BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF008M19

Length=275
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364242.1|  PREDICTED: probable protein S-acyltransferas...  62.0    3e-09   Solanum tuberosum [potatoes]
ref|XP_004248564.1|  PREDICTED: probable protein S-acyltransferas...  62.0    3e-09   Solanum lycopersicum
ref|XP_009610572.1|  PREDICTED: probable protein S-acyltransferas...  62.0    3e-09   Nicotiana tomentosiformis
ref|XP_009761491.1|  PREDICTED: probable protein S-acyltransferas...  59.7    6e-09   Nicotiana sylvestris
ref|XP_010692246.1|  PREDICTED: probable protein S-acyltransferas...  60.8    7e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010325709.1|  PREDICTED: probable protein S-acyltransferas...  60.5    9e-09   Solanum lycopersicum
ref|XP_006347869.1|  PREDICTED: probable protein S-acyltransferas...  60.5    9e-09   Solanum tuberosum [potatoes]
ref|XP_011090630.1|  PREDICTED: probable protein S-acyltransferas...  60.5    9e-09   Sesamum indicum [beniseed]
ref|XP_009791941.1|  PREDICTED: probable protein S-acyltransferas...  60.5    1e-08   Nicotiana sylvestris
gb|KCW73003.1|  hypothetical protein EUGRSUZ_E01439                   58.9    1e-08   Eucalyptus grandis [rose gum]
gb|EYU31985.1|  hypothetical protein MIMGU_mgv1a010704mg              60.5    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_010056317.1|  PREDICTED: probable protein S-acyltransferas...  60.1    1e-08   Eucalyptus grandis [rose gum]
ref|XP_010918308.1|  PREDICTED: probable protein S-acyltransferas...  60.1    1e-08   Elaeis guineensis
ref|XP_009616135.1|  PREDICTED: probable protein S-acyltransferas...  60.1    1e-08   Nicotiana tomentosiformis
ref|XP_011034295.1|  PREDICTED: probable protein S-acyltransferas...  59.3    2e-08   Populus euphratica
ref|XP_010255627.1|  PREDICTED: probable protein S-acyltransferas...  58.9    4e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010910146.1|  PREDICTED: probable protein S-acyltransferas...  58.9    4e-08   Elaeis guineensis
ref|XP_008798535.1|  PREDICTED: probable protein S-acyltransferas...  58.9    4e-08   Phoenix dactylifera
ref|XP_002279896.1|  PREDICTED: probable protein S-acyltransferas...  58.5    4e-08   Vitis vinifera
ref|XP_006602749.1|  PREDICTED: probable protein S-acyltransferas...  58.2    6e-08   Glycine max [soybeans]
ref|XP_002320722.2|  hypothetical protein POPTR_0014s06480g           57.8    6e-08   
gb|ACU18884.1|  unknown                                               56.6    6e-08   Glycine max [soybeans]
ref|XP_003552340.1|  PREDICTED: probable protein S-acyltransferas...  57.8    8e-08   Glycine max [soybeans]
ref|XP_008776787.1|  PREDICTED: probable protein S-acyltransferas...  58.2    8e-08   Phoenix dactylifera
ref|XP_006602748.1|  PREDICTED: probable protein S-acyltransferas...  57.8    9e-08   Glycine max [soybeans]
ref|XP_007052066.1|  DHHC-type zinc finger family protein isoform 1   58.2    9e-08   
ref|XP_002511714.1|  zinc finger protein, putative                    57.8    1e-07   Ricinus communis
gb|KDP28757.1|  hypothetical protein JCGZ_14528                       57.8    1e-07   Jatropha curcas
ref|XP_010276626.1|  PREDICTED: probable protein S-acyltransferas...  57.8    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_003521795.1|  PREDICTED: probable protein S-acyltransferas...  57.4    1e-07   Glycine max [soybeans]
gb|AHA84213.1|  palmitoyltransferase                                  57.4    1e-07   Phaseolus vulgaris [French bean]
ref|XP_007134881.1|  hypothetical protein PHAVU_010G083900g           57.4    1e-07   Phaseolus vulgaris [French bean]
ref|XP_006445267.1|  hypothetical protein CICLE_v10021302mg           57.4    1e-07   Citrus clementina [clementine]
ref|XP_003517050.1|  PREDICTED: probable protein S-acyltransferas...  57.0    2e-07   Glycine max [soybeans]
gb|EPS68199.1|  hypothetical protein M569_06570                       57.0    2e-07   Genlisea aurea
gb|KDO85816.1|  hypothetical protein CISIN_1g021813mg                 56.2    2e-07   Citrus sinensis [apfelsine]
gb|KDO85815.1|  hypothetical protein CISIN_1g021813mg                 56.2    2e-07   Citrus sinensis [apfelsine]
ref|XP_010524364.1|  PREDICTED: probable protein S-acyltransferas...  57.0    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_010544651.1|  PREDICTED: probable protein S-acyltransferas...  56.6    2e-07   Tarenaya hassleriana [spider flower]
gb|KHG00286.1|  hypothetical protein F383_19583                       56.6    2e-07   Gossypium arboreum [tree cotton]
ref|XP_006587892.1|  PREDICTED: probable protein S-acyltransferas...  56.6    2e-07   Glycine max [soybeans]
ref|XP_004506505.1|  PREDICTED: probable S-acyltransferase At3g60...  56.6    2e-07   Cicer arietinum [garbanzo]
gb|KJB09891.1|  hypothetical protein B456_001G174100                  55.5    2e-07   Gossypium raimondii
gb|KHN29455.1|  Putative S-acyltransferase                            56.6    2e-07   Glycine soja [wild soybean]
gb|ACU19432.1|  unknown                                               56.6    2e-07   Glycine max [soybeans]
ref|XP_011469138.1|  PREDICTED: probable protein S-acyltransferas...  56.6    2e-07   Fragaria vesca subsp. vesca
gb|KJB09889.1|  hypothetical protein B456_001G174100                  56.6    3e-07   Gossypium raimondii
ref|XP_011017489.1|  PREDICTED: probable protein S-acyltransferas...  56.2    3e-07   Populus euphratica
gb|KDO85814.1|  hypothetical protein CISIN_1g021813mg                 56.2    3e-07   Citrus sinensis [apfelsine]
ref|XP_002302535.2|  zinc finger family protein                       56.2    3e-07   
ref|XP_011469137.1|  PREDICTED: probable protein S-acyltransferas...  56.2    3e-07   Fragaria vesca subsp. vesca
gb|AES87286.2|  DHHC-type zinc finger protein                         56.2    3e-07   Medicago truncatula
ref|XP_007052067.1|  DHHC-type zinc finger family protein isoform 2   56.2    4e-07   
ref|XP_009116762.1|  PREDICTED: probable protein S-acyltransferas...  55.8    4e-07   Brassica rapa
ref|XP_010518152.1|  PREDICTED: probable protein S-acyltransferas...  55.8    5e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006402542.1|  hypothetical protein EUTSA_v10006120mg           55.5    5e-07   Eutrema salsugineum [saltwater cress]
ref|XP_009138811.1|  PREDICTED: probable protein S-acyltransferas...  55.5    5e-07   Brassica rapa
emb|CDY51805.1|  BnaC04g53110D                                        55.5    6e-07   Brassica napus [oilseed rape]
ref|NP_001148846.1|  palmitoyltransferase ZDHHC20                     55.5    7e-07   Zea mays [maize]
ref|XP_010413516.1|  PREDICTED: probable protein S-acyltransferas...  55.5    7e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010469144.1|  PREDICTED: probable protein S-acyltransferas...  55.5    7e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010506482.1|  PREDICTED: probable protein S-acyltransferas...  55.5    7e-07   Camelina sativa [gold-of-pleasure]
emb|CDX71777.1|  BnaC08g30970D                                        55.1    7e-07   
ref|NP_191639.2|  DHHC-type zinc finger family protein                55.1    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004975099.1|  PREDICTED: probable S-acyltransferase At3g60...  55.5    7e-07   Setaria italica
emb|CDY52347.1|  BnaA09g38960D                                        55.1    7e-07   Brassica napus [oilseed rape]
ref|XP_002446206.1|  hypothetical protein SORBIDRAFT_06g004040        55.5    7e-07   Sorghum bicolor [broomcorn]
ref|NP_001169109.1|  palmitoyltransferase ZDHHC20                     55.1    8e-07   Zea mays [maize]
ref|XP_002878349.1|  zinc finger family protein                       55.1    8e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_002882009.1|  hypothetical protein ARALYDRAFT_903981           55.1    8e-07   Arabidopsis lyrata subsp. lyrata
gb|KJB41112.1|  hypothetical protein B456_007G090900                  54.7    9e-07   Gossypium raimondii
emb|CDX89079.1|  BnaA04g01070D                                        55.1    9e-07   
ref|XP_010098912.1|  putative S-acyltransferase                       55.1    9e-07   Morus notabilis
ref|XP_009338113.1|  PREDICTED: probable protein S-acyltransferas...  55.1    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_010508175.1|  PREDICTED: probable protein S-acyltransferas...  54.7    1e-06   
gb|KJB41110.1|  hypothetical protein B456_007G090900                  54.7    1e-06   Gossypium raimondii
emb|CDX71345.1|  BnaC07g06240D                                        54.7    1e-06   
ref|XP_008393352.1|  PREDICTED: probable protein S-acyltransferas...  54.7    1e-06   
ref|XP_006291552.1|  hypothetical protein CARUB_v10017708mg           54.7    1e-06   Capsella rubella
ref|XP_009143136.1|  PREDICTED: probable protein S-acyltransferas...  54.7    1e-06   Brassica rapa
emb|CDX74736.1|  BnaA05g04820D                                        54.7    1e-06   
gb|KHG30156.1|  hypothetical protein F383_14468                       54.7    1e-06   Gossypium arboreum [tree cotton]
ref|XP_008438165.1|  PREDICTED: probable protein S-acyltransferas...  54.3    1e-06   Cucumis melo [Oriental melon]
ref|XP_004133913.1|  PREDICTED: probable S-acyltransferase At3g60...  54.3    1e-06   Cucumis sativus [cucumbers]
ref|XP_006652138.1|  PREDICTED: probable protein S-acyltransferas...  54.3    1e-06   Oryza brachyantha
gb|ABK24332.1|  unknown                                               54.3    2e-06   Picea sitchensis
gb|KFK37316.1|  hypothetical protein AALP_AA4G241200                  54.3    2e-06   Arabis alpina [alpine rockcress]
ref|XP_009346814.1|  PREDICTED: probable protein S-acyltransferas...  53.9    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_007218730.1|  hypothetical protein PRUPE_ppa009076mg           54.3    2e-06   Prunus persica
gb|KFK35280.1|  hypothetical protein AALP_AA5G264300                  54.3    2e-06   Arabis alpina [alpine rockcress]
ref|NP_001051618.1|  Os03g0804300                                     54.3    2e-06   
ref|XP_004952412.1|  PREDICTED: probable S-acyltransferase At3g60...  54.3    2e-06   Setaria italica
ref|XP_010053896.1|  PREDICTED: probable protein S-acyltransferas...  53.9    2e-06   Eucalyptus grandis [rose gum]
ref|XP_009143135.1|  PREDICTED: probable protein S-acyltransferas...  53.9    2e-06   
gb|ABF99421.1|  DHHC zinc finger domain containing protein, expre...  53.5    2e-06   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ93966.1|  predicted protein                                    53.9    2e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN40573.1|  Putative S-acyltransferase                            53.9    3e-06   Glycine soja [wild soybean]
ref|XP_003579517.1|  PREDICTED: probable protein S-acyltransferas...  53.5    3e-06   Brachypodium distachyon [annual false brome]
gb|KJB49336.1|  hypothetical protein B456_008G114100                  52.8    3e-06   Gossypium raimondii
ref|XP_006397719.1|  hypothetical protein EUTSA_v10001560mg           53.1    3e-06   Eutrema salsugineum [saltwater cress]
gb|KJB49337.1|  hypothetical protein B456_008G114100                  53.1    3e-06   Gossypium raimondii
gb|KJB49338.1|  hypothetical protein B456_008G114100                  52.4    4e-06   Gossypium raimondii
gb|KJB49335.1|  hypothetical protein B456_008G114100                  53.1    4e-06   Gossypium raimondii
gb|KCW78272.1|  hypothetical protein EUGRSUZ_D02456                   52.8    4e-06   Eucalyptus grandis [rose gum]
ref|XP_009389071.1|  PREDICTED: probable protein S-acyltransferas...  51.6    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008354779.1|  PREDICTED: uncharacterized protein LOC103418427  52.4    2e-05   
gb|EMS65746.1|  hypothetical protein TRIUR3_17127                     49.3    2e-05   Triticum urartu
ref|XP_002304438.2|  hypothetical protein POPTR_0003s11520g           50.8    3e-05   Populus trichocarpa [western balsam poplar]
gb|EEC76365.1|  hypothetical protein OsI_13959                        50.8    3e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_009351330.1|  PREDICTED: probable protein S-acyltransferas...  48.9    3e-05   Pyrus x bretschneideri [bai li]
gb|EMT07089.1|  Putative S-acyltransferase                            50.4    3e-05   
ref|XP_011033891.1|  PREDICTED: probable protein S-acyltransferas...  50.4    4e-05   Populus euphratica
ref|XP_008343300.1|  PREDICTED: probable protein S-acyltransferas...  50.1    5e-05   Malus domestica [apple tree]
ref|XP_004492612.1|  PREDICTED: probable S-acyltransferase At3g60...  49.7    6e-05   Cicer arietinum [garbanzo]
emb|CBI38870.3|  unnamed protein product                              49.7    7e-05   Vitis vinifera
gb|KJB09890.1|  hypothetical protein B456_001G174100                  48.9    1e-04   Gossypium raimondii
emb|CAB82684.1|  putative protein                                     48.9    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003605089.1|  Palmitoyltransferase pfa3                        48.5    1e-04   
ref|XP_006851861.1|  hypothetical protein AMTR_s00041p00097340        48.5    1e-04   
ref|XP_009399491.1|  PREDICTED: probable protein S-acyltransferas...  48.5    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002509618.1|  hypothetical protein RCOM_1680880                46.2    2e-04   
ref|XP_009398464.1|  PREDICTED: probable protein S-acyltransferas...  48.1    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011029092.1|  PREDICTED: probable protein S-acyltransferas...  47.8    3e-04   Populus euphratica
ref|XP_011029093.1|  PREDICTED: probable protein S-acyltransferas...  47.0    4e-04   Populus euphratica
ref|XP_010662159.1|  PREDICTED: probable protein S-acyltransferas...  47.0    5e-04   Vitis vinifera
ref|XP_006368710.1|  hypothetical protein POPTR_0001s08000g           47.0    5e-04   
ref|XP_007039984.1|  DHHC-type zinc finger family protein             47.0    6e-04   
ref|XP_003635680.2|  PREDICTED: probable protein S-acyltransferas...  46.6    8e-04   Vitis vinifera
gb|KJB37584.1|  hypothetical protein B456_006G211800                  46.6    8e-04   Gossypium raimondii
gb|KHG16541.1|  hypothetical protein F383_02611                       46.2    9e-04   Gossypium arboreum [tree cotton]



>ref|XP_006364242.1| PREDICTED: probable protein S-acyltransferase 14-like [Solanum 
tuberosum]
Length=308

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS AVMAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MYRSGAVMAWNVFRFCTALRGLGSIMILLV  30



>ref|XP_004248564.1| PREDICTED: probable protein S-acyltransferase 14 [Solanum lycopersicum]
Length=308

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS AVMAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MYRSGAVMAWNVFRFCTALRGLGSIMILLV  30



>ref|XP_009610572.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana tomentosiformis]
Length=308

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS AVMAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MYRSGAVMAWNVFRFCTALRGLGSIMILLV  30



>ref|XP_009761491.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana sylvestris]
Length=182

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS AVMAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MYRSGAVMAWNVFRFCTALRGLGSIMILLV  30



>ref|XP_010692246.1| PREDICTED: probable protein S-acyltransferase 14 [Beta vulgaris 
subsp. vulgaris]
Length=307

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS  VMAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MYRSGTVMAWNVFRFCTALRGLGSIMILLV  30



>ref|XP_010325709.1| PREDICTED: probable protein S-acyltransferase 14 [Solanum lycopersicum]
Length=309

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS  VMAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MYRSGTVMAWNVFRFCTALRGLGSIMILLV  30



>ref|XP_006347869.1| PREDICTED: probable protein S-acyltransferase 14-like [Solanum 
tuberosum]
Length=309

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS  VMAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MYRSGTVMAWNVFRFCTALRGLGSIMILLV  30



>ref|XP_011090630.1| PREDICTED: probable protein S-acyltransferase 14 [Sesamum indicum]
Length=302

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS AVMAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MYRSGAVMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_009791941.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana sylvestris]
Length=309

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS  VMAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MYRSGTVMAWNVFRFCTALRGLGSIMILLV  30



>gb|KCW73003.1| hypothetical protein EUGRSUZ_E01439 [Eucalyptus grandis]
Length=164

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS AVMAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MYRSGAVMAWNVFKFCTALRGLGSIMILLV  30



>gb|EYU31985.1| hypothetical protein MIMGU_mgv1a010704mg [Erythranthe guttata]
Length=304

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS AVMAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MYRSGAVMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_010056317.1| PREDICTED: probable protein S-acyltransferase 14 [Eucalyptus 
grandis]
Length=307

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS AVMAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MYRSGAVMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_010918308.1| PREDICTED: probable protein S-acyltransferase 14 [Elaeis guineensis]
Length=317

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS AVMAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGAVMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_009616135.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana tomentosiformis]
Length=309

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS  VMAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MYRSGTVMAWNVFRFCTALRGLGSIMILLV  30



>ref|XP_011034295.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=307

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS AVMAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSRAVMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_010255627.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
Length=316

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS AVMAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGAVMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_010910146.1| PREDICTED: probable protein S-acyltransferase 14 [Elaeis guineensis]
Length=317

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M RS AVMAWNVFRFCTALRGLGS+MI+LV
Sbjct  1    MQRSGAVMAWNVFRFCTALRGLGSVMILLV  30



>ref|XP_008798535.1| PREDICTED: probable protein S-acyltransferase 14 [Phoenix dactylifera]
Length=317

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS AVMAWNVF+FCTALRGLGS+MI+LV
Sbjct  1    MHRSGAVMAWNVFKFCTALRGLGSVMILLV  30



>ref|XP_002279896.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
 ref|XP_010661650.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
 emb|CAN80505.1| hypothetical protein VITISV_010744 [Vitis vinifera]
Length=307

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS AVMAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGAVMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_006602749.1| PREDICTED: probable protein S-acyltransferase 14 isoform X3 [Glycine 
max]
Length=287

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS A MAWNVFRFCTALRGLGSIMI++V
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMV  30



>ref|XP_002320722.2| hypothetical protein POPTR_0014s06480g [Populus trichocarpa]
 gb|EEE99037.2| hypothetical protein POPTR_0014s06480g [Populus trichocarpa]
Length=272

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS AVMAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSRAVMAWNVFKFCTALRGLGSIMILLV  30



>gb|ACU18884.1| unknown [Glycine max]
Length=179

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS A MAWNVFRFCTALRGLGSIMI++V
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMV  30



>ref|XP_003552340.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Glycine 
max]
Length=309

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS A MAWNVFRFCTALRGLGSIMI++V
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMV  30



>ref|XP_008776787.1| PREDICTED: probable protein S-acyltransferase 14 [Phoenix dactylifera]
Length=317

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M RSE VMAWNVFRFCT+LRGLGS+MI++V
Sbjct  1    MQRSETVMAWNVFRFCTSLRGLGSVMILIV  30



>ref|XP_006602748.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Glycine 
max]
Length=307

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS A MAWNVFRFCTALRGLGSIMI++V
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMV  30



>ref|XP_007052066.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
 gb|EOX96223.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
Length=353

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_002511714.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF50383.1| zinc finger protein, putative [Ricinus communis]
Length=307

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLV  30



>gb|KDP28757.1| hypothetical protein JCGZ_14528 [Jatropha curcas]
Length=307

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_010276626.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
 ref|XP_010276634.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
Length=316

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS  VMAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGVVMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_003521795.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
X1 [Glycine max]
 gb|KHN35648.1| Putative S-acyltransferase [Glycine soja]
Length=304

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLV  30



>gb|AHA84213.1| palmitoyltransferase [Phaseolus vulgaris]
Length=304

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_007134881.1| hypothetical protein PHAVU_010G083900g [Phaseolus vulgaris]
 gb|ESW06875.1| hypothetical protein PHAVU_010G083900g [Phaseolus vulgaris]
Length=304

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_006445267.1| hypothetical protein CICLE_v10021302mg [Citrus clementina]
 ref|XP_006490917.1| PREDICTED: probable protein S-acyltransferase 14-like [Citrus 
sinensis]
 gb|ESR58507.1| hypothetical protein CICLE_v10021302mg [Citrus clementina]
 gb|KDO85813.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=307

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_003517050.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
1 [Glycine max]
 gb|KHN40156.1| Putative S-acyltransferase [Glycine soja]
Length=304

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLV  30



>gb|EPS68199.1| hypothetical protein M569_06570, partial [Genlisea aurea]
Length=315

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  183  IMYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            IM RS   MAWNVFRFCTALRGLGSIMI+LV
Sbjct  17   IMCRSGTAMAWNVFRFCTALRGLGSIMILLV  47



>gb|KDO85816.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=245

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLV  30



>gb|KDO85815.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=246

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_010524364.1| PREDICTED: probable protein S-acyltransferase 14 [Tarenaya hassleriana]
Length=307

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_010544651.1| PREDICTED: probable protein S-acyltransferase 14 [Tarenaya hassleriana]
Length=305

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLV  30



>gb|KHG00286.1| hypothetical protein F383_19583 [Gossypium arboreum]
Length=307

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_006587892.1| PREDICTED: probable protein S-acyltransferase 14-like [Glycine 
max]
Length=307

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS A MAWNVFRFCTALRGLGSIMI++V
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMV  30



>ref|XP_004506505.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=305

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLV  30



>gb|KJB09891.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
Length=230

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLV  30



>gb|KHN29455.1| Putative S-acyltransferase [Glycine soja]
Length=307

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS A MAWNVFRFCTALRGLGSIMI++V
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMV  30



>gb|ACU19432.1| unknown [Glycine max]
Length=307

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            MYRS A MAWNVFRFCTALRGLGSIMI++V
Sbjct  1    MYRSGAGMAWNVFRFCTALRGLGSIMILMV  30



>ref|XP_011469138.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=307

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGS+MI+LV
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSVMILLV  30



>gb|KJB09889.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
 gb|KJB09892.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
Length=304

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_011017489.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=307

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMI  266
            M+RS AVMAWNVF+FCTALRGLGSIMI
Sbjct  1    MHRSRAVMAWNVFKFCTALRGLGSIMI  27



>gb|KDO85814.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=295

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_002302535.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE81808.2| zinc finger family protein [Populus trichocarpa]
Length=310

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMI  266
            M+RS AVMAWNVF+FCTALRGLGSIMI
Sbjct  1    MHRSRAVMAWNVFKFCTALRGLGSIMI  27



>ref|XP_011469137.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=319

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGS+MI+LV
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSVMILLV  30



>gb|AES87286.2| DHHC-type zinc finger protein [Medicago truncatula]
Length=299

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_007052067.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao]
 gb|EOX96224.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao]
Length=336

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_009116762.1| PREDICTED: probable protein S-acyltransferase 14 [Brassica rapa]
Length=305

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_010518152.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
 ref|XP_010518153.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_006402542.1| hypothetical protein EUTSA_v10006120mg [Eutrema salsugineum]
 gb|ESQ43995.1| hypothetical protein EUTSA_v10006120mg [Eutrema salsugineum]
Length=305

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_009138811.1| PREDICTED: probable protein S-acyltransferase 14 [Brassica rapa]
Length=300

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLV  30



>emb|CDY51805.1| BnaC04g53110D [Brassica napus]
Length=309

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLV  30



>ref|NP_001148846.1| palmitoyltransferase ZDHHC20 [Zea mays]
 gb|ACF83769.1| unknown [Zea mays]
 gb|ACG33116.1| palmitoyltransferase ZDHHC20 [Zea mays]
Length=316

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = +3

Query  186  MYRSEAV-MAWNVFRFCTALRGLGSIMIVLV  275
            MYRS  V MAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MYRSAGVAMAWNVFRFCTALRGLGSIMILLV  31



>ref|XP_010413516.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=307

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_010469144.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=307

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_010506482.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLV  30



>emb|CDX71777.1| BnaC08g30970D [Brassica napus]
Length=305

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLV  30



>ref|NP_191639.2| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 sp|Q8VYP5.1|ZDH14_ARATH RecName: Full=Probable protein S-acyltransferase 14; AltName: 
Full=Probable palmitoyltransferase At3g60800; AltName: Full=Zinc 
finger DHHC domain-containing protein At3g60800 [Arabidopsis 
thaliana]
 gb|AAL49877.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20224.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01138.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE80109.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=307

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_004975099.1| PREDICTED: probable S-acyltransferase At3g60800-like [Setaria 
italica]
Length=316

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = +3

Query  186  MYRSEAV-MAWNVFRFCTALRGLGSIMIVLV  275
            MYRS  V MAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MYRSAGVAMAWNVFRFCTALRGLGSIMILLV  31



>emb|CDY52347.1| BnaA09g38960D [Brassica napus]
Length=305

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_002446206.1| hypothetical protein SORBIDRAFT_06g004040 [Sorghum bicolor]
 gb|EES10534.1| hypothetical protein SORBIDRAFT_06g004040 [Sorghum bicolor]
Length=316

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = +3

Query  186  MYRSEAV-MAWNVFRFCTALRGLGSIMIVLV  275
            MYRS  V MAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MYRSAGVAMAWNVFRFCTALRGLGSIMILLV  31



>ref|NP_001169109.1| palmitoyltransferase ZDHHC20 [Zea mays]
 gb|ACN31678.1| unknown [Zea mays]
 tpg|DAA38384.1| TPA: palmitoyltransferase ZDHHC20 [Zea mays]
Length=312

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = +3

Query  186  MYRSEAV-MAWNVFRFCTALRGLGSIMIVLV  275
            MYRS  V MAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MYRSAGVAMAWNVFRFCTALRGLGSIMILLV  31



>ref|XP_002878349.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54608.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=306

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_002882009.1| hypothetical protein ARALYDRAFT_903981 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58268.1| hypothetical protein ARALYDRAFT_903981 [Arabidopsis lyrata subsp. 
lyrata]
Length=308

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLV  30



>gb|KJB41112.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
Length=285

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALR LGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRALGSIMILLV  30



>emb|CDX89079.1| BnaA04g01070D [Brassica napus]
Length=300

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_010098912.1| putative S-acyltransferase [Morus notabilis]
 gb|EXB76214.1| putative S-acyltransferase [Morus notabilis]
Length=308

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGVAMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_009338113.1| PREDICTED: probable protein S-acyltransferase 14 [Pyrus x bretschneideri]
Length=307

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGS+MI+LV
Sbjct  1    MHRSGVAMAWNVFKFCTALRGLGSVMILLV  30



>ref|XP_010508175.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
 ref|XP_010508176.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLV  30



>gb|KJB41110.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
 gb|KJB41111.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
Length=307

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALR LGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRALGSIMILLV  30



>emb|CDX71345.1| BnaC07g06240D [Brassica napus]
Length=300

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_008393352.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=307

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGS+MI+LV
Sbjct  1    MHRSGVAMAWNVFKFCTALRGLGSVMILLV  30



>ref|XP_006291552.1| hypothetical protein CARUB_v10017708mg [Capsella rubella]
 gb|EOA24450.1| hypothetical protein CARUB_v10017708mg [Capsella rubella]
Length=306

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWN+F+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTAMAWNIFKFCTALRGLGSIMILLV  30



>ref|XP_009143136.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Brassica 
rapa]
Length=309

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI++V
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILMV  30



>emb|CDX74736.1| BnaA05g04820D [Brassica napus]
Length=309

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI++V
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILMV  30



>gb|KHG30156.1| hypothetical protein F383_14468 [Gossypium arboreum]
Length=314

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS A MAWNVF+FCTALR LGSIMI+LV
Sbjct  1    MHRSGATMAWNVFKFCTALRALGSIMILLV  30



>ref|XP_008438165.1| PREDICTED: probable protein S-acyltransferase 14 [Cucumis melo]
Length=307

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGPAMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_004133913.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
 ref|XP_004170066.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
 gb|KGN56601.1| hypothetical protein Csa_3G126160 [Cucumis sativus]
Length=307

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGPAMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_006652138.1| PREDICTED: probable protein S-acyltransferase 14-like [Oryza 
brachyantha]
Length=316

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = +3

Query  186  MYRSE-AVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS  A MAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MHRSAGAAMAWNVFRFCTALRGLGSIMILLV  31



>gb|ABK24332.1| unknown [Picea sitchensis]
Length=316

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M RS  VMAWNVF+FCTALRGLGS+MI+LV
Sbjct  1    MQRSGIVMAWNVFKFCTALRGLGSVMILLV  30



>gb|KFK37316.1| hypothetical protein AALP_AA4G241200 [Arabis alpina]
Length=307

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILLV  30



>ref|XP_009346814.1| PREDICTED: probable protein S-acyltransferase 14 [Pyrus x bretschneideri]
Length=263

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGS+MI+LV
Sbjct  1    MHRSGVAMAWNVFKFCTALRGLGSVMILLV  30



>ref|XP_007218730.1| hypothetical protein PRUPE_ppa009076mg [Prunus persica]
 ref|XP_008232661.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Prunus 
mume]
 gb|EMJ19929.1| hypothetical protein PRUPE_ppa009076mg [Prunus persica]
Length=307

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGS+MI+LV
Sbjct  1    MHRSGVTMAWNVFKFCTALRGLGSVMILLV  30



>gb|KFK35280.1| hypothetical protein AALP_AA5G264300 [Arabis alpina]
Length=305

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTAL+GLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTALKGLGSIMILLV  30



>ref|NP_001051618.1| Os03g0804300 [Oryza sativa Japonica Group]
 gb|AAS07218.1| putative zinc finger protein [Oryza sativa Japonica Group]
 gb|ABF99420.1| DHHC zinc finger domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13532.1| Os03g0804300 [Oryza sativa Japonica Group]
Length=316

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = +3

Query  186  MYRSE-AVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS  A MAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MHRSAGATMAWNVFRFCTALRGLGSIMILLV  31



>ref|XP_004952412.1| PREDICTED: probable S-acyltransferase At3g60800-like isoform 
X1 [Setaria italica]
 ref|XP_004952413.1| PREDICTED: probable S-acyltransferase At3g60800-like isoform 
X2 [Setaria italica]
Length=317

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGS+MI+LV
Sbjct  1    MHRSGTAMAWNVFKFCTALRGLGSVMILLV  30



>ref|XP_010053896.1| PREDICTED: probable protein S-acyltransferase 14 [Eucalyptus 
grandis]
 gb|KCW78271.1| hypothetical protein EUGRSUZ_D02456 [Eucalyptus grandis]
Length=307

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMI  266
            M+RS A MAWNVF+FCTALRGLGSIMI
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMI  27



>ref|XP_009143135.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Brassica 
rapa]
Length=337

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCTALRGLGSIMI++V
Sbjct  1    MHRSGTTMAWNVFKFCTALRGLGSIMILMV  30



>gb|ABF99421.1| DHHC zinc finger domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=256

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = +3

Query  186  MYRSE-AVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS  A MAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MHRSAGATMAWNVFRFCTALRGLGSIMILLV  31



>dbj|BAJ93966.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89372.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = +3

Query  186  MYRSEAV-MAWNVFRFCTALRGLGSIMIVLV  275
            M+RS  V MAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MHRSAGVAMAWNVFRFCTALRGLGSIMILLV  31



>gb|KHN40573.1| Putative S-acyltransferase [Glycine soja]
Length=371

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  183  IMYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            I  +S A MAWNVFRFCTALRGLGSIMI++V
Sbjct  64   ITAKSGAGMAWNVFRFCTALRGLGSIMILMV  94



>ref|XP_003579517.1| PREDICTED: probable protein S-acyltransferase 14 [Brachypodium 
distachyon]
Length=315

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = +3

Query  186  MYRSEAV-MAWNVFRFCTALRGLGSIMIVLV  275
            M+RS  V MAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MHRSAGVAMAWNVFRFCTALRGLGSIMILLV  31



>gb|KJB49336.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=257

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCT LRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTVLRGLGSIMILLV  30



>ref|XP_006397719.1| hypothetical protein EUTSA_v10001560mg [Eutrema salsugineum]
 gb|ESQ39172.1| hypothetical protein EUTSA_v10001560mg [Eutrema salsugineum]
Length=308

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCT LRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFQFCTVLRGLGSIMILLV  30



>gb|KJB49337.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=285

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCT LRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTVLRGLGSIMILLV  30



>gb|KJB49338.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=232

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCT LRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTVLRGLGSIMILLV  30



>gb|KJB49335.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=307

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FCT LRGLGSIMI+LV
Sbjct  1    MHRSGTTMAWNVFKFCTVLRGLGSIMILLV  30



>gb|KCW78272.1| hypothetical protein EUGRSUZ_D02456 [Eucalyptus grandis]
Length=283

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMI  266
            M+RS A MAWNVF+FCTALRGLGSIMI
Sbjct  1    MHRSGAAMAWNVFKFCTALRGLGSIMI  27



>ref|XP_009389071.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M     VMAWNVFRFCTALRGLGS+MI++V
Sbjct  1    MRSGAVVMAWNVFRFCTALRGLGSLMILIV  30



>ref|XP_008354779.1| PREDICTED: uncharacterized protein LOC103418427 [Malus domestica]
Length=822

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FC  LRGLGS+MI+LV
Sbjct  1    MHRSGVAMAWNVFKFCIVLRGLGSVMILLV  30



>gb|EMS65746.1| hypothetical protein TRIUR3_17127 [Triticum urartu]
Length=159

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MAWNVFRFCTALRGLGSIMILLV  23



>ref|XP_002304438.2| hypothetical protein POPTR_0003s11520g [Populus trichocarpa]
 gb|EEE79417.2| hypothetical protein POPTR_0003s11520g [Populus trichocarpa]
Length=318

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  198  EAVMAWNVFRFCTALRGLGSIMIVLV  275
            ++VMAWNVF+FCTALR LGSIMIVLV
Sbjct  6    KSVMAWNVFKFCTALRALGSIMIVLV  31



>gb|EEC76365.1| hypothetical protein OsI_13959 [Oryza sativa Indica Group]
Length=308

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MAWNVFRFCTALRGLGSIMILLV  23



>ref|XP_009351330.1| PREDICTED: probable protein S-acyltransferase 14, partial [Pyrus 
x bretschneideri]
Length=148

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FC  LRGLGS+MI+LV
Sbjct  1    MHRSGVAMAWNVFKFCIVLRGLGSVMILLV  30



>gb|EMT07089.1| Putative S-acyltransferase [Aegilops tauschii]
Length=308

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVFRFCTALRGLGSIMI+LV
Sbjct  1    MAWNVFRFCTALRGLGSIMILLV  23



>ref|XP_011033891.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=318

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  198  EAVMAWNVFRFCTALRGLGSIMIVLV  275
            ++VMAWNVF+FCTALR LGSIMIVLV
Sbjct  6    KSVMAWNVFKFCTALRALGSIMIVLV  31



>ref|XP_008343300.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=307

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   MAWNVF+FC  LRGLGS+MI+LV
Sbjct  1    MHRSGVAMAWNVFKFCIVLRGLGSVMILLV  30



>ref|XP_004492612.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=307

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  186  MYRSEAVMAWNVFRFCTALRGLGSIMIVL  272
            M+RS  VMAWNVF+FCT+LRGLG +MI+ 
Sbjct  1    MHRSGVVMAWNVFKFCTSLRGLGYVMIIF  29



>emb|CBI38870.3| unnamed protein product [Vitis vinifera]
Length=300

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MAWNVFKFCTALRGLGSIMILLV  23



>gb|KJB09890.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
Length=297

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MAWNVFKFCTALRGLGSIMILLV  23



>emb|CAB82684.1| putative protein [Arabidopsis thaliana]
Length=273

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MAWNVFKFCTALRGLGSIMILLV  23



>ref|XP_003605089.1| Palmitoyltransferase pfa3 [Medicago truncatula]
Length=292

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVF+FCTALRGLGSIMI+LV
Sbjct  1    MAWNVFKFCTALRGLGSIMILLV  23



>ref|XP_006851861.1| hypothetical protein AMTR_s00041p00097340 [Amborella trichopoda]
 gb|ERN13328.1| hypothetical protein AMTR_s00041p00097340 [Amborella trichopoda]
Length=305

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVF+FCTALRGLGS+MI+LV
Sbjct  1    MAWNVFKFCTALRGLGSVMILLV  23



>ref|XP_009399491.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 1/31 (3%)
 Frame = +3

Query  186  MYRSEAV-MAWNVFRFCTALRGLGSIMIVLV  275
            M RS AV MAWNVF+FCTALR LGS+MI+LV
Sbjct  1    MRRSVAVVMAWNVFKFCTALRALGSLMILLV  31



>ref|XP_002509618.1| hypothetical protein RCOM_1680880 [Ricinus communis]
 gb|EEF51005.1| hypothetical protein RCOM_1680880 [Ricinus communis]
Length=99

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  204  VMAWNVFRFCTALRGLGSIMIVLV  275
            +MAWNVF+FCTALR LGSIM+VLV
Sbjct  13   LMAWNVFKFCTALRALGSIMMVLV  36



>ref|XP_009398464.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=314

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 1/31 (3%)
 Frame = +3

Query  186  MYRS-EAVMAWNVFRFCTALRGLGSIMIVLV  275
            M+RS   VMAWNVF+FCTALR  GS+MI+LV
Sbjct  1    MHRSGPVVMAWNVFKFCTALRAFGSLMILLV  31



>ref|XP_011029092.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Populus 
euphratica]
Length=310

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVF+FCTALR LGSIMIVLV
Sbjct  1    MAWNVFKFCTALRALGSIMIVLV  23



>ref|XP_011029093.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Populus 
euphratica]
Length=271

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVF+FCTALR LGSIMIVLV
Sbjct  1    MAWNVFKFCTALRALGSIMIVLV  23



>ref|XP_010662159.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
Length=310

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVF+FCTALRGLGS+MI +V
Sbjct  1    MAWNVFKFCTALRGLGSVMIFIV  23



>ref|XP_006368710.1| hypothetical protein POPTR_0001s08000g [Populus trichocarpa]
 gb|ERP65279.1| hypothetical protein POPTR_0001s08000g [Populus trichocarpa]
Length=304

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVF+FCTALR LGSIMI LV
Sbjct  1    MAWNVFKFCTALRALGSIMIALV  23



>ref|XP_007039984.1| DHHC-type zinc finger family protein [Theobroma cacao]
 gb|EOY24485.1| DHHC-type zinc finger family protein [Theobroma cacao]
Length=312

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVF+FCTALR LGSIMIV V
Sbjct  3    MAWNVFKFCTALRALGSIMIVFV  25



>ref|XP_003635680.2| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
Length=324

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVF+FCTALRGLGS+MI +V
Sbjct  1    MAWNVFKFCTALRGLGSVMIFIV  23



>gb|KJB37584.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
 gb|KJB37586.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
Length=308

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVF+FCTALR LGSIMIV V
Sbjct  1    MAWNVFKFCTALRALGSIMIVFV  23



>gb|KHG16541.1| hypothetical protein F383_02611 [Gossypium arboreum]
Length=308

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  207  MAWNVFRFCTALRGLGSIMIVLV  275
            MAWNVF+FCTALR LGSIMIV V
Sbjct  1    MAWNVFKFCTALRALGSIMIVFV  23



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561713539050