132467.1| hypothetical protein PHAVU_011G096400g [Phaseolus vulgaris]
 gb|ESW04461.1| hypothetical protein PHAVU_011G096400g [Phaseolus vulgaris]
Length=141

 Score = 75.9 bits (185),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 6/80 (8%)
 Frame = +3

Query  42   STVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLK--LPRACMGKFTCFERDWLXRD  215
            +TV GL  +SL   +S     LTS F++  VSARNPL+  +     G+ TCF+R+WL  D
Sbjct  6    ATVAGLGGASLGSTASR----LTSGFVRSPVSARNPLRQGVAMGNGGRVTCFQRNWLRAD  61

Query  216  LNVIGFGLIGWIAPSSVPLI  275
             +VIGFGLIGW+APSS+P I
Sbjct  62   YSVIGFGLIGWLAPSSIPAI  81



>gb|ADI45882.1| sex-linked protein 9 [Silene latifolia]
Length=102

 Score = 75.1 bits (183),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 6/61 (10%)
 Frame = +3

Query  105  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNVIGFGLIGWIAPSSVPL  272
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNVIGFGLIGW+APSS+P 
Sbjct  10   LSSGFLKLKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPA  67

Query  273  I  275
            I
Sbjct  68   I  68



>gb|ADI45847.1| sex-linked protein 9 [Silene latifolia]
Length=88

 Score = 74.7 bits (182),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 6/60 (10%)
 Frame = +3

Query  108  TSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +S FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNVIGFGLIGW+APSS+P I
Sbjct  1    SSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPAI  58



>ref|XP_003579709.1| PREDICTED: photosystem I subunit O [Brachypodium distachyon]
Length=144

 Score = 75.9 bits (185),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 56/86 (65%), Gaps = 11/86 (13%)
 Frame = +3

Query  33   CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  197
             AASTV GLA ++L R  + +  F T       VSARNPL    L R   G+ TC  F R
Sbjct  3    AAASTVSGLAGATLARRPAFSTNFTTGG----RVSARNPLMTRNLERN--GRITCMTFPR  56

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  57   DWLRRDLNVIGFGLIGWLAPSSIPLI  82



>dbj|BAJ90625.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=144

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 55/86 (64%), Gaps = 11/86 (13%)
 Frame = +3

Query  33   CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  197
             A STV GLA ++L R  +    F TS      VSARNPL    L R   G+ TC  F R
Sbjct  3    TATSTVYGLAGAALARRPA----FSTSFTSGGQVSARNPLMTRNLERN--GRITCMTFPR  56

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  57   DWLRRDLNVIGFGLIGWLAPSSIPLI  82



>emb|CAH66420.1| H0622F05.3 [Oryza sativa Indica Group]
 emb|CAH66478.1| OSIGBa0137L20.7 [Oryza sativa Indica Group]
 gb|EAY94055.1| hypothetical protein OsI_15832 [Oryza sativa Indica Group]
Length=142

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = +3

Query  36   AASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FERD  200
            AASTV GLA ++L R  + +  F T       VSARNPL    L R   G+ TC  F RD
Sbjct  2    AASTVSGLAGATLARRPAFSTGFTTG----ARVSARNPLMTRNLERN--GRITCMTFPRD  55

Query  201  WLXRDLNVIGFGLIGWIAPSSVPLI  275
            WL RDLNVIGFGLIGWIAPSSVP I
Sbjct  56   WLRRDLNVIGFGLIGWIAPSSVPAI  80



>gb|ABG75753.1| salt stress-responsive protein [Triticum aestivum]
Length=145

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 59/91 (65%), Gaps = 13/91 (14%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC  188
            MAA   A+STV GLA ++L R  +    F TS      VSARNPL    L R   G+ TC
Sbjct  1    MAA--AASSTVSGLAGAALARRPA----FSTSFTSGGRVSARNPLMTRNLERN--GRITC  52

Query  189  --FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
              F RDWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  53   MTFPRDWLRRDLNVIGFGLIGWLAPSSIPLI  83



>dbj|BAJ85402.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=144

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 55/86 (64%), Gaps = 11/86 (13%)
 Frame = +3

Query  33   CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  197
             A STV GLA ++L R  +    F TS      VSARNPL    L R   G+ TC  F R
Sbjct  3    TATSTVYGLAGAALARRPA----FSTSFTSGGRVSARNPLMTRNLERN--GRITCMTFPR  56

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  57   DWLRRDLNVIGFGLIGWLAPSSIPLI  82



>gb|ADI45845.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45850.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45851.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45852.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45853.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45854.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45855.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45856.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45858.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45860.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45863.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45864.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45865.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45867.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45868.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45870.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45872.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45874.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45875.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45876.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45878.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45886.1| sex-linked protein 9 [Silene latifolia]
 gb|ADI45887.1| sex-linked protein 9 [Silene latifolia]
Length=85

 Score = 72.8 bits (177),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 6/57 (11%)
 Frame = +3

Query  117  FLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNVIGFGLIGW+APSS+P I
Sbjct  1    FLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPAI  55



>gb|ABB90549.1| putative membrane protein [Triticum aestivum]
Length=144

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 55/86 (64%), Gaps = 11/86 (13%)
 Frame = +3

Query  33   CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  197
             A STV GLA ++L R  +    F TS      VSARNPL    L R   G+ TC  F R
Sbjct  3    AATSTVSGLAGAALTRRPA----FSTSFTSGARVSARNPLMTRNLERN--GRITCMTFPR  56

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  57   DWLRRDLNVIGFGLIGWLAPSSIPLI  82



>gb|EMT23727.1| hypothetical protein F775_30776 [Aegilops tauschii]
Length=144

 Score = 73.6 bits (179),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 55/86 (64%), Gaps = 11/86 (13%)
 Frame = +3

Query  33   CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  197
             A STV GLA ++L R  +    F TS      VSARNPL    L R   G+ TC  F R
Sbjct  3    AATSTVSGLAGAALARRPA----FSTSFTSGGRVSARNPLMTRNLERN--GRITCMTFPR  56

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  57   DWLRRDLNVIGFGLIGWLAPSSIPLI  82



>gb|ABK25454.1| unknown [Picea sitchensis]
 gb|ABR17159.1| unknown [Picea sitchensis]
Length=152

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = +3

Query  21   AATLCAASTVVGLATSSLPRLSSPN-KLFLTSDFLK-PAVSARNPLKLPRACMGKFTCFE  194
            AA +  +S V GL TSSL   S PN KL L+S F     V   NPL+       + TCF+
Sbjct  8    AANVTLSSPVAGLGTSSLSP-SKPNAKLQLSSGFTGCTTVRGNNPLRQKGLWASRITCFQ  66

Query  195  RDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            R+WL  D +VIGFGLIGWIAPSS+P+I
Sbjct  67   RNWLRTDYSVIGFGLIGWIAPSSLPVI  93



>gb|ADI45883.1| sex-linked protein 9 [Silene latifolia]
Length=85

 Score = 71.6 bits (174),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 6/57 (11%)
 Frame = +3

Query  117  FLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNVIGFGLIGW+APSS+P I
Sbjct  1    FLKLKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNVIGFGLIGWLAPSSIPAI  55



>ref|NP_001052755.1| Os04g0414700 [Oryza sativa Japonica Group]
 emb|CAE01514.1| OJ991214_12.3 [Oryza sativa Japonica Group]
 dbj|BAF14669.1| Os04g0414700 [Oryza sativa Japonica Group]
 gb|EAZ30691.1| hypothetical protein OsJ_14748 [Oryza sativa Japonica Group]
 dbj|BAG86813.1| unnamed protein product [Oryza sativa Japonica Group]
Length=142

 Score = 72.8 bits (177),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = +3

Query  36   AASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FERD  200
            AASTV GLA ++L R  + +  F T       VSARNPL    L R   G+ TC  F +D
Sbjct  2    AASTVSGLAGATLARRPAFSTGFTTG----ARVSARNPLLTRNLERN--GRITCMTFPQD  55

Query  201  WLXRDLNVIGFGLIGWIAPSSVPLI  275
            WL RDLNVIGFGLIGWIAPSSVP I
Sbjct  56   WLRRDLNVIGFGLIGWIAPSSVPAI  80



>ref|XP_006652269.1| PREDICTED: uncharacterized protein LOC102704139, partial [Oryza 
brachyantha]
Length=142

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 54/86 (63%), Gaps = 11/86 (13%)
 Frame = +3

Query  33   CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  197
             AASTV GLA ++L    + +  F T       VSARNPL    L R   G+ TC  F R
Sbjct  1    AAASTVSGLAGAALAHRPAFSTGFTTG----ARVSARNPLMTRNLERN--GRITCMTFPR  54

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDLNVIGFGLIGW+APSSVP I
Sbjct  55   DWLRRDLNVIGFGLIGWLAPSSVPAI  80



>ref|XP_006592347.1| PREDICTED: uncharacterized protein LOC100809697 [Glycine max]
Length=128

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +3

Query  105  LTSDFLKPAVSARNPLKLPRAC-MGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            L + F+K  VSARNPL+   A   G+ TCFER+WL  D +VIGFGLIGW+APSSVP I
Sbjct  11   LFAGFVKSPVSARNPLRKAVAMGNGRVTCFERNWLRADYSVIGFGLIGWLAPSSVPAI  68



>gb|KHN21168.1| hypothetical protein glysoja_006647 [Glycine soja]
Length=140

 Score = 70.5 bits (171),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +3

Query  114  DFLKPAVSARNPLKLPRAC-MGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
             F+K  VSARNPL+   A   G+ TCFER+WL  D +VIGFGLIGW+APSSVP I
Sbjct  26   GFVKSPVSARNPLRQAVAMGNGRVTCFERNWLRADYSVIGFGLIGWLAPSSVPAI  80



>ref|XP_004975583.1| PREDICTED: uncharacterized protein LOC101771677 [Setaria italica]
Length=144

 Score = 69.7 bits (169),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 54/91 (59%), Gaps = 14/91 (15%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC  188
            MAA+  A S + G A +S P  S       TS      VSARNPL    L R   G+ TC
Sbjct  1    MAASSSAVSGLAGAALASRPAFS-------TSFVRGGRVSARNPLMTRNLERN--GRITC  51

Query  189  --FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
              F RDWL RDL+VIGFGLIGWI PSSVP+I
Sbjct  52   MTFPRDWLRRDLSVIGFGLIGWIGPSSVPVI  82



>gb|ACU20009.1| unknown [Glycine max]
Length=140

 Score = 69.7 bits (169),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +3

Query  114  DFLKPAVSARNPLKLPRAC-MGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
             F+K  VSARNPL+   A   G+ TCFER+WL  D +VIGFGLIGW+APSSVP I
Sbjct  26   GFVKSPVSARNPLRKAVAMGNGRVTCFERNWLRADYSVIGFGLIGWLAPSSVPAI  80



>emb|CDY68716.1| BnaAnng28120D [Brassica napus]
Length=120

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 3/53 (6%)
 Frame = +3

Query  117  FLKPAVSARNPLKLPRACMGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            FLKP + A+NPL++  A  G+FT    +WL RDLNV+GFGLIGW+APSS+P+I
Sbjct  9    FLKPTLRAKNPLRVAGASGGRFTW---NWLRRDLNVVGFGLIGWLAPSSIPVI  58



>gb|ABK21270.1| unknown [Picea sitchensis]
 gb|ABK25280.1| unknown [Picea sitchensis]
 gb|ABK25521.1| unknown [Picea sitchensis]
 gb|ABK27000.1| unknown [Picea sitchensis]
 gb|ABR18345.1| unknown [Picea sitchensis]
Length=152

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +3

Query  21   AATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLK-PAVSARNPLKLPRACMGKFTCFER  197
            AA +  +S V GL TSSL       KL L+S F     V   NPL+       + TCF+R
Sbjct  8    AANVTLSSPVAGLGTSSLSSSKPNAKLQLSSGFTGCTTVRGNNPLRQKGLWASRITCFQR  67

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL  D +VIGFGLIGWIAPSS+P+I
Sbjct  68   NWLRTDYSVIGFGLIGWIAPSSLPVI  93



>ref|NP_001150218.1| LOC100283848 [Zea mays]
 gb|ACG27302.1| 16kDa membrane protein [Zea mays]
 gb|ACG30703.1| 16kDa membrane protein [Zea mays]
 gb|ACG38282.1| 16kDa membrane protein [Zea mays]
 gb|ACN34681.1| unknown [Zea mays]
 tpg|DAA37888.1| TPA: membrane protein [Zea mays]
Length=144

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 53/86 (62%), Gaps = 11/86 (13%)
 Frame = +3

Query  33   CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  197
             +ASTV GLA +SL    +    F TS      VSARNPL    L R   G+ TC  F R
Sbjct  3    ASASTVSGLAGASL----ASRPAFSTSFTRGSRVSARNPLMSRNLERN--GRITCMTFPR  56

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDL+VIGFGLIGW+ PSSVP I
Sbjct  57   DWLRRDLSVIGFGLIGWMGPSSVPAI  82



>gb|AHB79078.1| 16 kDa membrane protein [Saccharum hybrid cultivar]
Length=144

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 53/86 (62%), Gaps = 11/86 (13%)
 Frame = +3

Query  33   CAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FER  197
             +ASTV GLA +SL    +    F TS      VSARNPL    L R   G+ TC  F R
Sbjct  3    ASASTVSGLAGASL----ATRPAFSTSFARGSRVSARNPLMTRNLERN--GRITCMTFPR  56

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            DWL RDL++IG+GLIGWI PSSVP I
Sbjct  57   DWLRRDLSIIGYGLIGWIGPSSVPAI  82



>gb|KHN08815.1| hypothetical protein glysoja_046343 [Glycine soja]
Length=140

 Score = 67.8 bits (164),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +3

Query  114  DFLKPAVSARNPLKLPRAC-MGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
             F+K  V ARNPL+   A   G+ TCFER+WL  D +VIGFGLIGW+APSS+P I
Sbjct  26   GFVKSPVIARNPLRQAVAMGNGRITCFERNWLRADYSVIGFGLIGWLAPSSIPAI  80



>ref|NP_001236146.1| uncharacterized protein LOC100305746 [Glycine max]
 gb|ACU13599.1| unknown [Glycine max]
Length=140

 Score = 67.8 bits (164),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +3

Query  117  FLKPAVSARNPLKLPRAC-MGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            F+K  V ARNPL+   A   G+ TCFER+WL  D +VIGFGLIGW+APSS+P I
Sbjct  27   FVKSPVIARNPLRQAVAMGNGRITCFERNWLRADYSVIGFGLIGWLAPSSIPAI  80



>gb|ABK26506.1| unknown [Picea sitchensis]
Length=152

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +3

Query  21   AATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLK-PAVSARNPLKLPRACMGKFTCFER  197
            AA +  +S V GL TSSL       KL L+S       V   NPL+       + TCF+R
Sbjct  8    AANVTLSSPVAGLGTSSLSSSKPNAKLQLSSGVTGCTTVRGNNPLRQKGLWASRITCFQR  67

Query  198  DWLXRDLNVIGFGLIGWIAPSSVPLI  275
            +WL  D +VIGFGLIGWIAPSS+P+I
Sbjct  68   NWLRTDYSVIGFGLIGWIAPSSLPVI  93



>gb|ABK21819.1| unknown [Picea sitchensis]
Length=149

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = +3

Query  21   AATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTCFERD  200
            AA +  +S V GL TSSL       KL L+S      V   NPL+       + TCF+R+
Sbjct  8    AANVTLSSPVAGLGTSSLSSSKPNAKLQLSSG--CTTVRGNNPLRQKGLWASRITCFQRN  65

Query  201  WLXRDLNVIGFGLIGWIAPSSVPLI  275
            WL  D +VIGFGLIGWIAPSS+P+I
Sbjct  66   WLRTDYSVIGFGLIGWIAPSSLPVI  90



>ref|XP_002446437.1| hypothetical protein SORBIDRAFT_06g016090 [Sorghum bicolor]
 gb|EES10765.1| hypothetical protein SORBIDRAFT_06g016090 [Sorghum bicolor]
Length=143

 Score = 64.7 bits (156),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 54/85 (64%), Gaps = 10/85 (12%)
 Frame = +3

Query  36   AASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPL---KLPRACMGKFTC--FERD  200
            AASTV GLA +S   L+S    F TS      VSARNPL    L R   G+ TC  F RD
Sbjct  2    AASTVSGLAGAS--SLAS-RPAFSTSFTRGSRVSARNPLMTRNLERN--GRITCMTFPRD  56

Query  201  WLXRDLNVIGFGLIGWIAPSSVPLI  275
            WL RDL++IG+GLIGW+ PSS+P I
Sbjct  57   WLRRDLSIIGYGLIGWMGPSSIPAI  81



>gb|ACG27280.1| 16kDa membrane protein [Zea mays]
Length=127

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 38/53 (72%), Gaps = 7/53 (13%)
 Frame = +3

Query  132  VSARNPL---KLPRACMGKFTC--FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            VSARNPL    L R   G+ TC  F RDWL RDL+VIGFGLIGW+ PSSVP I
Sbjct  15   VSARNPLMSRNLERN--GRITCMTFPRDWLRRDLSVIGFGLIGWMGPSSVPAI  65



>gb|EMS65275.1| hypothetical protein TRIUR3_34121 [Triticum urartu]
Length=132

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +3

Query  129  AVSARNPLKLPRACMGKFTCFERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            A S    ++  R  +   T F RDWL RDLNVIGFGLIGW+APSS+PLI
Sbjct  23   AGSTHQEIRASRPVLHTET-FPRDWLRRDLNVIGFGLIGWLAPSSIPLI  70



>gb|ADI45889.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45890.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45891.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45892.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45893.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45894.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45895.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45896.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45897.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45898.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45899.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45900.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45901.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45902.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45903.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45904.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45905.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45906.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45907.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45908.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45909.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45910.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45911.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45912.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45913.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45914.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45915.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45916.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45917.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45918.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45919.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45920.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45921.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45922.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45923.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45924.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45925.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45926.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45927.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45928.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45929.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45930.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45931.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45932.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45933.1| sex-linked protein 9, partial [Silene latifolia]
 gb|ADI45934.1| sex-linked protein 9, partial [Silene latifolia]
Length=90

 Score = 56.2 bits (134),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  189  FERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
            F+RDWL RDLNVIGFGLIGW+APSS+P I
Sbjct  2    FQRDWLRRDLNVIGFGLIGWLAPSSIPAI  30



>gb|ADI45888.1| sex-linked protein 9, partial [Silene latifolia]
Length=52

 Score = 46.6 bits (109),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 6/44 (14%)
 Frame = +3

Query  105  LTSDFLKPAVSARNPLKLPRACM---GKFTC-FERDWLXRDLNV  224
            L+S FLK  V+A NPL+  +AC    G+FTC F+RDWL RDLNV
Sbjct  11   LSSGFLKSKVAAVNPLR--QACGTSGGRFTCSFQRDWLRRDLNV  52



>ref|XP_002976132.1| hypothetical protein SELMODRAFT_104218, partial [Selaginella 
moellendorffii]
 gb|EFJ23037.1| hypothetical protein SELMODRAFT_104218, partial [Selaginella 
moellendorffii]
Length=90

 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  CFERDWLXRDLNVIGFGLIGWIAPSSVPLI  275
             F  DWL  DL+VIGFGLIGW+APSS+P I
Sbjct  1    SFRGDWLRTDLSVIGFGLIGWLAPSSIPAI  30



>ref|XP_006417696.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
 gb|ESQ36049.1| hypothetical protein EUTSA_v10009047mg [Eutrema salsugineum]
Length=101

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 6/57 (11%)
 Frame = +3

Query  18   MAATLCAASTVVGLATSSLPRLSSPNKLFLTSDFLKPAVSARNPLKLPRACMGKFTC  188
            MAAT    STV+GL  SS+    SP     +S FLKP + A+NPL+L  A  G+FTC
Sbjct  1    MAATFTTPSTVIGLGGSSV----SPRPF--SSSFLKPTLRAKNPLRLAGASGGRFTC  51



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559814424900