BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF008N03

Length=345
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011096106.1|  PREDICTED: thiamine thiazole synthase 2, chl...  83.2    2e-16   Sesamum indicum [beniseed]
gb|EYU33910.1|  hypothetical protein MIMGU_mgv1a009148mg              81.6    5e-16   Erythranthe guttata [common monkey flower]
ref|XP_011037712.1|  PREDICTED: thiamine thiazole synthase 2, chl...  81.3    7e-16   Populus euphratica
ref|XP_002305603.1|  hypothetical protein POPTR_0004s01990g           80.9    9e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002281769.1|  PREDICTED: thiamine thiazole synthase 1, chl...  80.1    2e-15   Vitis vinifera
gb|AFM35683.1|  thiamin biosynthetic protein                          79.7    2e-15   Vitis pseudoreticulata
ref|XP_002267414.1|  PREDICTED: thiamine thiazole synthase 2, chl...  79.3    4e-15   Vitis vinifera
ref|XP_007143207.1|  hypothetical protein PHAVU_007G052900g           79.3    4e-15   Phaseolus vulgaris [French bean]
emb|CDO99712.1|  unnamed protein product                              77.4    2e-14   Coffea canephora [robusta coffee]
gb|KJB57700.1|  hypothetical protein B456_009G176400                  77.0    3e-14   Gossypium raimondii
gb|EYU19221.1|  hypothetical protein MIMGU_mgv1a009132mg              75.5    8e-14   Erythranthe guttata [common monkey flower]
gb|KHG02821.1|  Thiamine thiazole synthase 2, chloroplastic           75.5    9e-14   Gossypium arboreum [tree cotton]
ref|XP_011086171.1|  PREDICTED: thiamine thiazole synthase 2, chl...  75.5    1e-13   Sesamum indicum [beniseed]
ref|XP_002317206.1|  hypothetical protein POPTR_0011s00500g           75.1    1e-13   Populus trichocarpa [western balsam poplar]
gb|KJB67127.1|  hypothetical protein B456_010G176000                  74.7    2e-13   Gossypium raimondii
ref|XP_004244150.1|  PREDICTED: thiamine thiazole synthase, chlor...  74.3    3e-13   Solanum lycopersicum
gb|KJB57702.1|  hypothetical protein B456_009G176400                  73.2    3e-13   Gossypium raimondii
gb|AAP03875.1|  putative chloroplast thiazole biosynthetic protein    73.6    5e-13   Nicotiana tabacum [American tobacco]
ref|XP_009774029.1|  PREDICTED: thiamine thiazole synthase, chlor...  73.6    6e-13   Nicotiana sylvestris
gb|EPS63253.1|  hypothetical protein M569_11533                       72.8    8e-13   Genlisea aurea
ref|XP_009590342.1|  PREDICTED: thiamine thiazole synthase, chlor...  72.8    1e-12   Nicotiana tomentosiformis
gb|ABI84250.1|  thiamine biosynthetic enzyme                          71.2    1e-12   Arachis hypogaea [goober]
ref|XP_003556028.1|  PREDICTED: thiamine thiazole synthase 2, chl...  72.0    2e-12   Glycine max [soybeans]
ref|XP_004496776.1|  PREDICTED: thiamine thiazole synthase 2, chl...  71.6    2e-12   Cicer arietinum [garbanzo]
gb|KHG29710.1|  Thiamine thiazole synthase 2, chloroplastic           71.6    2e-12   Gossypium arboreum [tree cotton]
ref|XP_003536550.1|  PREDICTED: thiamine thiazole synthase 2, chl...  71.6    2e-12   Glycine max [soybeans]
gb|AEO13833.1|  thiazole biosynthetic protein                         68.9    3e-12   Camellia sinensis [black tea]
ref|XP_011000691.1|  PREDICTED: thiamine thiazole synthase 2, chl...  70.9    5e-12   Populus euphratica
ref|XP_004152916.1|  PREDICTED: thiamine thiazole synthase, chlor...  70.5    7e-12   Cucumis sativus [cucumbers]
ref|XP_004294348.1|  PREDICTED: thiamine thiazole synthase, chlor...  70.1    9e-12   Fragaria vesca subsp. vesca
gb|ACV52582.1|  thiazole biosynthetic enzyme                          67.8    1e-11   Nicotiana benthamiana
ref|XP_008244366.1|  PREDICTED: thiamine thiazole synthase, chlor...  70.1    1e-11   Prunus mume [ume]
ref|XP_006360084.1|  PREDICTED: thiamine thiazole synthase 1, chl...  69.7    2e-11   Solanum tuberosum [potatoes]
gb|EMS66450.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic       68.9    2e-11   Triticum urartu
ref|XP_003563001.1|  PREDICTED: thiamine thiazole synthase 2, chl...  68.9    2e-11   Brachypodium distachyon [annual false brome]
ref|XP_007025992.1|  Thiazole biosynthetic enzyme                     69.3    3e-11   
ref|XP_008463440.1|  PREDICTED: thiamine thiazole synthase, chlor...  68.6    3e-11   Cucumis melo [Oriental melon]
gb|EMT30436.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic       68.6    3e-11   
ref|XP_009408664.1|  PREDICTED: thiamine thiazole synthase 2, chl...  68.6    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS63028.1|  thiazole biosynthetic enzyme, chloroplastic           67.4    4e-11   Genlisea aurea
ref|NP_001105696.1|  thiamine thiazole synthase 1, chloroplastic ...  68.2    5e-11   Zea mays [maize]
gb|KDO52968.1|  hypothetical protein CISIN_1g018414mg                 68.2    5e-11   Citrus sinensis [apfelsine]
gb|AFW83047.1|  hypothetical protein ZEAMMB73_797739                  68.2    5e-11   
ref|XP_002522858.1|  electron transfer flavoprotein-ubiquinone ox...  68.2    5e-11   Ricinus communis
ref|NP_001275783.1|  thiamine thiazole synthase, chloroplastic        67.8    6e-11   Citrus sinensis [apfelsine]
ref|XP_006452193.1|  hypothetical protein CICLE_v10008765mg           67.8    6e-11   Citrus clementina [clementine]
ref|XP_004965741.1|  PREDICTED: thiamine thiazole synthase 2, chl...  67.8    6e-11   Setaria italica
ref|XP_004505443.1|  PREDICTED: thiamine thiazole synthase, chlor...  67.8    7e-11   Cicer arietinum [garbanzo]
ref|XP_011030844.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...  67.8    7e-11   Populus euphratica
ref|XP_002316981.2|  hypothetical protein POPTR_0011s13820g           67.4    8e-11   Populus trichocarpa [western balsam poplar]
ref|XP_004957903.1|  PREDICTED: thiamine thiazole synthase 2, chl...  67.4    8e-11   Setaria italica
ref|XP_010105570.1|  Thiamine thiazole synthase 2                     67.0    1e-10   
ref|XP_002463222.1|  hypothetical protein SORBIDRAFT_02g040060        67.0    1e-10   Sorghum bicolor [broomcorn]
ref|XP_010267751.1|  PREDICTED: thiamine thiazole synthase 2, chl...  67.0    1e-10   Nelumbo nucifera [Indian lotus]
gb|KEH43920.1|  thiazole biosynthetic enzyme                          67.0    1e-10   Medicago truncatula
ref|XP_004504342.1|  PREDICTED: thiamine thiazole synthase, chlor...  67.0    1e-10   Cicer arietinum [garbanzo]
gb|AFK44470.1|  unknown                                               66.6    1e-10   Medicago truncatula
gb|KDO52969.1|  hypothetical protein CISIN_1g018414mg                 66.2    1e-10   Citrus sinensis [apfelsine]
ref|XP_002458014.1|  hypothetical protein SORBIDRAFT_03g025520        66.6    2e-10   Sorghum bicolor [broomcorn]
ref|XP_007213805.1|  hypothetical protein PRUPE_ppa007657mg           66.6    2e-10   Prunus persica
ref|XP_004294669.1|  PREDICTED: thiamine thiazole synthase, chlor...  66.2    2e-10   Fragaria vesca subsp. vesca
ref|XP_010545204.1|  PREDICTED: thiamine thiazole synthase, chlor...  66.2    2e-10   Tarenaya hassleriana [spider flower]
gb|ACN36998.1|  unknown                                               64.7    2e-10   Zea mays [maize]
ref|XP_009378870.1|  PREDICTED: thiamine thiazole synthase, chlor...  66.2    2e-10   Pyrus x bretschneideri [bai li]
gb|ACF85034.1|  unknown                                               65.5    3e-10   Zea mays [maize]
ref|XP_009358110.1|  PREDICTED: thiamine thiazole synthase, chlor...  65.9    3e-10   
gb|AAZ93636.1|  pathogen-induced defense-responsive protein 8         65.9    3e-10   Oryza sativa Indica Group [Indian rice]
dbj|BAC45141.1|  putative thiamine biosynthesis protein               65.9    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008366026.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...  65.9    4e-10   
gb|EAZ04139.1|  hypothetical protein OsI_26282                        65.9    4e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010062976.1|  PREDICTED: thiamine thiazole synthase 1, chl...  65.9    4e-10   
gb|AGT16062.1|  Thiazole biosynthetic enzyme Thi4 family              65.9    4e-10   Saccharum hybrid cultivar R570
ref|NP_001059841.1|  Os07g0529600                                     65.9    4e-10   
ref|XP_006657781.1|  PREDICTED: thiamine thiazole synthase 2, chl...  65.5    4e-10   Oryza brachyantha
ref|NP_001105697.1|  thiamine thiazole synthase 2, chloroplastic ...  65.5    4e-10   
gb|AGT16846.1|  Thiazole biosynthetic enzyme Thi4 family              65.5    4e-10   Saccharum hybrid cultivar R570
gb|AGT15954.1|  Thiazole biosynthetic enzyme Thi4 family              65.5    4e-10   Saccharum hybrid cultivar R570
gb|AGT17015.1|  thiazole biosynthetic enzyme                          65.5    4e-10   Saccharum hybrid cultivar R570
gb|AGT16507.1|  Thiazole biosynthetic enzyme Thi4 family              65.5    4e-10   Saccharum hybrid cultivar R570
sp|Q38709.1|THI4_ALNGL  RecName: Full=Thiamine thiazole synthase,...  65.5    4e-10   Alnus glutinosa
gb|AFO59577.1|  thiamine biosynthetic enzyme                          65.5    4e-10   Saccharum hybrid cultivar GT28
ref|XP_007132954.1|  hypothetical protein PHAVU_011G139100g           65.5    5e-10   Phaseolus vulgaris [French bean]
gb|ACF87708.1|  unknown                                               65.5    5e-10   Zea mays [maize]
ref|XP_008386070.1|  PREDICTED: thiamine thiazole synthase, chlor...  64.7    5e-10   
gb|AHA84206.1|  thiamin biosynthetic enzyme                           65.1    5e-10   Phaseolus vulgaris [French bean]
ref|XP_010670817.1|  PREDICTED: thiamine thiazole synthase, chlor...  65.1    6e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670818.1|  PREDICTED: thiamine thiazole synthase 2, chl...  64.7    7e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670808.1|  PREDICTED: thiamine thiazole synthase 2, chl...  64.7    8e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB13600.1|  hypothetical protein B456_002G083700                  64.7    8e-10   Gossypium raimondii
ref|XP_001767548.1|  predicted protein                                64.7    8e-10   
gb|ADG27845.1|  thiazole biosynthetic enzyme                          64.7    8e-10   Gossypium hirsutum [American cotton]
ref|XP_010930933.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...  64.7    9e-10   
dbj|BAC79982.1|  putative thiamine biosynthesis protein               63.9    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AFK49080.1|  unknown                                               62.4    1e-09   Medicago truncatula
gb|ABK23376.1|  unknown                                               64.3    1e-09   Picea sitchensis
ref|XP_003607681.1|  Thiazole biosynthetic enzyme                     63.9    1e-09   Medicago truncatula
dbj|BAA88226.1|  thiamin biosynthetic enzyme                          63.9    1e-09   Glycine max [soybeans]
ref|XP_008809851.1|  PREDICTED: thiamine thiazole synthase 1, chl...  63.9    1e-09   Phoenix dactylifera
ref|XP_008803216.1|  PREDICTED: thiamine thiazole synthase 2, chl...  63.9    1e-09   Phoenix dactylifera
gb|AFG52195.1|  hypothetical protein UMN_CL97Contig1_06               60.1    2e-09   Pinus taeda
gb|AEW09378.1|  hypothetical protein UMN_CL97Contig1_06               60.1    2e-09   Pinus radiata
ref|NP_001236824.1|  thiamin biosynthetic enzyme                      63.9    2e-09   
ref|XP_002973063.1|  hypothetical protein SELMODRAFT_271002           63.5    2e-09   Selaginella moellendorffii
ref|XP_002994429.1|  hypothetical protein SELMODRAFT_163429           63.5    2e-09   
ref|XP_001755171.1|  predicted protein                                63.5    2e-09   
gb|AFK49632.1|  unknown                                               63.5    2e-09   Lotus japonicus
ref|XP_001753819.1|  predicted protein                                63.5    2e-09   
ref|XP_001753698.1|  predicted protein                                63.5    2e-09   
gb|KDP39066.1|  hypothetical protein JCGZ_00823                       63.5    2e-09   Jatropha curcas
ref|XP_009388868.1|  PREDICTED: thiamine thiazole synthase 2, chl...  63.5    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006845176.1|  hypothetical protein AMTR_s00005p00239290        63.5    2e-09   Amborella trichopoda
gb|KCW70139.1|  hypothetical protein EUGRSUZ_F03433                   63.5    3e-09   Eucalyptus grandis [rose gum]
gb|ABK22862.1|  unknown                                               62.8    3e-09   Picea sitchensis
gb|AAW66657.1|  thiamine biosynthetic enzyme                          62.8    3e-09   Picrorhiza kurrooa
ref|XP_001767495.1|  predicted protein                                62.8    3e-09   
gb|KHG06769.1|  Thiamine thiazole synthase 1, chloroplastic           62.8    4e-09   Gossypium arboreum [tree cotton]
ref|XP_007021022.1|  Thiazole biosynthetic enzyme, chloroplast (A...  62.4    5e-09   Theobroma cacao [chocolate]
gb|AFK46185.1|  unknown                                               62.4    6e-09   Medicago truncatula
gb|KFK27084.1|  hypothetical protein AALP_AA8G331900                  62.0    6e-09   Arabis alpina [alpine rockcress]
ref|XP_009127069.1|  PREDICTED: thiamine thiazole synthase, chlor...  62.0    6e-09   Brassica rapa
emb|CDY28754.1|  BnaA02g09460D                                        62.0    6e-09   Brassica napus [oilseed rape]
ref|NP_200288.1|  thiazole biosynthetic enzyme                        62.0    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401539.1|  hypothetical protein EUTSA_v10013978mg           62.0    6e-09   Eutrema salsugineum [saltwater cress]
ref|XP_010443053.1|  PREDICTED: thiamine thiazole synthase, chlor...  62.0    6e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010448624.1|  PREDICTED: thiamine thiazole synthase, chlor...  62.0    6e-09   Camelina sativa [gold-of-pleasure]
ref|XP_002864354.1|  hypothetical protein ARALYDRAFT_918614           62.0    6e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_009132425.1|  PREDICTED: thiamine thiazole synthase, chlor...  62.0    7e-09   Brassica rapa
emb|CDY43024.1|  BnaA03g11710D                                        62.0    7e-09   Brassica napus [oilseed rape]
ref|XP_009120006.1|  PREDICTED: thiamine thiazole synthase, chlor...  62.0    7e-09   Brassica rapa
emb|CDY52570.1|  BnaC03g71780D                                        62.0    7e-09   Brassica napus [oilseed rape]
ref|XP_010923945.1|  PREDICTED: thiamine thiazole synthase, chlor...  62.0    7e-09   Elaeis guineensis
gb|AFK48432.1|  unknown                                               62.0    8e-09   Lotus japonicus
gb|AAV92529.1|  thiazole biosynthetic enzyme                          61.6    9e-09   Pseudotsuga menziesii var. menziesii
gb|AAV92535.1|  thiazole biosynthetic enzyme                          61.6    9e-09   Pseudotsuga menziesii var. menziesii
gb|AAV92531.1|  thiazole biosynthetic enzyme                          61.6    9e-09   Pseudotsuga menziesii var. menziesii
gb|AAV92539.1|  thiazole biosynthetic enzyme                          61.6    9e-09   Pseudotsuga menziesii var. menziesii
gb|AAV92538.1|  thiazole biosynthetic enzyme                          61.6    9e-09   Pseudotsuga menziesii var. menziesii
gb|AAV92554.1|  thiazole biosynthetic enzyme                          61.6    9e-09   Pseudotsuga menziesii var. menziesii
gb|AAV92537.1|  thiazole biosynthetic enzyme                          61.6    9e-09   Pseudotsuga menziesii var. menziesii
ref|XP_010485129.1|  PREDICTED: thiamine thiazole synthase, chlor...  62.0    1e-08   
emb|CDY42479.1|  BnaA10g08550D                                        60.5    1e-08   Brassica napus [oilseed rape]
gb|AAV92552.1|  thiazole biosynthetic enzyme                          61.2    1e-08   Pseudotsuga menziesii var. menziesii
pdb|1RP0|A  Chain A, Crystal Structure Of Thi1 Protein From Arabi...  60.5    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006467989.1|  PREDICTED: thiamine thiazole synthase 2, chl...  60.8    2e-08   Citrus sinensis [apfelsine]
ref|XP_006449089.1|  hypothetical protein CICLE_v10015727mg           60.8    2e-08   Citrus clementina [clementine]
ref|XP_006280726.1|  hypothetical protein CARUB_v10026695mg           60.5    2e-08   Capsella rubella
ref|XP_008336996.1|  PREDICTED: thiamine thiazole synthase, chlor...  58.5    2e-08   
ref|NP_001236812.1|  thiamin biosynthetic enzyme                      60.1    3e-08   Glycine max [soybeans]
dbj|BAA88225.1|  thiamin biosynthetic enzyme                          60.1    3e-08   Glycine max [soybeans]
emb|CBI23176.3|  unnamed protein product                              59.3    6e-08   Vitis vinifera
emb|CDY47441.1|  BnaC09g31160D                                        58.5    1e-07   Brassica napus [oilseed rape]
ref|XP_001754158.1|  predicted protein                                56.2    2e-07   
ref|XP_006441062.1|  hypothetical protein CICLE_v10024231mg           57.0    4e-07   
gb|KDO47270.1|  hypothetical protein CISIN_1g039605mg                 56.6    5e-07   Citrus sinensis [apfelsine]
emb|CDM85402.1|  unnamed protein product                              56.2    7e-07   Triticum aestivum [Canadian hard winter wheat]
gb|KFH67165.1|  thiazole biosynthetic enzyme, chloroplastic           53.9    4e-06   Mortierella verticillata NRRL 6337



>ref|XP_011096106.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=354

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVARE  295
            K  FFD  KSSF+G+P+ +  V  +K++        ++  PY LD+FKFQPIKESIV+RE
Sbjct  14   KAQFFDN-KSSFHGSPLSTRAVQPIKSAPQSLAITMSAAAPYNLDNFKFQPIKESIVSRE  72

Query  296  MTRRYMTDMIXYXDTD  343
            MTRRYMTDMI Y DTD
Sbjct  73   MTRRYMTDMITYADTD  88



>gb|EYU33910.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
 gb|EYU33911.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
Length=351

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVARE  295
            K SFFD  KS+F+G  VV +R      S+   L+V+ + TPY LD FKFQPIKESIVARE
Sbjct  14   KTSFFDN-KSTFHGAAVVPTRAAQPIKSTPKNLAVAMASTPYNLDDFKFQPIKESIVARE  72

Query  296  MTRRYMTDMIXYXDTD  343
            MTRRYMTDMI Y DTD
Sbjct  73   MTRRYMTDMITYADTD  88



>ref|XP_011037712.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +2

Query  110  NIKPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVA  289
            N+K SF D  KSSF+GTP+ ++       S+   +++S +   Y L SFKFQPIKESIV+
Sbjct  12   NLKSSFLDH-KSSFHGTPITTTGRFTPIKSTSSAITMSLAQPSYDLQSFKFQPIKESIVS  70

Query  290  REMTRRYMTDMIXYXDTD  343
            REMTRRYMTDM+ Y DTD
Sbjct  71   REMTRRYMTDMVTYADTD  88



>ref|XP_002305603.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
 gb|ABK94925.1| unknown [Populus trichocarpa]
 gb|EEE86114.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
Length=350

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +2

Query  110  NIKPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVA  289
            N+K SF D  KSSF+GTP+ ++       S+   +++S +   Y L SFKFQPIKESIV+
Sbjct  12   NLKSSFLDH-KSSFHGTPITTTGRFTPIKSTSPAITMSLTQPSYDLQSFKFQPIKESIVS  70

Query  290  REMTRRYMTDMIXYXDTD  343
            REMTRRYMTDM+ Y DTD
Sbjct  71   REMTRRYMTDMVTYADTD  88



>ref|XP_002281769.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Vitis 
vinifera]
 sp|F6H9A9.1|THI41_VITVI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Vitis vinifera]
Length=353

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVARE  295
            K S FD  KSSF+G P+ +    +   S+   L+V+A+  PY L SFKF+PIKESIV+RE
Sbjct  13   KASVFDPHKSSFHGVPIATQARLSPVKSTPVNLAVTAAAMPYDLRSFKFEPIKESIVSRE  72

Query  296  MTRRYMTDMIXYXDTD  343
            MTRRYM DMI Y DTD
Sbjct  73   MTRRYMMDMITYADTD  88



>gb|AFM35683.1| thiamin biosynthetic protein [Vitis pseudoreticulata]
Length=355

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +2

Query  110  NIKPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVA  289
            N KP+FFD  KSSF+G+P+    +    +     +S+S++ +PY L SFKF+PIKESIVA
Sbjct  14   NPKPAFFDN-KSSFHGSPISYRVLPIKVSHQSPTISMSSA-SPYDLQSFKFEPIKESIVA  71

Query  290  REMTRRYMTDMIXYXDTD  343
            REMTRRYM DMI Y DTD
Sbjct  72   REMTRRYMMDMITYADTD  89



>ref|XP_002267414.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Vitis 
vinifera]
 sp|F6H7K5.1|THI42_VITVI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Vitis vinifera]
Length=355

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 2/78 (3%)
 Frame = +2

Query  110  NIKPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVA  289
            N KP+FFD  KSSF+G+P+    +    +     +S+S+  +PY L SFKF+PIKESIVA
Sbjct  14   NPKPAFFDN-KSSFHGSPISYRVLPIKVSHQSPTISMSSV-SPYDLQSFKFEPIKESIVA  71

Query  290  REMTRRYMTDMIXYXDTD  343
            REMTRRYM DMI Y DTD
Sbjct  72   REMTRRYMMDMITYADTD  89



>ref|XP_007143207.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
 gb|ESW15201.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
Length=355

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +2

Query  110  NIKPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsa-shTPYXLDSFKFQPIKESIV  286
            N K SFFD   +SF+G PV  SR+   K+SS       + +  PY L SFKFQPIKESIV
Sbjct  12   NPKLSFFDHKPTSFHGKPVSQSRLTPTKSSSKQPTISMSLTPPPYDLQSFKFQPIKESIV  71

Query  287  AREMTRRYMTDMIXYXDTD  343
            +REMTRRYMTDMI Y DTD
Sbjct  72   SREMTRRYMTDMITYADTD  90



>emb|CDO99712.1| unnamed protein product [Coffea canephora]
Length=353

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVARE  295
            KPSF +  KSSF+G+P++S       +  +  +++SAS   Y  D+FKFQPI+ESIV+RE
Sbjct  13   KPSFLET-KSSFHGSPILSRVQPVKSSPQNFSVTMSASTPQYNFDAFKFQPIQESIVSRE  71

Query  296  MTRRYMTDMIXYXDTD  343
            MTRRYMTDMI Y DTD
Sbjct  72   MTRRYMTDMITYADTD  87



>gb|KJB57700.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
 gb|KJB57701.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=355

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVARE  295
            KPSF D  KSSF+GTP+ S       +S    +S+S +  PY L SFKFQPIKES VARE
Sbjct  16   KPSFLDH-KSSFHGTPLASRFTPIKSSSQTATISMSLT-PPYDLQSFKFQPIKESYVARE  73

Query  296  MTRRYMTDMIXYXDTD  343
            MTRRYM DMI Y DTD
Sbjct  74   MTRRYMMDMITYADTD  89



>gb|EYU19221.1| hypothetical protein MIMGU_mgv1a009132mg [Erythranthe guttata]
Length=352

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 7/83 (8%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhx-------lsvsashTPYXLDSFKFQPIK  274
            KPSFFD  K+SFNG P+  +     +A+           +S ++S   Y L+ F+F PIK
Sbjct  11   KPSFFDTHKTSFNGQPISPAVRRRRQATRSAKPNGSPISMSSASSPPGYDLNQFRFAPIK  70

Query  275  ESIVAREMTRRYMTDMIXYXDTD  343
            ESIV+REMTRRYMTDMI Y DTD
Sbjct  71   ESIVSREMTRRYMTDMITYADTD  93



>gb|KHG02821.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=355

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVARE  295
            KPSF D  KSSF+GTP+ S       +S    +S+S +  PY L SFKFQPI+ES VARE
Sbjct  16   KPSFLDH-KSSFHGTPLASRFTPIKSSSQISTISMSLT-PPYDLQSFKFQPIQESYVARE  73

Query  296  MTRRYMTDMIXYXDTD  343
            MTRRYM DMI Y DTD
Sbjct  74   MTRRYMMDMITYADTD  89



>ref|XP_011086171.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=353

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVARE  295
            K +FFD  KSSF+G+P+ +     ++A+ H+     +S  PY LD+FKF PIKESIV+RE
Sbjct  14   KTAFFDN-KSSFHGSPIPTRAAQPIRATPHNLSVTMSS-APYNLDNFKFHPIKESIVSRE  71

Query  296  MTRRYMTDMIXYXDTD  343
            MTRRYMTDMI Y DTD
Sbjct  72   MTRRYMTDMITYADTD  87



>ref|XP_002317206.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
 gb|EEE97818.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
Length=350

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +2

Query  110  NIKPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVA  289
            N+K SF D  KSSF+GTP+ ++       S+   +S+S +   Y L SFKFQPIKESIV+
Sbjct  12   NLKSSFLDN-KSSFHGTPITTTTRFTPIKSTSPAISMSLTQPSYDLQSFKFQPIKESIVS  70

Query  290  REMTRRYMTDMIXYXDTD  343
            REMTRRYMTDM+ Y DTD
Sbjct  71   REMTRRYMTDMVTYADTD  88



>gb|KJB67127.1| hypothetical protein B456_010G176000 [Gossypium raimondii]
Length=356

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVARE  295
            KPSF D  KSSF+GT  + SR   +K+SSH+     +   PY L SF+FQPIKES V+RE
Sbjct  16   KPSFLDHNKSSFSGT-QIPSRFTPIKSSSHNSAISMSLTPPYDLQSFEFQPIKESYVSRE  74

Query  296  MTRRYMTDMIXYXDTD  343
            MTRRYM DMI Y DTD
Sbjct  75   MTRRYMMDMITYADTD  90



>ref|XP_004244150.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Solanum 
lycopersicum]
Length=354

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 45/79 (57%), Gaps = 3/79 (4%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrv---xavkasshhxlsvsashTPYXLDSFKFQPIKESIV  286
            K +F D  KSSF G P+ S            +      + +  PY L SF F PIKESIV
Sbjct  12   KTNFIDTHKSSFYGVPISSQTRLKIVKSTPQNMSVSMSADASPPYDLGSFSFNPIKESIV  71

Query  287  AREMTRRYMTDMIXYXDTD  343
            AREMTRRYMTDMI Y DTD
Sbjct  72   AREMTRRYMTDMITYADTD  90



>gb|KJB57702.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=304

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVARE  295
            KPSF D  KSSF+GTP+ S       +S    +S+S +  PY L SFKFQPIKES VARE
Sbjct  16   KPSFLDH-KSSFHGTPLASRFTPIKSSSQTATISMSLT-PPYDLQSFKFQPIKESYVARE  73

Query  296  MTRRYMTDMIXYXDTD  343
            MTRRYM DMI Y DTD
Sbjct  74   MTRRYMMDMITYADTD  89



>gb|AAP03875.1| putative chloroplast thiazole biosynthetic protein [Nicotiana 
tabacum]
Length=358

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 4/80 (5%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrv----xavkasshhxlsvsashTPYXLDSFKFQPIKESI  283
            K +F D  KSSF+G P+ S        + + +    +S  +S  PY L++F F PIKESI
Sbjct  15   KTNFLDTHKSSFSGVPLFSQARLKPVKSAQQNMTISMSADSSPPPYDLNAFSFNPIKESI  74

Query  284  VAREMTRRYMTDMIXYXDTD  343
            V+REMTRRYMTDMI Y DTD
Sbjct  75   VSREMTRRYMTDMITYADTD  94



>ref|XP_009774029.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Nicotiana 
sylvestris]
Length=358

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 4/80 (5%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrv----xavkasshhxlsvsashTPYXLDSFKFQPIKESI  283
            K +F D  KSSF+G P+ S        + + +    +S  +S  PY L++F F PIKESI
Sbjct  15   KTNFLDTHKSSFSGVPLFSQARLKPVKSAQQNMTISMSADSSPPPYDLNAFSFNPIKESI  74

Query  284  VAREMTRRYMTDMIXYXDTD  343
            V+REMTRRYMTDMI Y DTD
Sbjct  75   VSREMTRRYMTDMITYADTD  94



>gb|EPS63253.1| hypothetical protein M569_11533 [Genlisea aurea]
Length=344

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +2

Query  134  AAKSSFNGTPvvssrvxavkas--shhxlsvsashTPYXLDSFKFQPIKESIVAREMTRR  307
            A KSSF+G PV +        S  +      +A+  PY LD+FKF PIKESIV+REMTRR
Sbjct  9    APKSSFHGLPVNTRAAVHPVTSLPARSVTVAAAAALPYNLDAFKFNPIKESIVSREMTRR  68

Query  308  YMTDMIXYXDTD  343
            YMTDMI Y DTD
Sbjct  69   YMTDMITYADTD  80



>ref|XP_009590342.1| PREDICTED: thiamine thiazole synthase, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158} 
[Nicotiana tomentosiformis]
Length=359

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 4/80 (5%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrv----xavkasshhxlsvsashTPYXLDSFKFQPIKESI  283
            K +F D  KSSF+G P+ S        + + +    +S  +S  PY L++F F PIKESI
Sbjct  16   KTNFLDTHKSSFSGIPLFSQVRLKPVKSAQQNMTISMSADSSPPPYDLNAFTFNPIKESI  75

Query  284  VAREMTRRYMTDMIXYXDTD  343
            V+REMTRRYMTDMI Y DTD
Sbjct  76   VSREMTRRYMTDMITYADTD  95



>gb|ABI84250.1| thiamine biosynthetic enzyme [Arachis hypogaea]
Length=201

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SFKFQPIKESIVAREMTRRYMTDMI Y DTD
Sbjct  51   PYDLQSFKFQPIKESIVAREMTRRYMTDMITYADTD  86



>ref|XP_003556028.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SFKFQPIKESIV+REMTRRYMTDMI Y DTD
Sbjct  51   PYDLQSFKFQPIKESIVSREMTRRYMTDMITYADTD  86



>ref|XP_004496776.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Cicer 
arietinum]
Length=350

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SFKFQPIKESIV+REMTRRYMTDMI Y DTD
Sbjct  50   PYDLQSFKFQPIKESIVSREMTRRYMTDMITYADTD  85



>gb|KHG29710.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=356

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVARE  295
            KP+F D  KSSF+GTP+ S       +S +  +S+S +  PY L SFKFQPIKES V+RE
Sbjct  16   KPTFLDHNKSSFSGTPIPSRFTPIKSSSHNSAISMSLT-PPYDLQSFKFQPIKESYVSRE  74

Query  296  MTRRYMTDMIXYXDTD  343
            MTRRYM D+I Y DTD
Sbjct  75   MTRRYMMDIITYADTD  90



>ref|XP_003536550.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SFKFQPIKESIV+REMTRRYMTDMI Y DTD
Sbjct  51   PYDLQSFKFQPIKESIVSREMTRRYMTDMITYADTD  86



>gb|AEO13833.1| thiazole biosynthetic protein [Camellia sinensis]
Length=132

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = +2

Query  110  NIKPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashT--PYXLDSFKFQPIKESI  283
            N K SF D  +SSF+G P+ S        S+ H LS+S S +  PY L SF F+PIKESI
Sbjct  15   NPKTSFLDTHQSSFHGVPLSSPIRLQPIKSTPHNLSISMSASSPPYDLRSFTFEPIKESI  74

Query  284  VAREMTRRYMTDMIXYXDTD  343
            V+REMTRRYM DMI Y DTD
Sbjct  75   VSREMTRRYMMDMITYADTD  94



>ref|XP_011000691.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +2

Query  110  NIKPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVA  289
            N+K SF D  KSSF+GTP+ ++       S+   +S+S +       SFKFQPIKESIV+
Sbjct  12   NLKSSFLDT-KSSFHGTPITTTTRFTPIKSTSPAISMSLTQPSCDFQSFKFQPIKESIVS  70

Query  290  REMTRRYMTDMIXYXDTD  343
            REMTRRYMTDM+ Y DTD
Sbjct  71   REMTRRYMTDMVTYADTD  88



>ref|XP_004152916.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004172748.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56149.1| hypothetical protein Csa_3G078800 [Cucumis sativus]
Length=359

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 4/78 (5%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashT--PYXLDSFKFQPIKESIVA  289
            KPS      SSF+GTP+ S     +K+++   L++SAS +  PY L+ FKF PI+ESIV+
Sbjct  14   KPSLLH--DSSFHGTPLASPSSLRLKSTAATSLTISASASQPPYDLNQFKFNPIRESIVS  71

Query  290  REMTRRYMTDMIXYXDTD  343
            REMTRRYMTDMI Y DTD
Sbjct  72   REMTRRYMTDMITYADTD  89



>ref|XP_004294348.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=361

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 54/79 (68%), Gaps = 4/79 (5%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkassh---hxlsvsashTPYXLDSFKFQPIKESIV  286
            KPS  D + SSF+G P+   +     +SS+     +S+SAS   Y L +FKF+PIKESIV
Sbjct  19   KPSLLDTS-SSFHGAPLARVQPLKAASSSNGHGLSVSMSASTNAYDLSNFKFEPIKESIV  77

Query  287  AREMTRRYMTDMIXYXDTD  343
            +REMTRRYMTDMI Y DTD
Sbjct  78   SREMTRRYMTDMITYADTD  96



>gb|ACV52582.1| thiazole biosynthetic enzyme [Nicotiana benthamiana]
Length=160

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 50/80 (63%), Gaps = 4/80 (5%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxa----vkasshhxlsvsashTPYXLDSFKFQPIKESI  283
            K +F D  KSSF+G P+ S          + +    +S  +S  PY L++F F PIKESI
Sbjct  10   KTNFLDTHKSSFSGVPLFSQARVKPVKYAQQNMTISMSADSSPPPYDLNAFSFNPIKESI  69

Query  284  VAREMTRRYMTDMIXYXDTD  343
            V+REMTRRYMTDMI Y DTD
Sbjct  70   VSREMTRRYMTDMITYADTD  89



>ref|XP_008244366.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Prunus 
mume]
Length=360

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 50/81 (62%), Gaps = 8/81 (10%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkassh----hxlsvsashTP-YXLDSFKFQPIKES  280
            KPS  D   SSF+GTPVV  +      +S+         +   TP Y L +FKF PIKES
Sbjct  19   KPSLLD---SSFHGTPVVRLQPAKAATNSNNHGLSVSMSANGSTPSYDLSAFKFDPIKES  75

Query  281  IVAREMTRRYMTDMIXYXDTD  343
            IV+REMTRRYMTDMI Y DTD
Sbjct  76   IVSREMTRRYMTDMITYADTD  96



>ref|XP_006360084.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Solanum 
tuberosum]
Length=357

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 44/82 (54%), Gaps = 6/82 (7%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssr------vxavkasshhxlsvsashTPYXLDSFKFQPIKE  277
            K +F D  KSSF G P+ S              +       S    PY L SF F PIKE
Sbjct  12   KTNFIDTHKSSFYGVPISSQARLKIVKSTPQNMAVSMSADASPPPPPYDLGSFSFNPIKE  71

Query  278  SIVAREMTRRYMTDMIXYXDTD  343
            SIVAREMTRRYMTDMI Y DTD
Sbjct  72   SIVAREMTRRYMTDMITYADTD  93



>gb|EMS66450.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Triticum urartu]
Length=348

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++FKF PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  46   PYDLNAFKFSPIKESIVSREMTRRYMTDMITYADTD  81



>ref|XP_003563001.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Brachypodium 
distachyon]
Length=352

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++FKF PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  50   PYDLNAFKFSPIKESIVSREMTRRYMTDMITYADTD  85



>ref|XP_007025992.1| Thiazole biosynthetic enzyme [Theobroma cacao]
 gb|EOY28614.1| Thiazole biosynthetic enzyme [Theobroma cacao]
Length=387

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +2

Query  140  KSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVAREMTRRYMTD  319
            KSSF+GTP+ S       +S    +S+S +  PY L SF FQPIKES VAREMTRRYM D
Sbjct  54   KSSFHGTPIASRFTPIRSSSQDSAISMSLNTPPYDLQSFNFQPIKESYVAREMTRRYMMD  113

Query  320  MIXYXDTD  343
            MI Y DTD
Sbjct  114  MITYADTD  121



>ref|XP_008463440.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Cucumis 
melo]
Length=359

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 51/69 (74%), Gaps = 2/69 (3%)
 Frame = +2

Query  143  SSFNGTPvvssrvxavkasshhxlsvsashT--PYXLDSFKFQPIKESIVAREMTRRYMT  316
            SSF+GTP+ S     +K+ +   L++SAS +  PY L+ FKF PI+ESIV+REMTRRYMT
Sbjct  21   SSFHGTPLASPPSLRLKSPAATSLTISASASQPPYDLNQFKFNPIRESIVSREMTRRYMT  80

Query  317  DMIXYXDTD  343
            DMI Y DTD
Sbjct  81   DMITYADTD  89



>gb|EMT30436.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Aegilops tauschii]
Length=348

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++FKF PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  46   PYDLNAFKFSPIKESIVSREMTRRYMTDMITYADTD  81



>ref|XP_009408664.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y LDSF+F+PIKES+V+REMTRRYMTDMI Y DTD
Sbjct  59   YDLDSFRFEPIKESVVSREMTRRYMTDMITYADTD  93



>gb|EPS63028.1| thiazole biosynthetic enzyme, chloroplastic, partial [Genlisea 
aurea]
Length=291

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L+SFKF PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  2    PYDLNSFKFAPIKESIVSREMTRRYMTDMITYADTD  37



>ref|NP_001105696.1| thiamine thiazole synthase 1, chloroplastic precursor [Zea mays]
 sp|Q41738.1|THI41_MAIZE RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Zea mays]
 gb|AAA96738.1| thiamine biosynthetic enzyme [Zea mays]
 gb|ACF86401.1| unknown [Zea mays]
 gb|AFW83048.1| thiazole biosynthetic enzyme 1-1, Precursor [Zea mays]
Length=354

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  56   PYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTD  91



>gb|KDO52968.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=356

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++FKF PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  57   PYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTD  92



>gb|AFW83047.1| hypothetical protein ZEAMMB73_797739 [Zea mays]
Length=384

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  56   PYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTD  91



>ref|XP_002522858.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
 gb|EEF39556.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
Length=359

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 4/79 (5%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssr--vxavkasshhxlsvsashTP-YXLDSFKFQPIKESIV  286
            K S F+++ S+F GTPV +    +     ++   +S+SAS TP Y L+SFKF PIKESIV
Sbjct  20   KASLFESS-SAFYGTPVAAPSLRMQPTSKTNAVSVSMSASSTPSYNLNSFKFDPIKESIV  78

Query  287  AREMTRRYMTDMIXYXDTD  343
            +REMTRRYMTDMI Y DTD
Sbjct  79   SREMTRRYMTDMISYADTD  97



>ref|NP_001275783.1| thiamine thiazole synthase, chloroplastic [Citrus sinensis]
 sp|O23787.1|THI4_CITSI RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Citrus 
sinensis]
 emb|CAB05370.1| thi [Citrus sinensis]
Length=356

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++FKF PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  57   PYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTD  92



>ref|XP_006452193.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
 gb|ESR65433.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
Length=356

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++FKF PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  57   PYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTD  92



>ref|XP_004965741.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=351

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  50   PYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTD  85



>ref|XP_004505443.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=352

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L+SFKF PIKESIV+REMTRRYMTDM+ + DTD
Sbjct  53   PYDLNSFKFNPIKESIVSREMTRRYMTDMVTHADTD  88



>ref|XP_011030844.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic-like 
[Populus euphratica]
Length=357

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 52/78 (67%), Gaps = 3/78 (4%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashT--PYXLDSFKFQPIKESIVA  289
            K S FD + SSF+GTP+    +      S    +VS S +  PY L++FKF+PIKESIV+
Sbjct  17   KVSPFDTS-SSFHGTPISKPTLRMQPTKSSSSPNVSISMSSPPYDLNAFKFEPIKESIVS  75

Query  290  REMTRRYMTDMIXYXDTD  343
            REMTRRYM DMI + DTD
Sbjct  76   REMTRRYMMDMITHADTD  93



>ref|XP_002316981.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
 gb|ABK94930.1| unknown [Populus trichocarpa]
 gb|EEE97593.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
Length=357

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 52/78 (67%), Gaps = 3/78 (4%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashT--PYXLDSFKFQPIKESIVA  289
            K S FD + SSF+GTP+    +      S    +VS S +  PY L++FKF+PIKESIV+
Sbjct  17   KLSPFDTS-SSFHGTPISKPTLRMQPTKSSSSPNVSISMSSPPYDLNAFKFEPIKESIVS  75

Query  290  REMTRRYMTDMIXYXDTD  343
            REMTRRYM DMI + DTD
Sbjct  76   REMTRRYMMDMITHADTD  93



>ref|XP_004957903.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=350

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SFKF PIKESIV+REMTRRYMTDMI + DTD
Sbjct  49   PYDLTSFKFSPIKESIVSREMTRRYMTDMITHADTD  84



>ref|XP_010105570.1| Thiamine thiazole synthase 2 [Morus notabilis]
 gb|EXC05099.1| Thiamine thiazole synthase 2 [Morus notabilis]
Length=353

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 2/77 (3%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrv-xavkasshhxlsvsashTPYXLDSFKFQPIKESIVAR  292
            K S F+++ SSF+GTP+        ++ +        ++  PY L +F+F+PIKESIV+R
Sbjct  13   KTSLFESS-SSFHGTPLAPPPPCLRLQPAKAGFSVSMSAAAPYDLKNFRFEPIKESIVSR  71

Query  293  EMTRRYMTDMIXYXDTD  343
            EMTRRYM DMI Y DTD
Sbjct  72   EMTRRYMMDMITYADTD  88



>ref|XP_002463222.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
 sp|C5X2M4.1|THI42_SORBI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Sorghum bicolor]
 gb|EER99743.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
Length=352

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKES+V+REMTRRYMTDMI Y DTD
Sbjct  51   PYDLTSFRFSPIKESVVSREMTRRYMTDMITYADTD  86



>ref|XP_010267751.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Nelumbo 
nucifera]
Length=356

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SFKF+PI+ESIV+REMTRRYM DMI Y DTD
Sbjct  55   PYDLQSFKFEPIRESIVSREMTRRYMMDMITYADTD  90



>gb|KEH43920.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=349

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY +++FKF PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  50   PYDINTFKFAPIKESIVSREMTRRYMTDMITYADTD  85



>ref|XP_004504342.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=349

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L+SFKF PIKESIV+REMTRRYMTDM+ + DTD
Sbjct  52   PYDLNSFKFDPIKESIVSREMTRRYMTDMVTHADTD  87



>gb|AFK44470.1| unknown [Medicago truncatula]
Length=349

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY +++FKF PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  50   PYDINTFKFAPIKESIVSREMTRRYMTDMITYADTD  85



>gb|KDO52969.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=321

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++FKF PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  57   PYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTD  92



>ref|XP_002458014.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
 sp|C5XNN6.1|THI41_SORBI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Sorghum bicolor]
 gb|EES03134.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
Length=354

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SFKF PIKESIV+REMTRRYMTDMI + DTD
Sbjct  52   PYDLTSFKFSPIKESIVSREMTRRYMTDMITHADTD  87



>ref|XP_007213805.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
 gb|EMJ15004.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
Length=360

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 49/81 (60%), Gaps = 8/81 (10%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkassh----hxlsvsashTP-YXLDSFKFQPIKES  280
            KPS  D   SSF+GT VV  +      +S+         +   TP Y L +FKF PIKES
Sbjct  19   KPSLLD---SSFHGTSVVRLQPAKAATNSNNHGLSVSMSANGSTPSYDLSAFKFDPIKES  75

Query  281  IVAREMTRRYMTDMIXYXDTD  343
            IV+REMTRRYMTDMI Y DTD
Sbjct  76   IVSREMTRRYMTDMITYADTD  96



>ref|XP_004294669.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=360

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 7/80 (9%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkass----hhxlsvsashTPYXLDSFKFQPIKESI  283
            KPS  +   SSF+G PV   +      S+       +S   S + Y L +FKF+PIKESI
Sbjct  19   KPSLLE---SSFHGVPVARVQPLKAATSNGHGLSVSMSAGGSTSAYDLTNFKFEPIKESI  75

Query  284  VAREMTRRYMTDMIXYXDTD  343
            V+REMTRRYMTDMI Y DTD
Sbjct  76   VSREMTRRYMTDMITYADTD  95



>ref|XP_010545204.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Tarenaya 
hassleriana]
Length=359

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++F+F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  59   PYDLNNFRFSPIKESIVSREMTRRYMTDMITYAETD  94



>gb|ACN36998.1| unknown [Zea mays]
Length=218

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKESIV+REMTRRYMTDMI + DTD
Sbjct  54   PYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTD  89



>ref|XP_009378870.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 51/80 (64%), Gaps = 7/80 (9%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashT----PYXLDSFKFQPIKESI  283
            KPS  D   SSF+G P+V  +      +S+  LSVS S       Y L +FKF PIKESI
Sbjct  19   KPSLLD---SSFHGAPIVRLQPAKAAPASNGGLSVSMSSNGLNPSYDLSAFKFDPIKESI  75

Query  284  VAREMTRRYMTDMIXYXDTD  343
            V+REMTRRYMTDMI Y DTD
Sbjct  76   VSREMTRRYMTDMITYADTD  95



>gb|ACF85034.1| unknown [Zea mays]
Length=307

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  9    PYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTD  44



>ref|XP_009358110.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = +2

Query  233  TP-YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            TP Y L +FKF PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  58   TPSYDLSAFKFDPIKESIVSREMTRRYMTDMITYADTD  95



>gb|AAZ93636.1| pathogen-induced defense-responsive protein 8 [Oryza sativa Indica 
Group]
Length=352

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++ +F PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTD  84



>dbj|BAC45141.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
 gb|EAZ40087.1| hypothetical protein OsJ_24530 [Oryza sativa Japonica Group]
Length=352

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++ +F PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTD  84



>ref|XP_008366026.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic 
[Malus domestica]
Length=378

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = +2

Query  233  TP-YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            TP Y L +FKF PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  58   TPSYDLSAFKFDPIKESIVSREMTRRYMTDMITYADTD  95



>gb|EAZ04139.1| hypothetical protein OsI_26282 [Oryza sativa Indica Group]
Length=353

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++ +F PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTD  84



>ref|XP_010062976.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Eucalyptus 
grandis]
Length=357

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++F+F PIKESIV+REMTRRYM DMI Y DTD
Sbjct  58   PYDLNAFRFDPIKESIVSREMTRRYMMDMITYADTD  93



>gb|AGT16062.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKES+V+REMTRRYMTDMI + DTD
Sbjct  54   PYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTD  89



>ref|NP_001059841.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAC78562.1| thiamine biosynthetic enzyme [Oryza sativa Japonica Group]
 dbj|BAF21755.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAG94352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++ +F PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  52   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTD  87



>ref|XP_006657781.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Oryza 
brachyantha]
Length=351

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++ +F PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTD  84



>ref|NP_001105697.1| thiamine thiazole synthase 2, chloroplastic precursor [Zea mays]
 sp|Q41739.1|THI42_MAIZE RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Zea mays]
 gb|AAA96739.1| thiamine biosynthetic enzyme [Zea mays]
Length=354

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKESIV+REMTRRYMTDMI + DTD
Sbjct  53   PYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTD  88



>gb|AGT16846.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16900.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKES+V+REMTRRYMTDMI + DTD
Sbjct  54   PYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTD  89



>gb|AGT15954.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16278.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16833.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT17116.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKES+V+REMTRRYMTDMI + DTD
Sbjct  54   PYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTD  89



>gb|AGT17015.1| thiazole biosynthetic enzyme [Saccharum hybrid cultivar R570]
Length=355

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKES+V+REMTRRYMTDMI + DTD
Sbjct  54   PYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTD  89



>gb|AGT16507.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKES+V+REMTRRYMTDMI + DTD
Sbjct  54   PYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTD  89



>sp|Q38709.1|THI4_ALNGL RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Alnus 
glutinosa]
 emb|CAA66064.1| thaizole biosynthetic enzmye [Alnus glutinosa]
Length=352

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = +2

Query  122  SFFDAAKSSFNGTPvvssrvxavkasshhxlsvsas---hTPYXLDSFKFQPIKESIVAR  292
            + F+ + SSF GTP+  S +      +    S+S S     PY L +F F PIKESIV+R
Sbjct  13   ALFENSASSFYGTPLAPSSIRVQPTKAGAKPSISMSGAPSPPYDLKAFTFDPIKESIVSR  72

Query  293  EMTRRYMTDMIXYXDTD  343
            EMTRRYM DMI Y DTD
Sbjct  73   EMTRRYMMDMITYADTD  89



>gb|AFO59577.1| thiamine biosynthetic enzyme [Saccharum hybrid cultivar GT28]
Length=355

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKES+V+REMTRRYMTDMI + DTD
Sbjct  54   PYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTD  89



>ref|XP_007132954.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
 gb|ESW04948.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
Length=348

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SF+FQPIKESIV+REMTRRYMTDM+ + DTD
Sbjct  51   YDLSSFRFQPIKESIVSREMTRRYMTDMVTHADTD  85



>gb|ACF87708.1| unknown [Zea mays]
 gb|ACN36053.1| unknown [Zea mays]
 tpg|DAA58589.1| TPA: thiazole biosynthetic enzyme 1-2, Precursor [Zea mays]
Length=355

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SF+F PIKESIV+REMTRRYMTDMI + DTD
Sbjct  54   PYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTD  89



>ref|XP_008386070.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Malus 
domestica]
Length=312

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 51/80 (64%), Gaps = 7/80 (9%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashT----PYXLDSFKFQPIKESI  283
            KPS  D   SSF+G P+V  +      +S+  LSVS S       Y L +FKF PIKESI
Sbjct  19   KPSLLD---SSFHGAPMVRLQPAKAAPASNGGLSVSMSANGLNPSYNLSAFKFDPIKESI  75

Query  284  VAREMTRRYMTDMIXYXDTD  343
            V+REMTRRYMTDMI Y DTD
Sbjct  76   VSREMTRRYMTDMITYADTD  95



>gb|AHA84206.1| thiamin biosynthetic enzyme [Phaseolus vulgaris]
Length=348

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SF+FQPIKESIV+REMTRRYMTDM+ + DTD
Sbjct  51   YDLSSFRFQPIKESIVSREMTRRYMTDMVTHADTD  85



>ref|XP_010670817.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=352

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L + KF PI+ESIVAREMTRRYMTDMI Y DTD
Sbjct  55   PYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTD  90



>ref|XP_010670818.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=352

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L + KF PI+ESIVAREMTRRYMTDMI Y DTD
Sbjct  55   PYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTD  90



>ref|XP_010670808.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=352

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L + KF PI+ESIVAREMTRRYMTDMI Y DTD
Sbjct  55   PYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTD  90



>gb|KJB13600.1| hypothetical protein B456_002G083700 [Gossypium raimondii]
Length=357

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++F+F PIKESIV+REMTRRYM DMI Y DTD
Sbjct  58   PYDLNNFRFDPIKESIVSREMTRRYMMDMITYADTD  93



>ref|XP_001767548.1| predicted protein [Physcomitrella patens]
 sp|A9SME1.1|THI42_PHYPA RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67683.1| predicted protein [Physcomitrella patens]
Length=356

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L+++KF+PIKESIVAREMTRRYMTDMI + DTD
Sbjct  59   YDLNNYKFEPIKESIVAREMTRRYMTDMITHADTD  93



>gb|ADG27845.1| thiazole biosynthetic enzyme [Gossypium hirsutum]
Length=357

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++F+F PIKESIV+REMTRRYM DMI Y DTD
Sbjct  58   PYDLNNFRFDPIKESIVSREMTRRYMMDMITYADTD  93



>ref|XP_010930933.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase 1, 
chloroplastic-like [Elaeis guineensis]
Length=358

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = +2

Query  116  KPSFFDAAKSSFNG--TPvvssrvxavkasshhxlsvsashTP-YXLDSFKFQPIKESIV  286
            K  F D   SSF+G   P   S   A    S      +++  P Y L+S +F+PIKESIV
Sbjct  14   KTPFLDHRHSSFHGLSPPSHVSAAAARSPGSSSLSISASTADPRYDLNSIRFEPIKESIV  73

Query  287  AREMTRRYMTDMIXYXDTD  343
            +REMTRRYMTDMI Y DTD
Sbjct  74   SREMTRRYMTDMITYADTD  92



>dbj|BAC79982.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
Length=306

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++ +F PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTD  84



>gb|AFK49080.1| unknown [Medicago truncatula]
Length=195

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++FKF PIKESIVAREMTRRYMTDM+ + DTD
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMVTHADTD  88



>gb|ABK23376.1| unknown [Picea sitchensis]
Length=368

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L+SFKF+PI+ESIVAREMTRRYM DMI + DTD
Sbjct  71   YDLESFKFEPIRESIVAREMTRRYMMDMITHADTD  105



>ref|XP_003607681.1| Thiazole biosynthetic enzyme [Medicago truncatula]
 gb|AES89878.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=350

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++FKF PIKESIVAREMTRRYMTDM+ + DTD
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMVTHADTD  88



>dbj|BAA88226.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY   SF+F+PI+ESIV+REMTRRYMTDM+ + DTD
Sbjct  52   PYDFGSFRFEPIRESIVSREMTRRYMTDMVTHADTD  87



>ref|XP_008809851.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Phoenix 
dactylifera]
Length=359

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = +2

Query  233  TP-YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            TP Y L+S +F PIKESIV+REMTRRYMTDMI Y DTD
Sbjct  57   TPKYDLNSIRFDPIKESIVSREMTRRYMTDMITYADTD  94



>ref|XP_008803216.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Phoenix 
dactylifera]
Length=355

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTP-YXLDSFKFQPIKESIVAR  292
            K SF D   SSF+G  + S        SS      +++  P Y L+S +F PIKESIV+R
Sbjct  14   KTSFVDHYHSSFSGLILPSRVSATRSHSSPSLSISASAAAPRYDLNSIRFNPIKESIVSR  73

Query  293  EMTRRYMTDMIXYXDTD  343
            EMTRRYMTDMI + DTD
Sbjct  74   EMTRRYMTDMITHADTD  90



>gb|AFG52195.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus taeda]
 gb|AFG52197.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus taeda]
Length=66

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SFKF+PI+ESIVAREMTRRYM DMI + DTD
Sbjct  4    YDLQSFKFEPIRESIVAREMTRRYMMDMITHADTD  38



>gb|AEW09378.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus radiata]
 gb|AFG52194.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus taeda]
 gb|AFG52196.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus taeda]
 gb|AFG52198.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus taeda]
 gb|AFG52199.1| hypothetical protein UMN_CL97Contig1_06, partial [Pinus taeda]
Length=66

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SFKF+PI+ESIVAREMTRRYM DMI + DTD
Sbjct  4    YDLQSFKFEPIRESIVAREMTRRYMMDMITHADTD  38



>ref|NP_001236824.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88228.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY   SF+F+PI+ESIV+REMTRRYMTDM+ + DTD
Sbjct  52   PYDFGSFRFEPIRESIVSREMTRRYMTDMVTHADTD  87



>ref|XP_002973063.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
 gb|EFJ26284.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
Length=356

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L+ F F PIKES+VAREMTRRYMTDMI Y DTD
Sbjct  57   YDLNKFSFDPIKESLVAREMTRRYMTDMITYADTD  91



>ref|XP_002994429.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
 gb|EFJ04508.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
Length=356

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L+ F F PIKES+VAREMTRRYMTDMI Y DTD
Sbjct  57   YDLNKFSFDPIKESLVAREMTRRYMTDMITYADTD  91



>ref|XP_001755171.1| predicted protein [Physcomitrella patens]
 gb|EDQ80115.1| predicted protein [Physcomitrella patens]
Length=358

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L+++KF PIKESIVAREMTRRYMTDMI + DTD
Sbjct  61   YDLNNYKFDPIKESIVAREMTRRYMTDMITHADTD  95



>gb|AFK49632.1| unknown [Lotus japonicus]
Length=355

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 48/80 (60%), Gaps = 7/80 (9%)
 Frame = +2

Query  110  NIKPSFFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTP--YXLDSFKFQPIKESI  283
            N K SF     SSF+G P+ +        +  +  ++S S     Y L++FKF P KESI
Sbjct  16   NPKSSF-----SSFHGKPISTRTTSIKSTTQQNTTTISMSLNSPAYDLEAFKFAPTKESI  70

Query  284  VAREMTRRYMTDMIXYXDTD  343
            V+REMTRRYMTDMI Y DTD
Sbjct  71   VSREMTRRYMTDMITYADTD  90



>ref|XP_001753819.1| predicted protein [Physcomitrella patens]
 sp|A9RHX1.1|THI41_PHYPA RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81571.1| predicted protein [Physcomitrella patens]
Length=357

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L+++KF PIKESIVAREMTRRYMTDMI + DTD
Sbjct  60   YDLNNYKFAPIKESIVAREMTRRYMTDMITHADTD  94



>ref|XP_001753698.1| predicted protein [Physcomitrella patens]
 ref|XP_001753700.1| predicted protein [Physcomitrella patens]
 sp|A9RHW6.1|THI43_PHYPA RecName: Full=Thiamine thiazole synthase 3, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 3; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81450.1| predicted protein [Physcomitrella patens]
 gb|EDQ81452.1| predicted protein [Physcomitrella patens]
Length=357

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L+++KF PIKESIVAREMTRRYMTDMI + DTD
Sbjct  60   YDLNNYKFAPIKESIVAREMTRRYMTDMITHADTD  94



>gb|KDP39066.1| hypothetical protein JCGZ_00823 [Jatropha curcas]
Length=354

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 10/84 (12%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhx--lsvsashTP------YXLDSFKFQPI  271
            K S FD+  S+F GTPV ++        +         +++TP      Y L+SF+F PI
Sbjct  11   KSSLFDS--SAFYGTPVAAAPPSLRMQPTKSNGVSISMSANTPSSSVPQYNLNSFRFDPI  68

Query  272  KESIVAREMTRRYMTDMIXYXDTD  343
            KESIV+REMTRRYMTDM+ + DTD
Sbjct  69   KESIVSREMTRRYMTDMVTHADTD  92



>ref|XP_009388868.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=360

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SF F+PI+ESIV+REMTRRYMTDMI Y DTD
Sbjct  60   YDLGSFSFKPIQESIVSREMTRRYMTDMISYADTD  94



>ref|XP_006845176.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
 gb|ERN06851.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
Length=355

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L  FKF+PIKESIV+REMTRRYM DMI Y DTD
Sbjct  56   YDLKDFKFEPIKESIVSREMTRRYMMDMITYADTD  90



>gb|KCW70139.1| hypothetical protein EUGRSUZ_F03433 [Eucalyptus grandis]
Length=487

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++F+F PIKESIV+REMTRRYM DMI Y DTD
Sbjct  188  PYDLNAFRFDPIKESIVSREMTRRYMMDMITYADTD  223



>gb|ABK22862.1| unknown [Picea sitchensis]
Length=335

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L+SFKF+PI+ESIVAREMTRRYM DMI + DTD
Sbjct  71   YDLESFKFEPIRESIVAREMTRRYMMDMITHADTD  105



>gb|AAW66657.1| thiamine biosynthetic enzyme [Picrorhiza kurrooa]
Length=354

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 46/78 (59%), Gaps = 3/78 (4%)
 Frame = +2

Query  116  KPSFFDAAKSSFNGTPvvssrvxavkasshhx-lsvsashTP-YXLDSFKFQPIKESIVA  289
            K SF D  KSS  G+P+ S        SS        ++ TP Y LD+  F PIKESIV+
Sbjct  14   KSSFLDT-KSSIYGSPLSSRATIQRVKSSPQNLSVTMSAATPAYDLDNLTFAPIKESIVS  72

Query  290  REMTRRYMTDMIXYXDTD  343
            REMTRRYM DMI Y DTD
Sbjct  73   REMTRRYMMDMITYADTD  90



>ref|XP_001767495.1| predicted protein [Physcomitrella patens]
 sp|A9SMC8.1|THI44_PHYPA RecName: Full=Thiamine thiazole synthase 4, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 4; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67630.1| predicted protein [Physcomitrella patens]
Length=343

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L+++KF+PIKESIVAREMTRRYMT+MI + DTD
Sbjct  46   YDLNNYKFEPIKESIVAREMTRRYMTEMITHADTD  80



>gb|KHG06769.1| Thiamine thiazole synthase 1, chloroplastic [Gossypium arboreum]
Length=357

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY  ++F+F PIKESIV+REMTRRYM DMI Y DTD
Sbjct  58   PYDFNNFRFDPIKESIVSREMTRRYMMDMIIYADTD  93



>ref|XP_007021022.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
 gb|EOY12547.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
Length=358

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L++F+F PIKESIV+REMTRRYM DMI + DTD
Sbjct  59   PYDLNNFRFDPIKESIVSREMTRRYMMDMITHADTD  94



>gb|AFK46185.1| unknown [Medicago truncatula]
Length=350

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++FKF PIKESIVAREMTRRYMTDM  + DTD
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMATHADTD  88



>gb|KFK27084.1| hypothetical protein AALP_AA8G331900 [Arabis alpina]
Length=345

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  47   YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETD  81



>ref|XP_009127069.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=349

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  51   YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETD  85



>emb|CDY28754.1| BnaA02g09460D [Brassica napus]
Length=349

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  51   YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETD  85



>ref|NP_200288.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
 sp|Q38814.1|THI4_ARATH RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16153.1|AF428385_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL16285.1|AF428355_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL31936.1|AF419604_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAC97124.1| Thi1 protein [Arabidopsis thaliana]
 dbj|BAB08756.1| thiazole biosynthetic enzyme precursor (ARA6) [Arabidopsis thaliana]
 gb|AAL06876.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL24202.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAN12914.1| At5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AED96539.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
Length=349

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  51   YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETD  85



>ref|XP_006401539.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
 gb|ESQ42992.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
Length=350

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  52   YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETD  86



>ref|XP_010443053.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=351

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  53   YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETD  87



>ref|XP_010448624.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010448632.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X2 [Camelina sativa]
Length=351

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  53   YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETD  87



>ref|XP_002864354.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40613.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  54   YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETD  88



>ref|XP_009132425.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=351

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = +2

Query  116  KPS-FFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVAR  292
            KP   FD   SSF+G+ + +S V               +   Y L++F F PIKESIV+R
Sbjct  14   KPQRLFD---SSFHGSSISASPVSVGLKPRSASTVSVRATAGYDLNAFTFAPIKESIVSR  70

Query  293  EMTRRYMTDMIXYXDTD  343
            EMTRRYMTDMI Y +TD
Sbjct  71   EMTRRYMTDMITYAETD  87



>emb|CDY43024.1| BnaA03g11710D [Brassica napus]
Length=351

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = +2

Query  116  KPS-FFDAAKSSFNGTPvvssrvxavkasshhxlsvsashTPYXLDSFKFQPIKESIVAR  292
            KP   FD   SSF+G+ + +S V               +   Y L++F F PIKESIV+R
Sbjct  14   KPQRLFD---SSFHGSSISASPVSVGLKPRSASTVSVRATAGYDLNAFTFAPIKESIVSR  70

Query  293  EMTRRYMTDMIXYXDTD  343
            EMTRRYMTDMI Y +TD
Sbjct  71   EMTRRYMTDMITYAETD  87



>ref|XP_009120006.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Brassica 
rapa]
Length=352

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  54   YDLNAFTFAPIKESIVSREMTRRYMTDMITYAETD  88



>emb|CDY52570.1| BnaC03g71780D [Brassica napus]
Length=352

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  53   YDLNAFTFAPIKESIVSREMTRRYMTDMITYAETD  87



>ref|XP_010923945.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Elaeis 
guineensis]
Length=360

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = +2

Query  233  TP-YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            TP Y L+S +F PIKESIV+REMTRRYMTDMI + DTD
Sbjct  58   TPKYDLNSIRFDPIKESIVSREMTRRYMTDMITHADTD  95



>gb|AFK48432.1| unknown [Lotus japonicus]
Length=363

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SFKF PIKESIV+REM RRYMTDM+ + DTD
Sbjct  63   YDLGSFKFAPIKESIVSREMARRYMTDMVTFADTD  97



>gb|AAV92529.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92530.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92532.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92540.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92541.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92546.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SFKF+PI+ESIVAREMTRRYM DMI + +TD
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETD  80



>gb|AAV92535.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SFKF+PI+ESIVAREMTRRYM DMI + +TD
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETD  80



>gb|AAV92531.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92533.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92534.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92536.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92542.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92543.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92544.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92545.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92547.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92548.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92549.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92550.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92551.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92555.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92556.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SFKF+PI+ESIVAREMTRRYM DMI + +TD
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETD  80



>gb|AAV92539.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SFKF+PI+ESIVAREMTRRYM DMI + +TD
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETD  80



>gb|AAV92538.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SFKF+PI+ESIVAREMTRRYM DMI + +TD
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETD  80



>gb|AAV92554.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=351

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SFKF+PI+ESIVAREMTRRYM DMI + +TD
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETD  80



>gb|AAV92537.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SFKF+PI+ESIVAREMTRRYM DMI + +TD
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETD  80



>ref|XP_010485129.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=548

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  52   YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETD  86


 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  250  YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETD  284



>emb|CDY42479.1| BnaA10g08550D [Brassica napus]
Length=258

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  54   YDLNAFTFAPIKESIVSREMTRRYMTDMITYAETD  88



>gb|AAV92552.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92553.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L SFKF+PI+ESIVAREMTRRYM DMI + +TD
Sbjct  46   YDLHSFKFEPIRESIVAREMTRRYMMDMITHAETD  80



>pdb|1RP0|A Chain A, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
 pdb|1RP0|B Chain B, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
Length=284

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI Y +TD
Sbjct  7    YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETD  41



>ref|XP_006467989.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Citrus 
sinensis]
 gb|KDO75540.1| hypothetical protein CISIN_1g018188mg [Citrus sinensis]
Length=359

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = +2

Query  140  KSSFNGTPvvssrvx-avkasshhxlsvsashTP-YXLDSFKFQPIKESIVAREMTRRYM  313
            KSSF+G+P+++SRV     +S     ++S S TP Y  +SF F PIKESIV+REMTRRYM
Sbjct  24   KSSFHGSPIITSRVTPIRSSSQSQTHTISMSLTPQYDFNSFTFDPIKESIVSREMTRRYM  83

Query  314  TDMIXYXDTD  343
            TDM+ Y DTD
Sbjct  84   TDMVTYADTD  93



>ref|XP_006449089.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
 gb|ESR62329.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
Length=359

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = +2

Query  140  KSSFNGTPvvssrvx-avkasshhxlsvsashTP-YXLDSFKFQPIKESIVAREMTRRYM  313
            KSSF+G+P+++SRV     +S     ++S S TP Y  +SF F PIKESIV+REMTRRYM
Sbjct  24   KSSFHGSPIITSRVTPIRSSSQSQTHTISMSLTPQYDFNSFTFDPIKESIVSREMTRRYM  83

Query  314  TDMIXYXDTD  343
            TDM+ Y DTD
Sbjct  84   TDMVTYADTD  93



>ref|XP_006280726.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
 gb|EOA13624.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
Length=350

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI + +TD
Sbjct  52   YDLNAFTFDPIKESIVSREMTRRYMTDMITFAETD  86



>ref|XP_008336996.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Malus 
domestica]
Length=160

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDT  340
            Y L +FKF PIKESIV+REMTR YMTDMI Y DT
Sbjct  42   YDLSAFKFDPIKESIVSREMTRHYMTDMITYADT  75



>ref|NP_001236812.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88227.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY   SF+F PI+ESIV+REMTRRYM DM+ + DTD
Sbjct  48   PYDFGSFRFDPIRESIVSREMTRRYMIDMVTHADTD  83



>dbj|BAA88225.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY   SF+F PI+ESIV+REMTRRYM DM+ + DTD
Sbjct  48   PYDFGSFRFDPIRESIVSREMTRRYMIDMVTHADTD  83



>emb|CBI23176.3| unnamed protein product [Vitis vinifera]
Length=337

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  254  FKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            FKF+PIKESIVAREMTRRYM DMI Y DTD
Sbjct  42   FKFEPIKESIVAREMTRRYMMDMITYADTD  71



>emb|CDY47441.1| BnaC09g31160D [Brassica napus]
Length=352

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++F F PIKESIV+REMTRRYMTDMI   +TD
Sbjct  54   YDLNAFTFAPIKESIVSREMTRRYMTDMITSAETD  88



>ref|XP_001754158.1| predicted protein [Physcomitrella patens]
 gb|EDQ81059.1| predicted protein [Physcomitrella patens]
Length=233

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y  +++ F PIKESIVAREMTRRYMTDMI + DTD
Sbjct  76   YDQNNYTFDPIKESIVAREMTRRYMTDMITHADTD  110



>ref|XP_006441062.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
 gb|ESR54302.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
Length=353

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  245  LDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            LD+FKF  IKESIV+RE TRRYMTDMI + DTD
Sbjct  76   LDAFKFDAIKESIVSRETTRRYMTDMITHADTD  108



>gb|KDO47270.1| hypothetical protein CISIN_1g039605mg [Citrus sinensis]
Length=352

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  245  LDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            LD+FKF  IKESIV+RE TRRYMTDMI + DTD
Sbjct  76   LDAFKFDAIKESIVSRETTRRYMTDMITHADTD  108



>emb|CDM85402.1| unnamed protein product [Triticum aestivum]
Length=338

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  236  PYXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            PY L SFKF P+KES+ +REM RRYMTDMI   +TD
Sbjct  49   PYDLSSFKFSPMKESVASREMIRRYMTDMIADVNTD  84



>gb|KFH67165.1| thiazole biosynthetic enzyme, chloroplastic [Mortierella verticillata 
NRRL 6337]
Length=307

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  239  YXLDSFKFQPIKESIVAREMTRRYMTDMIXYXDTD  343
            Y L++ KF PIKE+ V+REMTRRYMTDM+ + +TD
Sbjct  31   YDLNNLKFNPIKEADVSREMTRRYMTDMLDHAETD  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554595229600