BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF008M13

Length=338
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008811520.1|  PREDICTED: ADP-ribosylation factor 1-like          209   4e-67   Phoenix dactylifera
gb|KJB15575.1|  hypothetical protein B456_002G185200                    210   5e-67   Gossypium raimondii
ref|XP_006386699.1|  hypothetical protein POPTR_0002s19210g             210   5e-67   
gb|EAY92309.1|  hypothetical protein OsI_14032                          217   5e-67   Oryza sativa Indica Group [Indian rice]
gb|KJB11520.1|  hypothetical protein B456_001G263300                    211   6e-67   Gossypium raimondii
ref|XP_007151018.1|  hypothetical protein PHAVU_004G011900g             211   7e-67   Phaseolus vulgaris [French bean]
gb|KHN00225.1|  ADP-ribosylation factor 2                               211   7e-67   Glycine soja [wild soybean]
ref|XP_009612443.1|  PREDICTED: ADP-ribosylation factor                 211   7e-67   Nicotiana tomentosiformis
ref|NP_001280835.1|  ADP-ribosylation factor                            211   7e-67   Malus domestica [apple tree]
gb|AAT08648.1|  ADP-ribosylation factor                                 211   7e-67   Hyacinthus orientalis [common hyacinth]
ref|XP_002521452.1|  ADP-ribosylation factor, arf, putative             211   8e-67   Ricinus communis
ref|XP_002318934.1|  hypothetical protein POPTR_0013s00690g             211   8e-67   
ref|XP_002318935.1|  hypothetical protein POPTR_0013s00700g             211   8e-67   Populus trichocarpa [western balsam poplar]
ref|NP_001274832.1|  ADP-ribosylation factor 1-like protein             211   9e-67   Solanum tuberosum [potatoes]
sp|O48920.3|ARF_VIGUN  RecName: Full=ADP-ribosylation factor            211   9e-67   Vigna unguiculata
gb|KHG04267.1|  ADP-ribosylation factor                                 213   9e-67   Gossypium arboreum [tree cotton]
gb|KJB24452.1|  hypothetical protein B456_004G146100                    211   9e-67   Gossypium raimondii
ref|XP_002457613.1|  hypothetical protein SORBIDRAFT_03g010350          211   9e-67   Sorghum bicolor [broomcorn]
sp|P51822.2|ARF1_DAUCA  RecName: Full=ADP-ribosylation factor 1         211   9e-67   Daucus carota [carrots]
ref|XP_004288363.1|  PREDICTED: ADP-ribosylation factor 2-like          211   9e-67   Fragaria vesca subsp. vesca
ref|XP_003536036.1|  PREDICTED: ADP-ribosylation factor-like isof...    211   9e-67   
gb|ACJ84691.1|  unknown                                                 211   9e-67   Medicago truncatula
ref|XP_002302788.1|  hypothetical protein POPTR_0002s19210g             211   1e-66   Populus trichocarpa [western balsam poplar]
ref|XP_011040674.1|  PREDICTED: ADP-ribosylation factor-like isof...    211   1e-66   Populus euphratica
ref|XP_004252939.1|  PREDICTED: ADP-ribosylation factor 2               211   1e-66   Solanum lycopersicum
gb|ABD73294.1|  ADP-ribosylation factor-like protein                    211   1e-66   Panax ginseng [Asiatic ginseng]
gb|EPS65320.1|  hypothetical protein M569_09462                         208   1e-66   Genlisea aurea
gb|KDP28302.1|  hypothetical protein JCGZ_14073                         210   1e-66   Jatropha curcas
gb|EYU46850.1|  hypothetical protein MIMGU_mgv1a014704mg                209   1e-66   Erythranthe guttata [common monkey flower]
ref|XP_010092942.1|  ADP-ribosylation factor 2                          211   1e-66   
ref|XP_011003178.1|  PREDICTED: ADP-ribosylation factor-like isof...    210   1e-66   Populus euphratica
gb|KJB11518.1|  hypothetical protein B456_001G263300                    211   1e-66   Gossypium raimondii
ref|XP_010524305.1|  PREDICTED: ADP-ribosylation factor-like            210   1e-66   Tarenaya hassleriana [spider flower]
ref|XP_006480700.1|  PREDICTED: ADP-ribosylation factor 2-like is...    210   1e-66   Citrus sinensis [apfelsine]
ref|XP_004494449.1|  PREDICTED: ADP-ribosylation factor 2-like          210   1e-66   Cicer arietinum [garbanzo]
ref|XP_003626009.1|  ADP-ribosylation factor-like protein               211   1e-66   
ref|XP_006840725.1|  hypothetical protein AMTR_s00096p00110370          210   1e-66   
ref|XP_011038977.1|  PREDICTED: ADP-ribosylation factor-like            210   1e-66   Populus euphratica
gb|KDO66124.1|  hypothetical protein CISIN_1g029675mg                   210   2e-66   Citrus sinensis [apfelsine]
emb|CBI25984.3|  unnamed protein product                                211   2e-66   Vitis vinifera
gb|KDO72117.1|  hypothetical protein CISIN_1g030193mg                   209   2e-66   Citrus sinensis [apfelsine]
gb|EPS68301.1|  hypothetical protein M569_06468                         210   2e-66   Genlisea aurea
gb|ADB85106.1|  ADP ribosylation factor 002                             210   2e-66   Jatropha curcas
ref|XP_008777957.1|  PREDICTED: ADP-ribosylation factor                 210   2e-66   Phoenix dactylifera
gb|KJB82424.1|  hypothetical protein B456_013G208600                    209   2e-66   Gossypium raimondii
gb|ACU16903.1|  unknown                                                 211   2e-66   Glycine max [soybeans]
ref|XP_010659724.1|  PREDICTED: ADP-ribosylation factor isoform X1      210   2e-66   Vitis vinifera
ref|XP_010660901.1|  PREDICTED: ADP-ribosylation factor isoform X1      210   2e-66   Vitis vinifera
gb|KHG02135.1|  ADP-ribosylation factor                                 211   2e-66   Gossypium arboreum [tree cotton]
gb|AFW67226.1|  hypothetical protein ZEAMMB73_332083                    212   2e-66   
emb|CAN71086.1|  hypothetical protein VITISV_006303                     209   2e-66   Vitis vinifera
gb|AFW67223.1|  hypothetical protein ZEAMMB73_332083                    210   2e-66   
gb|KJB75878.1|  hypothetical protein B456_012G062700                    210   2e-66   Gossypium raimondii
ref|XP_010674549.1|  PREDICTED: ADP-ribosylation factor-like isof...    210   2e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010094415.1|  ADP-ribosylation factor 2                          211   2e-66   
gb|KCW56007.1|  hypothetical protein EUGRSUZ_I01779                     209   2e-66   Eucalyptus grandis [rose gum]
ref|XP_004304633.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    210   2e-66   Fragaria vesca subsp. vesca
ref|XP_004981305.1|  PREDICTED: ADP-ribosylation factor-like isof...    211   2e-66   
ref|XP_002466220.1|  hypothetical protein SORBIDRAFT_01g003770          209   2e-66   Sorghum bicolor [broomcorn]
ref|NP_001051676.1|  Os03g0811900                                       209   2e-66   
ref|XP_010941504.1|  PREDICTED: ADP-ribosylation factor                 209   2e-66   Elaeis guineensis
ref|XP_009389142.1|  PREDICTED: ADP-ribosylation factor 1-like          209   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007031496.1|  ADP-ribosylation factor A1F                        209   3e-66   Theobroma cacao [chocolate]
gb|ACF80896.1|  unknown                                                 209   3e-66   Zea mays [maize]
ref|NP_001105897.1|  ADP-ribosylation factor                            209   3e-66   
ref|XP_002277054.2|  PREDICTED: ADP-ribosylation factor isoform X2      209   3e-66   Vitis vinifera
ref|XP_003618209.1|  ADP-ribosylation factor                            209   3e-66   Medicago truncatula
gb|EYU46846.1|  hypothetical protein MIMGU_mgv1a014704mg                209   3e-66   Erythranthe guttata [common monkey flower]
gb|ADP00406.1|  ADP-ribosylation factor                                 209   3e-66   Actinidia chinensis
gb|AEX49947.1|  ADP-ribosylation factor 1                               209   3e-66   Haloxylon ammodendron
gb|AFW67224.1|  hypothetical protein ZEAMMB73_332083                    210   3e-66   
ref|NP_001275425.1|  ADP-ribosylation factor 2-like                     209   3e-66   Solanum tuberosum [potatoes]
ref|XP_010679455.1|  PREDICTED: ADP-ribosylation factor 2-B-like        209   3e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007224194.1|  hypothetical protein PRUPE_ppa017304mg             209   3e-66   
ref|XP_010248146.1|  PREDICTED: ADP-ribosylation factor                 209   3e-66   Nelumbo nucifera [Indian lotus]
ref|XP_002265983.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    209   3e-66   Vitis vinifera
ref|XP_006488769.1|  PREDICTED: ADP-ribosylation factor-like            209   3e-66   Citrus sinensis [apfelsine]
ref|XP_007205794.1|  hypothetical protein PRUPE_ppa010615mg             211   3e-66   
gb|ACM67553.1|  ADP-ribosylation factor-like protein                    209   3e-66   Musa acuminata AAA Group [Cavendish banana]
gb|KCW56002.1|  hypothetical protein EUGRSUZ_I01779                     210   3e-66   Eucalyptus grandis [rose gum]
ref|XP_008389662.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    209   3e-66   Malus domestica [apple tree]
gb|AFK39359.1|  unknown                                                 209   3e-66   Medicago truncatula
ref|XP_010108788.1|  ADP-ribosylation factor                            209   3e-66   
gb|KHG04030.1|  ADP-ribosylation factor 2                               209   3e-66   Gossypium arboreum [tree cotton]
ref|XP_002871626.1|  ADP-ribosylation factor A1B                        209   3e-66   Arabidopsis lyrata subsp. lyrata
gb|KDP46432.1|  hypothetical protein JCGZ_10272                         209   3e-66   Jatropha curcas
ref|NP_172533.2|  ADP-ribosylation factor A1F                           209   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305639.1|  hypothetical protein CARUB_v10010344mg             209   3e-66   
ref|XP_010319588.1|  PREDICTED: ADP-ribosylation factor                 209   3e-66   
ref|XP_006399980.1|  hypothetical protein EUTSA_v10014797mg             209   3e-66   Eutrema salsugineum [saltwater cress]
gb|AAF17671.1|AC009398_20  F20B24.7                                     209   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010651474.1|  PREDICTED: ADP-ribosylation factor 2 isoform X2    209   3e-66   
gb|EYU19417.1|  hypothetical protein MIMGU_mgv1a014679mg                209   3e-66   Erythranthe guttata [common monkey flower]
ref|XP_009776781.1|  PREDICTED: ADP-ribosylation factor-like            209   3e-66   Nicotiana sylvestris
ref|NP_001236384.1|  uncharacterized protein LOC100306021               209   3e-66   Glycine max [soybeans]
gb|KGN51378.1|  hypothetical protein Csa_5G524710                       209   3e-66   Cucumis sativus [cucumbers]
ref|XP_006390885.1|  hypothetical protein EUTSA_v10019096mg             211   3e-66   
gb|EYU38402.1|  hypothetical protein MIMGU_mgv1a014684mg                209   3e-66   Erythranthe guttata [common monkey flower]
gb|KCW56001.1|  hypothetical protein EUGRSUZ_I01779                     209   3e-66   Eucalyptus grandis [rose gum]
ref|XP_010674548.1|  PREDICTED: ADP-ribosylation factor-like isof...    209   3e-66   
ref|XP_009416365.1|  PREDICTED: ADP-ribosylation factor 1               209   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403841.1|  PREDICTED: ADP-ribosylation factor 1-like          209   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP13175.1|  unnamed protein product                                210   4e-66   Coffea canephora [robusta coffee]
ref|XP_010492280.1|  PREDICTED: ADP-ribosylation factor isoform X1      209   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006361664.1|  PREDICTED: ADP-ribosylation factor 2-like is...    209   4e-66   Solanum tuberosum [potatoes]
ref|XP_010922925.1|  PREDICTED: ADP-ribosylation factor-like isof...    208   4e-66   
ref|XP_009375124.1|  PREDICTED: ADP-ribosylation factor 1-like          209   4e-66   Pyrus x bretschneideri [bai li]
ref|XP_009121644.1|  PREDICTED: ADP-ribosylation factor 2               209   4e-66   Brassica rapa
ref|XP_002892585.1|  ADP-ribosylation factor                            209   4e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_006417443.1|  hypothetical protein EUTSA_v10008885mg             209   4e-66   Eutrema salsugineum [saltwater cress]
ref|XP_006356426.1|  PREDICTED: ADP-ribosylation factor 2-like is...    209   4e-66   Solanum tuberosum [potatoes]
gb|KJB82421.1|  hypothetical protein B456_013G208600                    210   4e-66   Gossypium raimondii
ref|XP_010943658.1|  PREDICTED: ADP-ribosylation factor 2-like          209   4e-66   Elaeis guineensis
dbj|BAB90396.1|  ADP-ribosylation factor                                215   4e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004135253.1|  PREDICTED: ADP-ribosylation factor 2-like is...    209   4e-66   
gb|AAR18698.1|  ADP-ribosylation factor 1                               209   4e-66   Populus tomentosa [Chinese white poplar]
ref|XP_006288755.1|  hypothetical protein CARUB_v10002073mg             209   4e-66   Capsella rubella
gb|KJB31031.1|  hypothetical protein B456_005G181600                    209   5e-66   Gossypium raimondii
gb|ACJ84889.1|  unknown                                                 208   5e-66   Medicago truncatula
ref|XP_002888782.1|  hypothetical protein ARALYDRAFT_476172             209   5e-66   
gb|EAZ29027.1|  hypothetical protein OsJ_13076                          209   5e-66   Oryza sativa Japonica Group [Japonica rice]
ref|NP_177206.1|  ARF GTPase family protein                             209   5e-66   Arabidopsis thaliana [mouse-ear cress]
gb|ABF99502.1|  ADP-ribosylation factor, putative, expressed            209   5e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003618207.1|  ADP-ribosylation factor                            211   5e-66   
gb|ACJ85257.1|  unknown                                                 209   5e-66   Medicago truncatula
ref|NP_001290536.1|  uncharacterized protein LOC105052388               209   5e-66   Elaeis guineensis
gb|KHG28118.1|  ARF2-B: ADP-ribosylation factor 2-B                     209   5e-66   Gossypium arboreum [tree cotton]
gb|ADH44695.1|  ADP-ribosylation factor                                 209   5e-66   Salvia miltiorrhiza [Chinese salvia]
pdb|3AQ4|A  Chain A, Molecular Insights Into Plant Cell Prolifera...    209   5e-66   Arabidopsis thaliana [mouse-ear cress]
emb|CAD12855.1|  ADP-ribosylation factor                                209   6e-66   Gossypium hirsutum [American cotton]
ref|XP_009393904.1|  PREDICTED: ADP-ribosylation factor 1-like          209   6e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_196971.1|  ADP-ribosylation factor A1B                           209   6e-66   
gb|AAC98042.1|  Strong similarity to gb|M95166 ADP-ribosylation f...    209   6e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KDP26602.1|  hypothetical protein JCGZ_17760                         209   6e-66   Jatropha curcas
ref|XP_004981306.1|  PREDICTED: ADP-ribosylation factor-like isof...    209   6e-66   
gb|AFW79620.1|  hypothetical protein ZEAMMB73_444016                    207   6e-66   
gb|ACU13131.1|  unknown                                                 209   6e-66   Glycine max [soybeans]
gb|AIX10946.1|  putative ADP-ribosylation factor                        209   6e-66   Gardenia jasminoides
ref|XP_004981304.1|  PREDICTED: ADP-ribosylation factor-like isof...    210   6e-66   
gb|KJB15578.1|  hypothetical protein B456_002G185200                    209   7e-66   Gossypium raimondii
gb|AGH68504.1|  ADP-ribosylation factor                                 208   7e-66   Ipomoea batatas [batate]
ref|XP_006841600.1|  hypothetical protein AMTR_s00003p00209290          208   7e-66   
emb|CDX69567.1|  BnaA10g19160D                                          209   8e-66   
ref|NP_001042668.1|  Os01g0265100                                       208   8e-66   
ref|XP_008223454.1|  PREDICTED: ADP-ribosylation factor-like            208   9e-66   Prunus mume [ume]
ref|XP_008812250.1|  PREDICTED: ADP-ribosylation factor 2-like          208   9e-66   Phoenix dactylifera
ref|XP_008806237.1|  PREDICTED: ADP-ribosylation factor 2-like          208   9e-66   Phoenix dactylifera
gb|AGV54289.1|  ADP-ribosylation factor                                 209   9e-66   Phaseolus vulgaris [French bean]
ref|XP_008443527.1|  PREDICTED: ADP-ribosylation factor 1-like          208   9e-66   Cucumis melo [Oriental melon]
ref|XP_010491587.1|  PREDICTED: ADP-ribosylation factor 1-like          208   9e-66   Camelina sativa [gold-of-pleasure]
emb|CDY09875.1|  BnaC09g42860D                                          209   9e-66   Brassica napus [oilseed rape]
ref|XP_011087519.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    208   9e-66   
ref|XP_010553607.1|  PREDICTED: ADP-ribosylation factor 2-B             208   1e-65   Tarenaya hassleriana [spider flower]
ref|NP_182239.1|  ADP-ribosylation factor 1                             208   1e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AEZ00866.1|  putative ADP-ribosylation factor protein                208   1e-65   Elaeis guineensis
ref|XP_009595261.1|  PREDICTED: ADP-ribosylation factor 1-like          208   1e-65   Nicotiana tomentosiformis
ref|XP_009417875.1|  PREDICTED: ADP-ribosylation factor 1-like          208   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001136508.1|  uncharacterized protein LOC100216623               208   1e-65   Zea mays [maize]
ref|XP_006344797.1|  PREDICTED: ADP-ribosylation factor 1-like is...    208   1e-65   Solanum tuberosum [potatoes]
gb|AGV54515.1|  ADP ribosylation factor                                 210   1e-65   Phaseolus vulgaris [French bean]
ref|XP_006291918.1|  hypothetical protein CARUB_v10018102mg             208   1e-65   Capsella rubella
ref|XP_006296139.1|  hypothetical protein CARUB_v10025292mg             208   1e-65   
ref|XP_004967765.1|  PREDICTED: ADP-ribosylation factor 2-like          208   1e-65   Setaria italica
ref|XP_002888469.1|  ADP-ribosylation factor                            208   1e-65   
ref|XP_009410044.1|  PREDICTED: ADP-ribosylation factor 1-like          208   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY47221.1|  BnaC09g14700D                                          208   1e-65   Brassica napus [oilseed rape]
ref|XP_009110099.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    208   1e-65   Brassica rapa
ref|NP_001044599.1|  Os01g0813400                                       208   1e-65   
ref|XP_008444322.1|  PREDICTED: ADP-ribosylation factor 2-like          208   1e-65   Cucumis melo [Oriental melon]
gb|ABY76246.1|  ADP-ribosylation factor                                 208   1e-65   Brassica napus [oilseed rape]
gb|AAO62347.1|  ARF1-like GTP-binding protein                           208   1e-65   Gossypium hirsutum [American cotton]
ref|XP_002876669.1|  ADP-ribosylation factor                            208   1e-65   
ref|XP_010551906.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    208   1e-65   Tarenaya hassleriana [spider flower]
ref|NP_001274834.1|  ARF-like small GTPase-like protein                 208   1e-65   Solanum tuberosum [potatoes]
gb|EMT17349.1|  ADP-ribosylation factor 2                               208   1e-65   
ref|XP_009110098.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    208   1e-65   Brassica rapa
ref|XP_009399937.1|  PREDICTED: ADP-ribosylation factor 2-like          207   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010922923.1|  PREDICTED: ADP-ribosylation factor 2-like is...    207   1e-65   Elaeis guineensis
ref|NP_001055892.1|  Os05g0489600                                       207   1e-65   
ref|XP_009383762.1|  PREDICTED: ADP-ribosylation factor 1               207   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY47137.1|  BnaA08g05460D                                          207   1e-65   Brassica napus [oilseed rape]
ref|XP_006305640.1|  hypothetical protein CARUB_v10010344mg             208   1e-65   
gb|ABR17508.1|  unknown                                                 207   2e-65   Picea sitchensis
ref|XP_010313707.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    207   2e-65   
ref|NP_001237492.1|  uncharacterized protein LOC100499890               207   2e-65   Glycine max [soybeans]
emb|CDM84658.1|  unnamed protein product                                207   2e-65   Triticum aestivum [Canadian hard winter wheat]
gb|AAU82112.1|  ADP-ribosylation factor                                 207   2e-65   Triticum aestivum [Canadian hard winter wheat]
gb|AFW79615.1|  hypothetical protein ZEAMMB73_444016                    208   2e-65   
ref|XP_009381359.1|  PREDICTED: ADP-ribosylation factor 1-like          207   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009105711.1|  PREDICTED: ADP-ribosylation factor 2-B-like        207   2e-65   Brassica rapa
ref|XP_002962225.1|  ARF family GTPase                                  207   2e-65   Selaginella moellendorffii
gb|AFK42466.1|  unknown                                                 207   2e-65   Lotus japonicus
ref|XP_010232478.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    207   2e-65   Brachypodium distachyon [annual false brome]
ref|XP_009391635.1|  PREDICTED: ADP-ribosylation factor 2               207   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001059207.1|  Os07g0223400                                       207   2e-65   
gb|EMT22177.1|  ADP-ribosylation factor                                 210   2e-65   
ref|XP_009394868.1|  PREDICTED: ADP-ribosylation factor 1-like          207   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACR37635.1|  unknown                                                 206   2e-65   Zea mays [maize]
ref|XP_009629758.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    209   2e-65   Nicotiana tomentosiformis
ref|XP_010551905.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    208   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_011462890.1|  PREDICTED: ADP-ribosylation factor-like isof...    207   2e-65   Fragaria vesca subsp. vesca
gb|ABR25719.1|  ADP-ribosylation factor 1                               207   2e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_003557370.1|  PREDICTED: ADP-ribosylation factor 1               207   2e-65   Brachypodium distachyon [annual false brome]
ref|XP_006416080.1|  hypothetical protein EUTSA_v10008884mg             207   2e-65   Eutrema salsugineum [saltwater cress]
ref|XP_003557369.1|  PREDICTED: ADP-ribosylation factor 1-like          207   2e-65   Brachypodium distachyon [annual false brome]
dbj|BAJ87426.1|  predicted protein                                      207   2e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB81136.1|  hypothetical protein B456_013G131000                    209   2e-65   Gossypium raimondii
emb|CDX95712.1|  BnaC03g25930D                                          207   3e-65   
gb|KHG17087.1|  ARF2-B: ADP-ribosylation factor 2-B                     208   3e-65   Gossypium arboreum [tree cotton]
gb|EMS63688.1|  ADP-ribosylation factor 2                               207   3e-65   Triticum urartu
gb|ACM67554.1|  ADP-ribosylation factor-like protein                    207   3e-65   Musa acuminata AAA Group [Cavendish banana]
ref|NP_001168955.1|  uncharacterized protein LOC100382775               207   3e-65   Zea mays [maize]
ref|XP_010694842.1|  PREDICTED: ADP-ribosylation factor 1-like          207   3e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_191788.1|  ADP-ribosylation factor A1E                           206   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113207.1|  PREDICTED: ADP-ribosylation factor 1-like          206   4e-65   Brassica rapa
ref|XP_004228551.1|  PREDICTED: ADP-ribosylation factor 2-like          206   5e-65   Solanum lycopersicum
gb|EEE66819.1|  hypothetical protein OsJ_23579                          209   5e-65   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001149117.1|  ADP-ribosylation factor                            206   5e-65   Zea mays [maize]
ref|XP_004970328.1|  PREDICTED: ADP-ribosylation factor 1-like is...    206   5e-65   Setaria italica
ref|XP_009420958.1|  PREDICTED: ADP-ribosylation factor 1-like          206   5e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF74733.1|  ADP-ribosylation factor 1                               206   5e-65   Nicotiana benthamiana
ref|XP_004970327.1|  PREDICTED: ADP-ribosylation factor 1-like is...    206   5e-65   
gb|AFW79619.1|  hypothetical protein ZEAMMB73_444016                    209   5e-65   
gb|EAY73411.1|  hypothetical protein OsI_01294                          207   6e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_009395959.1|  PREDICTED: ADP-ribosylation factor 1-like          206   6e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009115521.1|  PREDICTED: ADP-ribosylation factor 2-B             206   6e-65   
gb|AAT08663.1|  ADP-ribosylation factor                                 206   6e-65   Hyacinthus orientalis [common hyacinth]
gb|AFW78461.1|  hypothetical protein ZEAMMB73_418055                    205   6e-65   
ref|XP_004158320.1|  PREDICTED: ADP-ribosylation factor 1-like          206   7e-65   
ref|XP_001776146.1|  predicted protein                                  206   7e-65   
ref|XP_008443534.1|  PREDICTED: ADP-ribosylation factor 1-like is...    206   7e-65   Cucumis melo [Oriental melon]
emb|CDX83340.1|  BnaA03g21660D                                          206   7e-65   
gb|AAF79587.1|AC007945_7  F28C11.12                                     208   9e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AFW78462.1|  hypothetical protein ZEAMMB73_418055                    206   9e-65   
ref|NP_001170436.1|  uncharacterized protein LOC100384428               206   9e-65   Zea mays [maize]
gb|AFW78457.1|  hypothetical protein ZEAMMB73_418055                    206   1e-64   
ref|XP_001776112.1|  Arf1_5/ArfA-family small GTPase                    206   1e-64   
gb|EMS51203.1|  ADP-ribosylation factor 2                               207   1e-64   Triticum urartu
ref|XP_009133804.1|  PREDICTED: ADP-ribosylation factor 1-like          205   1e-64   Brassica rapa
gb|KJB09503.1|  hypothetical protein B456_001G146100                    205   1e-64   Gossypium raimondii
ref|XP_011462888.1|  PREDICTED: ADP-ribosylation factor-like isof...    206   1e-64   Fragaria vesca subsp. vesca
gb|EEE66818.1|  hypothetical protein OsJ_23578                          207   1e-64   Oryza sativa Japonica Group [Japonica rice]
gb|ACG31280.1|  ADP-ribosylation factor 1                               205   2e-64   Zea mays [maize]
sp|O23778.3|ARF1_CATRO  RecName: Full=ADP-ribosylation factor 1         205   2e-64   Catharanthus roseus [chatas]
gb|AAD17207.1|  ADP-ribosylation factor                                 205   2e-64   Glycine max [soybeans]
ref|XP_001764375.1|  Arf1_5/ArfA-family small GTPase                    205   2e-64   
gb|ABR17658.1|  unknown                                                 204   2e-64   Picea sitchensis
ref|XP_007147411.1|  hypothetical protein PHAVU_006G122200g             205   2e-64   Phaseolus vulgaris [French bean]
ref|XP_009138731.1|  PREDICTED: ADP-ribosylation factor 1               204   2e-64   Brassica rapa
ref|XP_001764701.1|  Arf1_5/ArfA-family small GTPase                    204   3e-64   
ref|XP_003055413.1|  predicted protein                                  204   3e-64   Micromonas pusilla CCMP1545
ref|XP_001776147.1|  Arf1_5/ArfA-family small GTPase                    204   3e-64   
ref|XP_009118871.1|  PREDICTED: ADP-ribosylation factor 1-like          204   4e-64   Brassica rapa
ref|XP_001764700.1|  predicted protein                                  204   5e-64   
ref|XP_005643690.1|  ADP-ribosylation factor 1                          204   5e-64   Coccomyxa subellipsoidea C-169
gb|AAP69821.1|  ARF                                                     203   7e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004141190.1|  PREDICTED: ADP-ribosylation factor 1-like          209   8e-64   
sp|P51824.2|ARF1_SOLTU  RecName: Full=ADP-ribosylation factor 1         204   9e-64   Solanum tuberosum [potatoes]
ref|XP_002312302.1|  ADP-ribosylation factor family protein             202   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_002314987.1|  ADP-ribosylation factor family protein             202   1e-63   Populus trichocarpa [western balsam poplar]
emb|CDS06496.1|  Putative ADP-ribosylation factor 1                     202   2e-63   Lichtheimia ramosa
ref|XP_001420856.1|  predicted protein                                  202   2e-63   Ostreococcus lucimarinus CCE9901
emb|CBI39638.3|  unnamed protein product                                213   2e-63   Vitis vinifera
ref|XP_003613219.1|  ADP-ribosylation factor                            210   3e-63   
emb|CEF99966.1|  Small GTPase superfamily, ARF/SAR type                 202   3e-63   Ostreococcus tauri
ref|XP_003533111.1|  PREDICTED: ADP-ribosylation factor 2-B-like        202   3e-63   Glycine max [soybeans]
ref|XP_010528581.1|  PREDICTED: ADP-ribosylation factor 1-like          200   3e-63   Tarenaya hassleriana [spider flower]
emb|CDH54768.1|  adp-ribosylation factor                                201   4e-63   Lichtheimia corymbifera JMRC:FSU:9682
gb|AAO63779.1|  ADP-ribosylation factor 1                               201   5e-63   Populus tremuloides
sp|P51821.2|ARF1_CHLRE  RecName: Full=ADP-ribosylation factor 1         201   5e-63   Chlamydomonas reinhardtii
emb|CDH50625.1|  adp-ribosylation factor                                201   5e-63   Lichtheimia corymbifera JMRC:FSU:9682
dbj|BAK00965.1|  predicted protein                                      200   1e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008086386.1|  P-loop containing nucleoside triphosphate hy...    200   1e-62   Glarea lozoyensis ATCC 20868
gb|KIX04641.1|  ADP-ribosylation factor                                 200   1e-62   Rhinocladiella mackenziei CBS 650.93
ref|XP_003856771.1|  hypothetical protein MYCGRDRAFT_102943             200   2e-62   Zymoseptoria tritici IPO323
ref|XP_007747463.1|  ADP-ribosylation factor                            200   2e-62   Cladophialophora psammophila CBS 110553
ref|XP_001558462.1|  ADP-ribosylation factor                            199   2e-62   Botrytis cinerea B05.10
ref|XP_007913163.1|  putative adp-ribosylation factor protein           199   2e-62   Phaeoacremonium minimum UCRPA7
ref|XP_007920061.1|  hypothetical protein MYCFIDRAFT_49010              199   2e-62   Pseudocercospora fijiensis CIRAD86
ref|XP_007725373.1|  ADP-ribosylation factor                            199   2e-62   
gb|EWZ50626.1|  ADP-ribosylation factor                                 199   2e-62   
ref|XP_007758701.1|  ADP-ribosylation factor                            199   2e-62   
ref|XP_003054231.1|  predicted protein                                  199   2e-62   
ref|XP_006438364.1|  hypothetical protein CICLE_v10032807mg             200   2e-62   
gb|KIW06748.1|  ADP-ribosylation factor                                 199   3e-62   
ref|XP_002119700.1|  PREDICTED: ADP-ribosylation factor 1               199   3e-62   
gb|EWY94085.1|  ADP-ribosylation factor                                 198   3e-62   
gb|EWZ91915.1|  ADP-ribosylation factor                                 198   3e-62   
ref|XP_005830502.1|  hypothetical protein GUITHDRAFT_163836             199   3e-62   
ref|XP_007788559.1|  putative adp-ribosylation factor protein           199   3e-62   
ref|XP_007672425.1|  hypothetical protein BAUCODRAFT_61772              199   3e-62   
ref|XP_001825200.1|  ADP-ribosylation factor                            199   3e-62   
gb|EIE79751.1|  ADP-ribosylation factor                                 199   4e-62   
emb|CEG67980.1|  Putative ADP-ribosylation factor 1                     199   4e-62   
gb|KEQ60941.1|  ARF/SAR superfamily                                     199   4e-62   
ref|XP_002973399.1|  ARF family GTPase                                  199   4e-62   
gb|KIY94970.1|  ADP-ribosylation factor 1                               199   5e-62   
gb|KIY96152.1|  ADP-ribosylation factor 1                               199   5e-62   
ref|XP_007293765.1|  ADP-ribosylation factor 1                          199   5e-62   
gb|EPB84634.1|  ADP-ribosylation factor 1                               199   5e-62   
gb|KHN99894.1|  ADP-ribosylation factor 1                               199   5e-62   
ref|XP_007692073.1|  hypothetical protein COCMIDRAFT_106246             199   6e-62   
gb|KDE06822.1|  ADP-ribosylation factor 1                               198   6e-62   
gb|EYU46843.1|  hypothetical protein MIMGU_mgv1a020290mg                199   6e-62   
ref|XP_005845590.1|  hypothetical protein CHLNCDRAFT_49011              199   6e-62   
ref|XP_003713533.1|  ADP-ribosylation factor                            198   6e-62   
gb|KIL95193.1|  adp-ribosylation factor                                 198   6e-62   
ref|XP_007820253.1|  RAS-like GTPase, Rho2 subfamily                    198   6e-62   
ref|XP_752539.1|  ADP-ribosylation factor                               198   6e-62   
ref|XP_001797240.1|  hypothetical protein SNOG_06879                    198   6e-62   
gb|KFY84038.1|  hypothetical protein V500_09663                         198   6e-62   
gb|KFH64649.1|  ADP-ribosylation factor                                 198   6e-62   
ref|XP_002628950.1|  conserved hypothetical protein                     198   7e-62   
ref|XP_001210450.1|  ADP-ribosylation factor                            198   7e-62   
ref|XP_001386620.1|  hypothetical protein PICST_79956                   198   7e-62   
ref|XP_009226423.1|  ADP-ribosylation factor                            198   7e-62   
ref|XP_003578999.1|  PREDICTED: ADP-ribosylation factor 1-like          198   7e-62   
gb|ELR01747.1|  ADP-ribosylation factor                                 198   7e-62   
ref|XP_002790403.1|  ADP-ribosylation factor                            198   8e-62   
ref|XP_001269102.1|  ADP-ribosylation factor, putative                  198   9e-62   
ref|XP_009269147.1|  ADP-ribosylation factor                            198   9e-62   
ref|XP_006671098.1|  ADP-ribosylation factor                            198   9e-62   
dbj|GAM83579.1|  hypothetical protein ANO11243_015670                   198   9e-62   
gb|EYE95405.1|  ARF/SAR superfamily                                     198   9e-62   
gb|EIE86445.1|  ADP-ribosylation factor                                 198   1e-61   
ref|XP_010802773.1|  PREDICTED: ADP-ribosylation factor 5 isoform X1    200   1e-61   
ref|XP_001392486.1|  ADP-ribosylation factor                            198   1e-61   
gb|KDB16711.1|  ADP-ribosylation factor                                 198   1e-61   
gb|ETK76464.1|  ADP-ribosylation factor                                 195   1e-61   
gb|EPQ67144.1|  ADP-ribosylation factor GTPase of the Ras superfa...    197   1e-61   
ref|XP_010885236.1|  PREDICTED: ADP-ribosylation factor 4               197   1e-61   
ref|XP_009380714.1|  PREDICTED: ADP-ribosylation factor 2-B-like        195   1e-61   
ref|XP_010753133.1|  PREDICTED: ADP-ribosylation factor 5               197   1e-61   
ref|NP_956170.1|  ADP-ribosylation factor 4                             197   1e-61   
ref|XP_004084997.2|  PREDICTED: ADP-ribosylation factor 4-like          197   1e-61   
ref|XP_005815513.1|  PREDICTED: ADP-ribosylation factor 4-like          197   2e-61   
ref|XP_004631736.1|  PREDICTED: ADP-ribosylation factor 4               195   2e-61   
ref|XP_006962569.1|  ADP-ribosylation factor GTPase of the ras su...    197   2e-61   
ref|XP_005938441.1|  PREDICTED: ADP-ribosylation factor 4-like          197   2e-61   
ref|XP_009015604.1|  hypothetical protein HELRODRAFT_64136              197   2e-61   
ref|XP_723175.1|  potential ADP-ribosylation factor                     197   2e-61   
ref|XP_002618500.1|  ADP-ribosylation factor 1                          197   2e-61   
ref|XP_009908327.1|  PREDICTED: ADP-ribosylation factor 4               197   2e-61   
gb|EUC66412.1|  ADP-ribosylation factor Arf1                            198   2e-61   
ref|XP_007828274.1|  ADP-ribosylation factor                            197   2e-61   
gb|KEP55349.1|  ADP-ribosylation factor Arf1                            198   2e-61   
ref|XP_007373512.1|  hypothetical protein SPAPADRAFT_59312              196   2e-61   
gb|EPB86904.1|  ADP-ribosylation factor                                 197   2e-61   
ref|XP_007268416.1|  ARF/SAR                                            197   2e-61   
ref|XP_459420.1|  DEHA2E02002p                                          197   2e-61   
gb|KEY71043.1|  hypothetical protein S7711_00867                        197   2e-61   
gb|EUB59848.1|  ADP-ribosylation factor                                 197   3e-61   
emb|CEG74858.1|  Putative ADP-ribosylation factor                       197   3e-61   
ref|XP_005703144.1|  ADP-ribosylation factor                            197   3e-61   
ref|XP_009495037.1|  arf/Sar family, other                              199   3e-61   
ref|XP_658730.1|  ARF_AJECA ADP-RIBOSYLATION FACTOR                     197   3e-61   
ref|XP_001837013.1|  ADP-ribosylation factor Arf1                       196   3e-61   
ref|XP_002900890.1|  ADP-ribosylation factor family                     196   3e-61   
ref|XP_001386074.1|  hypothetical protein PICST_62979                   196   3e-61   
gb|EKV18057.1|  hypothetical protein PDIP_28470                         197   3e-61   
ref|XP_005802076.1|  PREDICTED: ADP-ribosylation factor 4-like          196   3e-61   
ref|XP_005760428.1|  ADP-ribosylation factor                            197   3e-61   
gb|ACM08502.1|  ADP-ribosylation factor 4                               196   3e-61   
ref|XP_002585174.1|  ADP-ribosylation factor                            196   3e-61   
ref|XP_003448799.2|  PREDICTED: ADP-ribosylation factor 4-like          199   3e-61   
ref|XP_006090553.1|  PREDICTED: ADP-ribosylation factor 5 isoform X1    197   4e-61   
ref|XP_002900891.1|  ADP-ribosylation factor family                     196   4e-61   
gb|KHJ35367.1|  putative adp-ribosylation factor                        196   4e-61   
ref|XP_008610697.1|  ADP-ribosylation factor                            196   4e-61   
ref|XP_006959545.1|  ARF/SAR                                            196   4e-61   
ref|XP_002619854.1|  ADP-ribosylation factor 1                          196   4e-61   
ref|NP_001154084.1|  ADP-ribosylation factor 4                          196   4e-61   
emb|CAF90670.1|  unnamed protein product                                196   4e-61   
ref|XP_005706095.1|  ADP-ribosylation factor                            196   4e-61   
ref|XP_007376194.1|  hypothetical protein SPAPADRAFT_61980              196   5e-61   
ref|XP_002559517.1|  Pc13g10970                                         196   5e-61   
ref|XP_003978975.1|  PREDICTED: ADP-ribosylation factor 4-like          196   5e-61   
ref|XP_008294715.1|  PREDICTED: ADP-ribosylation factor 4-like          196   5e-61   
ref|XP_004564999.1|  PREDICTED: ADP-ribosylation factor 4-like          199   5e-61   
ref|XP_791037.1|  PREDICTED: ADP-ribosylation factor 1-like             196   5e-61   
ref|XP_008292410.1|  PREDICTED: ADP-ribosylation factor 5               196   5e-61   
ref|NP_001082540.1|  ADP-ribosylation factor 4                          196   5e-61   
ref|XP_010215313.1|  PREDICTED: ADP-ribosylation factor 4               196   5e-61   
ref|XP_004891855.1|  PREDICTED: uncharacterized protein LOC101711...    196   5e-61   
gb|KGK37938.1|  hypothetical protein JL09_g2915                         196   5e-61   
ref|XP_010735419.1|  PREDICTED: ADP-ribosylation factor 1-like 2        196   5e-61   
ref|XP_003868774.1|  Arf2 ADP-ribosylation factor                       196   5e-61   
ref|XP_010611040.1|  PREDICTED: ADP-ribosylation factor 4-like          196   5e-61   
emb|CBJ48963.1|  Arf1, ARF family GTPase                                196   6e-61   
ref|XP_008409530.1|  PREDICTED: ADP-ribosylation factor 4-like          196   6e-61   
ref|XP_008068244.1|  PREDICTED: ADP-ribosylation factor 4               196   6e-61   
ref|XP_003480137.1|  PREDICTED: ADP-ribosylation factor 4               196   6e-61   
ref|XP_003217762.1|  PREDICTED: ADP-ribosylation factor 4               196   6e-61   
emb|CEJ85970.1|  Putative ADP-ribosylation factor                       196   6e-61   
ref|XP_007343507.1|  ARF/SAR                                            196   6e-61   
ref|XP_005734268.1|  PREDICTED: ADP-ribosylation factor 4-like          199   6e-61   
ref|XP_004891854.1|  PREDICTED: uncharacterized protein LOC101711270    196   6e-61   
ref|XP_004368693.1|  PREDICTED: LOW QUALITY PROTEIN: ADP-ribosyla...    196   6e-61   
gb|EMS22909.1|  ADP-ribosylation factor                                 196   6e-61   
gb|EJU06117.1|  ARF/SAR                                                 196   6e-61   
emb|CCI50104.1|  unnamed protein product                                196   6e-61   
ref|XP_007425297.1|  PREDICTED: ADP-ribosylation factor 4               196   6e-61   
gb|KIO32788.1|  hypothetical protein M407DRAFT_95874                    196   6e-61   
ref|XP_005317291.1|  PREDICTED: ADP-ribosylation factor 4               196   6e-61   
ref|XP_008896095.1|  ADP-ribosylation factor                            197   6e-61   
ref|XP_007521246.1|  PREDICTED: ADP-ribosylation factor 4               196   6e-61   
ref|NP_001025648.1|  ADP-ribosylation factor 4                          196   6e-61   
ref|XP_011474902.1|  PREDICTED: ADP-ribosylation factor 4-like          196   7e-61   
gb|ABV22434.1|  ADP-ribosylation factor 1                               196   7e-61   
ref|XP_001690893.1|  small ARF-related GTPase                           196   7e-61   
ref|XP_003982414.1|  PREDICTED: ADP-ribosylation factor 4               196   7e-61   
ref|XP_001511094.1|  PREDICTED: ADP-ribosylation factor 4               196   7e-61   
ref|XP_004676095.1|  PREDICTED: ADP-ribosylation factor 4               196   7e-61   
ref|NP_031505.1|  ADP-ribosylation factor 4                             196   7e-61   
ref|XP_004616543.1|  PREDICTED: ADP-ribosylation factor 4               196   7e-61   
dbj|BAB29041.1|  unnamed protein product                                196   7e-61   
ref|NP_001029702.1|  ADP-ribosylation factor 4                          196   7e-61   
dbj|BAB21999.1|  unnamed protein product                                196   7e-61   
ref|XP_003785602.1|  PREDICTED: ADP-ribosylation factor 4               196   7e-61   
gb|EWC44149.1|  ADP-ribosylation factor 1                               196   7e-61   
dbj|GAD95122.1|  ADP-ribosylation factor, putative                      196   7e-61   
ref|NP_001041537.1|  ADP-ribosylation factor 4                          196   8e-61   
gb|KDQ20587.1|  hypothetical protein BOTBODRAFT_26592                   196   8e-61   
ref|XP_007803162.1|  ADP-ribosylation factor                            196   8e-61   
emb|CAG31674.1|  hypothetical protein RCJMB04_9i5                       196   8e-61   
ref|XP_005977897.1|  PREDICTED: ADP-ribosylation factor 4 isoform X2    196   8e-61   
ref|XP_002713309.1|  PREDICTED: ADP-ribosylation factor 4               196   8e-61   
ref|NP_954969.1|  ADP-ribosylation factor 5                             196   8e-61   
ref|XP_008847504.1|  PREDICTED: ADP-ribosylation factor 4               196   8e-61   
ref|XP_004661366.1|  PREDICTED: ADP-ribosylation factor 4               196   8e-61   
ref|XP_004412427.1|  PREDICTED: ADP-ribosylation factor 4               196   8e-61   
gb|KII94939.1|  hypothetical protein PLICRDRAFT_97075                   196   9e-61   
gb|KIM91090.1|  hypothetical protein PILCRDRAFT_811607                  195   9e-61   
ref|XP_005538032.1|  small GTP-binding protein Arf1                     195   1e-60   
ref|XP_006302886.1|  hypothetical protein CARUB_v10021017mg             195   1e-60   
gb|EFX70245.1|  hypothetical protein DAPPUDRAFT_300544                  195   1e-60   
ref|XP_005997826.1|  PREDICTED: ADP-ribosylation factor 4               195   1e-60   
ref|XP_003070170.1|  ADP-ribosylation factor family protein             195   1e-60   
ref|XP_010792349.1|  PREDICTED: ADP-ribosylation factor 4               195   1e-60   
ref|NP_001003590.1|  uncharacterized protein LOC445196                  195   1e-60   
ref|XP_006633802.1|  PREDICTED: ADP-ribosylation factor 4-like          195   1e-60   
gb|ACM09579.1|  ADP-ribosylation factor 4                               194   1e-60   
gb|KFO27677.1|  ADP-ribosylation factor 2                               196   1e-60   
ref|XP_002839805.1|  hypothetical protein                               195   1e-60   
gb|KDN47361.1|  ARF/SAR                                                 195   1e-60   
ref|XP_636353.1|  ADP-ribosylation factor                               195   1e-60   
gb|ADO28352.1|  ADP-ribosylation factor 4                               192   1e-60   
gb|EWM26802.1|  adp-ribosylation factor                                 195   1e-60   
ref|XP_002011461.1|  GI14031                                            195   1e-60   
emb|CDO71404.1|  hypothetical protein BN946_scf184908.g162              195   1e-60   
ref|XP_006675831.1|  ADP-Ribosylation factor                            195   2e-60   
ref|XP_006631017.1|  PREDICTED: ADP-ribosylation factor 4-like is...    195   2e-60   
ref|XP_001982687.1|  GG16407                                            195   2e-60   
ref|NP_524631.1|  ADP ribosylation factor at 102F, isoform A            195   2e-60   
emb|CDR39163.1|  CYFA0S03e00342g1_1                                     195   2e-60   
gb|KIL70197.1|  hypothetical protein M378DRAFT_96593                    195   2e-60   
ref|XP_003771630.1|  PREDICTED: ADP-ribosylation factor 5               194   2e-60   
ref|XP_006631016.1|  PREDICTED: ADP-ribosylation factor 4-like is...    195   2e-60   
ref|XP_002740964.1|  PREDICTED: ADP-ribosylation factor 1-like is...    194   2e-60   
gb|AIU47295.1|  ADP ribosylation factor 4                               194   2e-60   
ref|XP_007245071.1|  PREDICTED: ADP-ribosylation factor 4-like          194   2e-60   
ref|XP_007935457.1|  PREDICTED: ADP-ribosylation factor 4               194   2e-60   
ref|XP_006862132.1|  PREDICTED: ADP-ribosylation factor 4               194   2e-60   
ref|XP_007302431.1|  ARF/SAR                                            194   2e-60   
ref|XP_007244151.1|  PREDICTED: ADP-ribosylation factor 4-like is...    194   2e-60   
ref|XP_001366170.1|  PREDICTED: ADP-ribosylation factor 5 isoform X1    194   2e-60   
gb|KEZ44483.1|  hypothetical protein SAPIO_CDS3496                      194   2e-60   
gb|ADB92615.1|  ADP ribosylation factor 4                               194   2e-60   
ref|NP_001653.1|  ADP-ribosylation factor 5                             194   2e-60   
ref|XP_001877050.1|  predicted protein                                  194   2e-60   
dbj|BAN20471.1|  ADP-ribosylation factor, arf                           194   2e-60   
ref|XP_004592558.1|  PREDICTED: ADP-ribosylation factor 5               194   2e-60   
ref|XP_001640422.1|  predicted protein                                  194   2e-60   
gb|KIR49173.1|  ADP-ribosylation factor                                 194   2e-60   
gb|EJT48679.1|  ARF small monomeric GTPase                              194   2e-60   
ref|NP_596118.1|  ADP-ribosylation factor, Arf family Arf1              194   2e-60   
ref|XP_572032.1|  ARF small monomeric GTPase                            194   2e-60   
gb|KIY49393.1|  ADP-ribosylation facter                                 194   2e-60   
ref|XP_002286443.1|  adp-ribosylation factor                            194   2e-60   
ref|XP_003036735.1|  ADP-ribosylation facter                            194   2e-60   
gb|ACO12575.1|  ADP-ribosylation factor 4                               194   2e-60   
ref|XP_002174014.1|  ADP-ribosylation factor                            194   2e-60   
gb|EPS25841.1|  hypothetical protein PDE_00777                          194   2e-60   
ref|XP_009035447.1|  ADP-ribosylation factor                            194   2e-60   
gb|AAP36805.1|  Homo sapiens ADP-ribosylation factor 5                  194   2e-60   
ref|XP_011099095.1|  PREDICTED: ADP-ribosylation factor 1-like          194   3e-60   
ref|XP_011276692.1|  ADP-ribosylation factor 1                          194   3e-60   
emb|CCM05575.1|  predicted protein                                      194   3e-60   
ref|XP_003440429.1|  PREDICTED: ADP-ribosylation factor 5-like          194   3e-60   
gb|EXX72896.1|  Arf2p                                                   194   3e-60   
gb|AAP80740.1|  ADP-ribosylation factor 1                               194   3e-60   
ref|XP_002099641.1|  Arf102F                                            194   3e-60   
ref|XP_006789524.1|  PREDICTED: ADP-ribosylation factor 5-like          194   3e-60   
ref|XP_009104952.1|  PREDICTED: ADP-ribosylation factor 2-B-like        194   3e-60   
ref|XP_003307076.1|  ADP-ribosylation factor                            194   3e-60   
gb|KIR88675.1|  ADP-ribosylation factor                                 194   3e-60   
gb|EDL34206.1|  ADP-ribosylation factor 2, isoform CRA_b                192   3e-60   
ref|XP_007413478.1|  hypothetical protein MELLADRAFT_117357             194   3e-60   
ref|XP_002948332.1|  small Arf-related GTPase                           194   3e-60   
gb|ELK07801.1|  ADP-ribosylation factor 4                               197   3e-60   



>ref|XP_008811520.1| PREDICTED: ADP-ribosylation factor 1-like [Phoenix dactylifera]
 ref|XP_008811521.1| PREDICTED: ADP-ribosylation factor 1-like [Phoenix dactylifera]
Length=116

 Score =   209 bits (532),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>gb|KJB15575.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
Length=134

 Score =   210 bits (534),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006386699.1| hypothetical protein POPTR_0002s19210g [Populus trichocarpa]
 gb|ERP64496.1| hypothetical protein POPTR_0002s19210g [Populus trichocarpa]
 gb|KDO86879.1| hypothetical protein CISIN_1g030191mg [Citrus sinensis]
 gb|KJB41775.1| hypothetical protein B456_007G120600 [Gossypium raimondii]
Length=153

 Score =   210 bits (535),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|EAY92309.1| hypothetical protein OsI_14032 [Oryza sativa Indica Group]
Length=354

 Score =   217 bits (553),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KJB11520.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
Length=183

 Score =   211 bits (538),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_007151018.1| hypothetical protein PHAVU_004G011900g [Phaseolus vulgaris]
 gb|AGZ15424.1| ADP-ribosylation factor 1 [Phaseolus vulgaris]
 gb|ESW23012.1| hypothetical protein PHAVU_004G011900g [Phaseolus vulgaris]
Length=181

 Score =   211 bits (537),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KHN00225.1| ADP-ribosylation factor 2 [Glycine soja]
Length=184

 Score =   211 bits (537),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_009612443.1| PREDICTED: ADP-ribosylation factor [Nicotiana tomentosiformis]
Length=181

 Score =   211 bits (537),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_001280835.1| ADP-ribosylation factor [Malus domestica]
 gb|AEX97079.1| ADP-ribosylation factor [Malus domestica]
Length=188

 Score =   211 bits (537),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AAT08648.1| ADP-ribosylation factor [Hyacinthus orientalis]
Length=199

 Score =   211 bits (538),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  19   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  78

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  79   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  120



>ref|XP_002521452.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gb|EEF40942.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
Length=181

 Score =   211 bits (537),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_002318934.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
 gb|EEE94857.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
Length=182

 Score =   211 bits (537),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_002318935.1| hypothetical protein POPTR_0013s00700g [Populus trichocarpa]
 ref|XP_003553934.1| PREDICTED: ADP-ribosylation factor isoform 3 [Glycine max]
 ref|XP_006382311.1| hypothetical protein POPTR_0005s00910g [Populus trichocarpa]
 ref|XP_006375716.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
 ref|XP_006375717.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_009757514.1| PREDICTED: ADP-ribosylation factor [Nicotiana sylvestris]
 ref|XP_010550140.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010550141.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010554051.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010554052.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010554053.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010672580.1| PREDICTED: ADP-ribosylation factor [Beta vulgaris subsp. vulgaris]
 ref|XP_011023829.1| PREDICTED: ADP-ribosylation factor isoform X1 [Populus euphratica]
 ref|XP_011023830.1| PREDICTED: ADP-ribosylation factor isoform X2 [Populus euphratica]
 ref|XP_011023831.1| PREDICTED: ADP-ribosylation factor isoform X3 [Populus euphratica]
 ref|XP_011023832.1| PREDICTED: ADP-ribosylation factor isoform X4 [Populus euphratica]
 ref|XP_011038984.1| PREDICTED: ADP-ribosylation factor [Populus euphratica]
 gb|ABK93177.1| unknown [Populus trichocarpa]
 gb|ABK93657.1| unknown [Populus trichocarpa]
 gb|ABK95673.1| unknown [Populus trichocarpa]
 gb|EEE94858.1| hypothetical protein POPTR_0013s00700g [Populus trichocarpa]
 gb|ERP53513.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
 gb|ERP53514.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ERP60108.1| hypothetical protein POPTR_0005s00910g [Populus trichocarpa]
 gb|KHN23524.1| ADP-ribosylation factor [Glycine soja]
 gb|KHN27442.1| ADP-ribosylation factor [Glycine soja]
 gb|KJB11517.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
 gb|KJB11519.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
 gb|KJB11521.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
Length=181

 Score =   211 bits (536),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_001274832.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum]
 gb|ABB16972.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum]
 gb|ABB16982.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum]
 gb|ABB87122.1| ADP-ribosylation factor 1-like [Solanum tuberosum]
Length=181

 Score =   211 bits (536),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>sp|O48920.3|ARF_VIGUN RecName: Full=ADP-ribosylation factor [Vigna unguiculata]
 gb|AAB91395.1| ADP-ribosylation factor [Vigna unguiculata]
Length=181

 Score =   211 bits (536),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KHG04267.1| ADP-ribosylation factor [Gossypium arboreum]
Length=237

 Score =   213 bits (541),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KJB24452.1| hypothetical protein B456_004G146100 [Gossypium raimondii]
Length=184

 Score =   211 bits (537),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_002457613.1| hypothetical protein SORBIDRAFT_03g010350 [Sorghum bicolor]
 gb|EES02733.1| hypothetical protein SORBIDRAFT_03g010350 [Sorghum bicolor]
Length=181

 Score =   211 bits (536),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>sp|P51822.2|ARF1_DAUCA RecName: Full=ADP-ribosylation factor 1 [Daucus carota]
 dbj|BAA08259.1| ADP-ribosylation factor [Daucus carota]
Length=181

 Score =   211 bits (536),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_004288363.1| PREDICTED: ADP-ribosylation factor 2-like [Fragaria vesca subsp. 
vesca]
 ref|XP_007221509.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
 ref|XP_007221510.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
 ref|XP_008227807.1| PREDICTED: ADP-ribosylation factor 2 [Prunus mume]
 ref|XP_008381455.1| PREDICTED: ADP-ribosylation factor 2-like [Malus domestica]
 ref|XP_009363094.1| PREDICTED: ADP-ribosylation factor 2-like [Pyrus x bretschneideri]
 ref|XP_009367177.1| PREDICTED: ADP-ribosylation factor 2-like [Pyrus x bretschneideri]
 ref|XP_009376185.1| PREDICTED: ADP-ribosylation factor 2-like [Pyrus x bretschneideri]
 gb|EMJ22708.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
 gb|EMJ22709.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
Length=181

 Score =   211 bits (536),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_003536036.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Glycine max]
 ref|XP_006589106.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Glycine max]
 ref|XP_006589107.1| PREDICTED: ADP-ribosylation factor-like isoform X3 [Glycine max]
 ref|XP_006589108.1| PREDICTED: ADP-ribosylation factor-like isoform X4 [Glycine max]
Length=181

 Score =   211 bits (536),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|ACJ84691.1| unknown [Medicago truncatula]
 gb|AFK35530.1| unknown [Medicago truncatula]
 gb|AES82227.2| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
Length=181

 Score =   211 bits (536),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_002302788.1| hypothetical protein POPTR_0002s19210g [Populus trichocarpa]
 ref|XP_002320274.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_002264654.1| PREDICTED: ADP-ribosylation factor [Vitis vinifera]
 ref|XP_002281047.1| PREDICTED: ADP-ribosylation factor isoform X2 [Vitis vinifera]
 ref|XP_002515227.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 ref|XP_002515230.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 ref|XP_003518676.1| PREDICTED: ADP-ribosylation factor 2-like [Glycine max]
 ref|XP_003535875.1| PREDICTED: ADP-ribosylation factor 2-like [Glycine max]
 ref|XP_003555789.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Glycine 
max]
 ref|XP_003555790.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Glycine 
max]
 ref|XP_003591352.1| ADP ribosylation factor [Medicago truncatula]
 ref|XP_003632415.1| PREDICTED: ADP-ribosylation factor [Vitis vinifera]
 ref|XP_004135977.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis sativus]
 ref|XP_004169278.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis sativus]
 ref|XP_004302301.1| PREDICTED: ADP-ribosylation factor-like [Fragaria vesca subsp. 
vesca]
 ref|XP_004495884.1| PREDICTED: ADP-ribosylation factor 2-like [Cicer arietinum]
 ref|XP_006386700.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_006382312.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_006375425.1| hypothetical protein POPTR_0014s11180g [Populus trichocarpa]
 ref|XP_006428233.1| hypothetical protein CICLE_v10012898mg [Citrus clementina]
 ref|XP_006444563.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 ref|XP_006444564.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 ref|XP_006444565.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 ref|XP_006480701.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006492378.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492379.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_007051216.1| ADP-ribosylation factor A1F [Theobroma cacao]
 ref|XP_007145024.1| hypothetical protein PHAVU_007G203600g [Phaseolus vulgaris]
 ref|XP_007145120.1| hypothetical protein PHAVU_007G211700g [Phaseolus vulgaris]
 ref|XP_007163209.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 ref|XP_007163210.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 ref|XP_007205795.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
 ref|XP_008246262.1| PREDICTED: ADP-ribosylation factor-like [Prunus mume]
 ref|XP_008353867.1| PREDICTED: ADP-ribosylation factor [Malus domestica]
 ref|XP_008362551.1| PREDICTED: ADP-ribosylation factor [Malus domestica]
 ref|XP_008461403.1| PREDICTED: ADP-ribosylation factor-like [Cucumis melo]
 ref|XP_008461404.1| PREDICTED: ADP-ribosylation factor-like [Cucumis melo]
 ref|XP_010042229.1| PREDICTED: ADP-ribosylation factor-like [Eucalyptus grandis]
 ref|XP_010270872.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270873.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270874.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270875.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270882.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270883.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270884.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010276502.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010276503.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_011040695.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
 ref|XP_011038982.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
 ref|XP_011038983.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
 ref|XP_011003176.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011003177.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011079513.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 ref|XP_011079514.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 ref|XP_011092180.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 ref|XP_011092181.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 gb|ABB03801.1| ADP ribosylation factor 002 [Daucus carota]
 gb|ABK93146.1| unknown [Populus trichocarpa]
 gb|ABK93165.1| unknown [Populus trichocarpa]
 gb|ACJ84391.1| unknown [Medicago truncatula]
 gb|EEE82061.1| hypothetical protein POPTR_0002s19210g [Populus trichocarpa]
 gb|EEE98589.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|EEF47211.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gb|EEF47214.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gb|AEA92306.1| Arf2 [Hevea brasiliensis]
 gb|AES61603.1| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|AFK34270.1| unknown [Medicago truncatula]
 gb|AFS50009.1| hypothetical protein [Dendrobium catenatum]
 gb|EMJ06994.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
 gb|EOX95373.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|ERP53222.1| hypothetical protein POPTR_0014s11180g [Populus trichocarpa]
 gb|ERP60109.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ERP64497.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ESR41473.1| hypothetical protein CICLE_v10012898mg [Citrus clementina]
 gb|ESR57803.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 gb|ESR57804.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 gb|ESR57805.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 gb|ESW17018.1| hypothetical protein PHAVU_007G203600g [Phaseolus vulgaris]
 gb|ESW17114.1| hypothetical protein PHAVU_007G211700g [Phaseolus vulgaris]
 gb|ESW35203.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 gb|ESW35204.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 gb|KDO86877.1| hypothetical protein CISIN_1g030191mg [Citrus sinensis]
 gb|KDO86878.1| hypothetical protein CISIN_1g030191mg [Citrus sinensis]
 gb|KGN45043.1| hypothetical protein Csa_7G414405 [Cucumis sativus]
 gb|KHG07003.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KHG09762.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KHG21203.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KHN00327.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN02820.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KJB22479.1| hypothetical protein B456_004G049700 [Gossypium raimondii]
 gb|KJB24450.1| hypothetical protein B456_004G146100 [Gossypium raimondii]
 gb|KJB24451.1| hypothetical protein B456_004G146100 [Gossypium raimondii]
 gb|KJB41774.1| hypothetical protein B456_007G120600 [Gossypium raimondii]
 gb|KJB49771.1| hypothetical protein B456_008G137100 [Gossypium raimondii]
 gb|KJB49772.1| hypothetical protein B456_008G137100 [Gossypium raimondii]
 gb|KJB49773.1| hypothetical protein B456_008G137100 [Gossypium raimondii]
Length=181

 Score =   211 bits (536),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_011040674.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011040681.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011040689.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
Length=189

 Score =   211 bits (537),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_004252939.1| PREDICTED: ADP-ribosylation factor 2 [Solanum lycopersicum]
Length=181

 Score =   211 bits (536),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|ABD73294.1| ADP-ribosylation factor-like protein [Panax ginseng]
Length=181

 Score =   211 bits (536),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|EPS65320.1| hypothetical protein M569_09462, partial [Genlisea aurea]
Length=113

 Score =   208 bits (529),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KDP28302.1| hypothetical protein JCGZ_14073 [Jatropha curcas]
Length=181

 Score =   210 bits (535),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|EYU46850.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
Length=153

 Score =   209 bits (533),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010092942.1| ADP-ribosylation factor 2 [Morus notabilis]
 gb|EXB52995.1| ADP-ribosylation factor 2 [Morus notabilis]
Length=188

 Score =   211 bits (536),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>ref|XP_011003178.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
Length=181

 Score =   210 bits (535),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KJB11518.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
Length=205

 Score =   211 bits (537),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  25   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  84

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  85   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  126



>ref|XP_010524305.1| PREDICTED: ADP-ribosylation factor-like [Tarenaya hassleriana]
Length=181

 Score =   210 bits (535),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>ref|XP_006480700.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Citrus 
sinensis]
Length=183

 Score =   210 bits (535),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_004494449.1| PREDICTED: ADP-ribosylation factor 2-like [Cicer arietinum]
 ref|XP_011092183.1| PREDICTED: ADP-ribosylation factor-like [Sesamum indicum]
Length=181

 Score =   210 bits (535),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_003626009.1| ADP-ribosylation factor-like protein [Medicago truncatula]
Length=206

 Score =   211 bits (537),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006840725.1| hypothetical protein AMTR_s00096p00110370 [Amborella trichopoda]
 gb|ERN02400.1| hypothetical protein AMTR_s00096p00110370 [Amborella trichopoda]
Length=188

 Score =   210 bits (535),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>ref|XP_011038977.1| PREDICTED: ADP-ribosylation factor-like [Populus euphratica]
 ref|XP_011038978.1| PREDICTED: ADP-ribosylation factor-like [Populus euphratica]
 ref|XP_011038980.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011038981.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
Length=183

 Score =   210 bits (535),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KDO66124.1| hypothetical protein CISIN_1g029675mg [Citrus sinensis]
Length=189

 Score =   210 bits (535),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>emb|CBI25984.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  31   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  90

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  91   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  132



>gb|KDO72117.1| hypothetical protein CISIN_1g030193mg [Citrus sinensis]
Length=153

 Score =   209 bits (532),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|EPS68301.1| hypothetical protein M569_06468, partial [Genlisea aurea]
Length=180

 Score =   210 bits (534),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV+E
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVIE  102



>gb|ADB85106.1| ADP ribosylation factor 002 [Jatropha curcas]
Length=181

 Score =   210 bits (534),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_008777957.1| PREDICTED: ADP-ribosylation factor [Phoenix dactylifera]
 ref|XP_008777958.1| PREDICTED: ADP-ribosylation factor [Phoenix dactylifera]
 ref|XP_010914673.1| PREDICTED: ADP-ribosylation factor-like [Elaeis guineensis]
 ref|XP_010914674.1| PREDICTED: ADP-ribosylation factor-like [Elaeis guineensis]
 gb|ACL67836.1| ADP ribosylation factor [Jatropha curcas]
 gb|KDP23360.1| hypothetical protein JCGZ_23193 [Jatropha curcas]
Length=181

 Score =   210 bits (534),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>gb|KJB82424.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82425.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
Length=142

 Score =   209 bits (531),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|ACU16903.1| unknown [Glycine max]
Length=204

 Score =   211 bits (536),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010659724.1| PREDICTED: ADP-ribosylation factor isoform X1 [Vitis vinifera]
Length=183

 Score =   210 bits (534),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010660901.1| PREDICTED: ADP-ribosylation factor isoform X1 [Vitis vinifera]
 ref|XP_010660902.1| PREDICTED: ADP-ribosylation factor isoform X1 [Vitis vinifera]
Length=183

 Score =   210 bits (534),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KHG02135.1| ADP-ribosylation factor [Gossypium arboreum]
Length=209

 Score =   211 bits (536),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AFW67226.1| hypothetical protein ZEAMMB73_332083 [Zea mays]
Length=241

 Score =   212 bits (539),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  53   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  112

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  113  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  154



>emb|CAN71086.1| hypothetical protein VITISV_006303 [Vitis vinifera]
Length=146

 Score =   209 bits (531),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AFW67223.1| hypothetical protein ZEAMMB73_332083 [Zea mays]
Length=183

 Score =   210 bits (534),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KJB75878.1| hypothetical protein B456_012G062700 [Gossypium raimondii]
Length=191

 Score =   210 bits (535),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010674549.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=181

 Score =   210 bits (534),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVE  102



>ref|XP_010094415.1| ADP-ribosylation factor 2 [Morus notabilis]
 gb|EXB55996.1| ADP-ribosylation factor 2 [Morus notabilis]
Length=203

 Score =   211 bits (536),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KCW56007.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
Length=179

 Score =   209 bits (533),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_004304633.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=184

 Score =   210 bits (534),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_004981305.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Setaria italica]
Length=213

 Score =   211 bits (536),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_002466220.1| hypothetical protein SORBIDRAFT_01g003770 [Sorghum bicolor]
 ref|XP_010227861.1| PREDICTED: ADP-ribosylation factor [Brachypodium distachyon]
 gb|EER93218.1| hypothetical protein SORBIDRAFT_01g003770 [Sorghum bicolor]
Length=181

 Score =   209 bits (533),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_001051676.1| Os03g0811900 [Oryza sativa Japonica Group]
 ref|XP_006650781.1| PREDICTED: ADP-ribosylation factor 1-like [Oryza brachyantha]
 gb|AAP73857.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 gb|ABF99500.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99501.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99504.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13590.1| Os03g0811900 [Oryza sativa Japonica Group]
 emb|CCI55417.1| PH01B015M02.18 [Phyllostachys edulis]
Length=181

 Score =   209 bits (533),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010941504.1| PREDICTED: ADP-ribosylation factor [Elaeis guineensis]
Length=181

 Score =   209 bits (533),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFV+DSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRIVE  102



>ref|XP_009389142.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389143.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389144.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389145.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 gb|KJB75876.1| hypothetical protein B456_012G062700 [Gossypium raimondii]
 gb|KJB75877.1| hypothetical protein B456_012G062700 [Gossypium raimondii]
Length=181

 Score =   209 bits (533),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_007031496.1| ADP-ribosylation factor A1F [Theobroma cacao]
 ref|XP_007215053.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 ref|XP_007215054.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 ref|XP_008379235.1| PREDICTED: ADP-ribosylation factor [Malus domestica]
 gb|EMJ16252.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 gb|EMJ16253.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 gb|EOY02422.1| ADP-ribosylation factor A1F [Theobroma cacao]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|ACF80896.1| unknown [Zea mays]
 gb|AFW67225.1| ADP-ribosylation factor [Zea mays]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_001105897.1| ADP-ribosylation factor [Zea mays]
 sp|P49076.2|ARF_MAIZE RecName: Full=ADP-ribosylation factor [Zea mays]
 emb|CAA56351.1| ADP-ribosylation factor [Zea mays]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_002277054.2| PREDICTED: ADP-ribosylation factor isoform X2 [Vitis vinifera]
 ref|XP_010660903.1| PREDICTED: ADP-ribosylation factor isoform X2 [Vitis vinifera]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_003618209.1| ADP-ribosylation factor [Medicago truncatula]
 ref|XP_004142795.1| PREDICTED: ADP-ribosylation factor 1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004142796.1| PREDICTED: ADP-ribosylation factor 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156684.1| PREDICTED: ADP-ribosylation factor 1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156685.1| PREDICTED: ADP-ribosylation factor 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004304634.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Fragaria vesca 
subsp. vesca]
 ref|XP_004489257.1| PREDICTED: ADP-ribosylation factor 1-like [Cicer arietinum]
 ref|XP_006470306.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470307.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Citrus 
sinensis]
 ref|XP_008230584.1| PREDICTED: ADP-ribosylation factor 1 [Prunus mume]
 ref|XP_008341441.1| PREDICTED: ADP-ribosylation factor 1 [Malus domestica]
 ref|XP_008341442.1| PREDICTED: ADP-ribosylation factor 1 [Malus domestica]
 ref|XP_008458781.1| PREDICTED: ADP-ribosylation factor 1 [Cucumis melo]
 ref|XP_009334096.1| PREDICTED: ADP-ribosylation factor 1 [Pyrus x bretschneideri]
 ref|XP_009334097.1| PREDICTED: ADP-ribosylation factor 1 [Pyrus x bretschneideri]
 ref|XP_010029154.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010029155.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010029156.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010033289.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010033290.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 gb|AAR29293.1| ADP-ribosylation factor [Medicago sativa]
 emb|CAI29265.1| ADP-ribosylation factor 1 [Medicago truncatula]
 gb|AES74427.1| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|AEV66152.1| ADP-ribosylation factor [Arachis hypogaea]
 gb|AFK42113.1| unknown [Medicago truncatula]
 gb|AFK44737.1| unknown [Lotus japonicus]
 gb|KCW56003.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KCW56004.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KCW56005.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KCW56006.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KDO66122.1| hypothetical protein CISIN_1g029675mg [Citrus sinensis]
 gb|KDO66123.1| hypothetical protein CISIN_1g029675mg [Citrus sinensis]
 gb|KGN59678.1| hypothetical protein Csa_3G837590 [Cucumis sativus]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|EYU46846.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
 gb|EYU46847.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
 gb|EYU46848.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
 gb|EYU46849.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|ADP00406.1| ADP-ribosylation factor [Actinidia chinensis]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AEX49947.1| ADP-ribosylation factor 1 [Haloxylon ammodendron]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVE  102



>gb|AFW67224.1| hypothetical protein ZEAMMB73_332083 [Zea mays]
Length=206

 Score =   210 bits (535),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_001275425.1| ADP-ribosylation factor 2-like [Solanum tuberosum]
 gb|ABA40446.1| unknown [Solanum tuberosum]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010679455.1| PREDICTED: ADP-ribosylation factor 2-B-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679456.1| PREDICTED: ADP-ribosylation factor 2-B-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679457.1| PREDICTED: ADP-ribosylation factor 2-B-like [Beta vulgaris subsp. 
vulgaris]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_007224194.1| hypothetical protein PRUPE_ppa017304mg [Prunus persica]
 gb|EMJ25393.1| hypothetical protein PRUPE_ppa017304mg [Prunus persica]
Length=182

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDA+GKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDASGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFV+DSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRVVE  102



>ref|XP_010248146.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_002265983.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Vitis vinifera]
 ref|XP_002265874.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Vitis vinifera]
 ref|XP_004297476.1| PREDICTED: ADP-ribosylation factor 2 [Fragaria vesca subsp. vesca]
 ref|XP_007157443.1| hypothetical protein PHAVU_002G070500g [Phaseolus vulgaris]
 ref|XP_010682536.1| PREDICTED: ADP-ribosylation factor 2 [Beta vulgaris subsp. vulgaris]
 gb|ESW29437.1| hypothetical protein PHAVU_002G070500g [Phaseolus vulgaris]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006488769.1| PREDICTED: ADP-ribosylation factor-like [Citrus sinensis]
 gb|KDO72116.1| hypothetical protein CISIN_1g030193mg [Citrus sinensis]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_007205794.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
 gb|EMJ06993.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
Length=243

 Score =   211 bits (538),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/107 (96%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +3

Query  18   SSV*NMGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVET  197
            S +  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVET
Sbjct  58   SKLFKMGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVET  117

Query  198  VEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            VEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  118  VEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  164



>gb|ACM67553.1| ADP-ribosylation factor-like protein [Musa acuminata AAA Group]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KCW56002.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
Length=190

 Score =   210 bits (534),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_008389662.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Malus domestica]
 ref|XP_008340050.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Malus domestica]
Length=182

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AFK39359.1| unknown [Medicago truncatula]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010108788.1| ADP-ribosylation factor [Morus notabilis]
 gb|EXC20303.1| ADP-ribosylation factor [Morus notabilis]
Length=185

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>gb|KHG04030.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KJB15573.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
 gb|KJB15574.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
 gb|KJB15577.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_002871626.1| ADP-ribosylation factor A1B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47885.1| ADP-ribosylation factor A1B [Arabidopsis lyrata subsp. lyrata]
Length=183

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KDP46432.1| hypothetical protein JCGZ_10272 [Jatropha curcas]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_172533.2| ADP-ribosylation factor A1F [Arabidopsis thaliana]
 ref|XP_010475938.1| PREDICTED: ADP-ribosylation factor 1-like [Camelina sativa]
 gb|AAT41759.1| At1g10630 [Arabidopsis thaliana]
 gb|AAT70455.1| At1g10630 [Arabidopsis thaliana]
 dbj|BAE98462.1| similar to ADP-ribosylation factor gb|AAD17207 [Arabidopsis thaliana]
 gb|AEE28611.1| ADP-ribosylation factor A1F [Arabidopsis thaliana]
Length=181

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006305639.1| hypothetical protein CARUB_v10010344mg, partial [Capsella rubella]
 gb|EOA38537.1| hypothetical protein CARUB_v10010344mg, partial [Capsella rubella]
Length=168

 Score =   209 bits (531),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  17   MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  76

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VE
Sbjct  77   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVE  118



>ref|XP_010319588.1| PREDICTED: ADP-ribosylation factor [Solanum lycopersicum]
Length=185

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MG+SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGMSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006399980.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
 ref|XP_006399981.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
 ref|XP_010420114.1| PREDICTED: ADP-ribosylation factor [Camelina sativa]
 ref|XP_010420115.1| PREDICTED: ADP-ribosylation factor [Camelina sativa]
 ref|XP_010453596.1| PREDICTED: ADP-ribosylation factor [Camelina sativa]
 ref|XP_010492281.1| PREDICTED: ADP-ribosylation factor isoform X2 [Camelina sativa]
 gb|ESQ41433.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
 gb|ESQ41434.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
Length=181

 Score =   209 bits (532),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AAF17671.1|AC009398_20 F20B24.7 [Arabidopsis thaliana]
Length=186

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010651474.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Vitis vinifera]
Length=181

 Score =   209 bits (532),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|EYU19417.1| hypothetical protein MIMGU_mgv1a014679mg [Erythranthe guttata]
Length=181

 Score =   209 bits (532),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_009776781.1| PREDICTED: ADP-ribosylation factor-like [Nicotiana sylvestris]
 ref|XP_009776782.1| PREDICTED: ADP-ribosylation factor-like [Nicotiana sylvestris]
Length=181

 Score =   209 bits (532),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQG+IFVVDSNDRDRV+E
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRDRVIE  102



>ref|NP_001236384.1| uncharacterized protein LOC100306021 [Glycine max]
 ref|XP_003517709.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Glycine 
max]
 ref|XP_003519837.1| PREDICTED: ADP-ribosylation factor 2-like isoformX1 [Glycine 
max]
 ref|XP_003557055.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Glycine 
max]
 ref|XP_004135254.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004165817.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004238652.1| PREDICTED: ADP-ribosylation factor 2 [Solanum lycopersicum]
 ref|XP_006356427.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006574623.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Glycine 
max]
 ref|XP_007044675.1| ADP-ribosylation factor A1F [Theobroma cacao]
 ref|XP_007153744.1| hypothetical protein PHAVU_003G061400g [Phaseolus vulgaris]
 ref|XP_007223549.1| hypothetical protein PRUPE_ppa012160mg [Prunus persica]
 ref|XP_008221835.1| PREDICTED: ADP-ribosylation factor 2 [Prunus mume]
 ref|XP_008389663.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Malus domestica]
 ref|XP_008340051.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Malus domestica]
 ref|XP_008446200.1| PREDICTED: ADP-ribosylation factor 2 [Cucumis melo]
 ref|XP_008776867.1| PREDICTED: ADP-ribosylation factor 2 [Phoenix dactylifera]
 ref|XP_008776868.1| PREDICTED: ADP-ribosylation factor 2 [Phoenix dactylifera]
 ref|XP_009622926.1| PREDICTED: ADP-ribosylation factor 2 [Nicotiana tomentosiformis]
 ref|XP_009629759.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009759206.1| PREDICTED: ADP-ribosylation factor 2 [Nicotiana sylvestris]
 ref|XP_009758092.1| PREDICTED: ADP-ribosylation factor 2 [Nicotiana sylvestris]
 ref|XP_010029157.1| PREDICTED: ADP-ribosylation factor 2 [Eucalyptus grandis]
 ref|XP_010552645.1| PREDICTED: ADP-ribosylation factor 2 [Tarenaya hassleriana]
 ref|XP_010904967.1| PREDICTED: ADP-ribosylation factor 2 [Elaeis guineensis]
 ref|XP_011071092.1| PREDICTED: ADP-ribosylation factor 2 [Sesamum indicum]
 ref|XP_011071093.1| PREDICTED: ADP-ribosylation factor 2 [Sesamum indicum]
 ref|XP_011086584.1| PREDICTED: ADP-ribosylation factor 2 [Sesamum indicum]
 gb|ACJ85464.1| unknown [Medicago truncatula]
 gb|ACN39752.1| unknown [Picea sitchensis]
 gb|ACN39787.1| unknown [Picea sitchensis]
 gb|ACN41130.1| unknown [Picea sitchensis]
 gb|ACU13997.1| unknown [Glycine max]
 gb|ACU23220.1| unknown [Glycine max]
 gb|AFK34829.1| unknown [Medicago truncatula]
 gb|AFK43802.1| unknown [Lotus japonicus]
 gb|AFK44369.1| unknown [Lotus japonicus]
 gb|AFK46588.1| unknown [Medicago truncatula]
 gb|EMJ24748.1| hypothetical protein PRUPE_ppa012160mg [Prunus persica]
 gb|EOY00507.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|ESW25738.1| hypothetical protein PHAVU_003G061400g [Phaseolus vulgaris]
 gb|EYU22499.1| hypothetical protein MIMGU_mgv1a014705mg [Erythranthe guttata]
 gb|EYU22500.1| hypothetical protein MIMGU_mgv1a014705mg [Erythranthe guttata]
 gb|EYU28446.1| hypothetical protein MIMGU_mgv1a014709mg [Erythranthe guttata]
 gb|KCW56009.1| hypothetical protein EUGRSUZ_I01780 [Eucalyptus grandis]
 gb|KCW56010.1| hypothetical protein EUGRSUZ_I01780 [Eucalyptus grandis]
 gb|KCW56011.1| hypothetical protein EUGRSUZ_I01780 [Eucalyptus grandis]
 gb|KEH27753.1| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|AES96177.2| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|KGN51799.1| hypothetical protein Csa_5G601490 [Cucumis sativus]
 gb|KHN00363.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN12112.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN25534.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN26886.1| ADP-ribosylation factor 2 [Glycine soja]
Length=181

 Score =   209 bits (532),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KGN51378.1| hypothetical protein Csa_5G524710 [Cucumis sativus]
Length=191

 Score =   209 bits (533),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006390885.1| hypothetical protein EUTSA_v10019096mg [Eutrema salsugineum]
 gb|ESQ28171.1| hypothetical protein EUTSA_v10019096mg [Eutrema salsugineum]
Length=226

 Score =   211 bits (536),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/110 (95%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  9    RSVSSV*NMGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFN  188
            R  SS   MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFN
Sbjct  38   RVFSSESKMGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFN  97

Query  189  VETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            VETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  98   VETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  147



>gb|EYU38402.1| hypothetical protein MIMGU_mgv1a014684mg [Erythranthe guttata]
Length=181

 Score =   209 bits (532),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF+KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFSKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KCW56001.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
Length=183

 Score =   209 bits (532),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010674548.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score =   209 bits (532),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVE  102



>ref|XP_009416365.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416366.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416367.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416368.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416369.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416370.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
Length=181

 Score =   209 bits (532),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>ref|XP_009403841.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   209 bits (532),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>emb|CDP13175.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   210 bits (535),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010492280.1| PREDICTED: ADP-ribosylation factor isoform X1 [Camelina sativa]
Length=183

 Score =   209 bits (532),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006361664.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006361665.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006361666.1| PREDICTED: ADP-ribosylation factor 2-like isoform X3 [Solanum 
tuberosum]
 ref|XP_009604530.1| PREDICTED: ADP-ribosylation factor 2-like [Nicotiana tomentosiformis]
 ref|XP_009604531.1| PREDICTED: ADP-ribosylation factor 2-like [Nicotiana tomentosiformis]
 ref|XP_009762302.1| PREDICTED: ADP-ribosylation factor 2-like [Nicotiana sylvestris]
Length=181

 Score =   209 bits (532),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010922925.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Elaeis guineensis]
Length=152

 Score =   208 bits (529),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>ref|XP_009375124.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
 ref|XP_009375125.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
 ref|XP_009377201.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
 ref|XP_009377202.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
Length=181

 Score =   209 bits (532),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_009121644.1| PREDICTED: ADP-ribosylation factor 2 [Brassica rapa]
 ref|XP_009121645.1| PREDICTED: ADP-ribosylation factor 2 [Brassica rapa]
Length=181

 Score =   209 bits (532),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_002892585.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 ref|XP_007031214.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|EFH68844.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gb|EOY11716.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|KHG17086.1| ARF2-B: ADP-ribosylation factor 2-B [Gossypium arboreum]
 gb|KHG18341.1| ADP-ribosylation factor 2-B -like protein [Gossypium arboreum]
 gb|KJB81134.1| hypothetical protein B456_013G131000 [Gossypium raimondii]
 gb|KJB81135.1| hypothetical protein B456_013G131000 [Gossypium raimondii]
Length=181

 Score =   209 bits (532),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006417443.1| hypothetical protein EUTSA_v10008885mg [Eutrema salsugineum]
 ref|XP_010547797.1| PREDICTED: ADP-ribosylation factor 2-B-like [Tarenaya hassleriana]
 ref|XP_010547805.1| PREDICTED: ADP-ribosylation factor 2-B-like [Tarenaya hassleriana]
 ref|XP_010533952.1| PREDICTED: ADP-ribosylation factor 2-B-like [Tarenaya hassleriana]
 gb|ESQ35796.1| hypothetical protein EUTSA_v10008885mg [Eutrema salsugineum]
Length=181

 Score =   209 bits (532),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006356426.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Solanum 
tuberosum]
Length=184

 Score =   209 bits (532),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KJB82421.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
Length=204

 Score =   210 bits (534),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010943658.1| PREDICTED: ADP-ribosylation factor 2-like [Elaeis guineensis]
Length=181

 Score =   209 bits (532),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>dbj|BAB90396.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
Length=376

 Score =   215 bits (548),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  179  MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  238

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  239  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  280



>ref|XP_004135253.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004165816.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Cucumis 
sativus]
Length=189

 Score =   209 bits (532),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AAR18698.1| ADP-ribosylation factor 1 [Populus tomentosa]
Length=195

 Score =   209 bits (533),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006288755.1| hypothetical protein CARUB_v10002073mg [Capsella rubella]
 gb|EOA21653.1| hypothetical protein CARUB_v10002073mg [Capsella rubella]
Length=181

 Score =   209 bits (532),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KJB31031.1| hypothetical protein B456_005G181600, partial [Gossypium raimondii]
Length=180

 Score =   209 bits (531),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|ACJ84889.1| unknown [Medicago truncatula]
Length=167

 Score =   208 bits (530),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAG+TTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGRTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_002888782.1| hypothetical protein ARALYDRAFT_476172 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_009127797.1| PREDICTED: ADP-ribosylation factor 2-B isoform X1 [Brassica rapa]
 ref|XP_009127798.1| PREDICTED: ADP-ribosylation factor 2-B isoform X1 [Brassica rapa]
 gb|EFH65041.1| hypothetical protein ARALYDRAFT_476172 [Arabidopsis lyrata subsp. 
lyrata]
Length=182

 Score =   209 bits (532),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|EAZ29027.1| hypothetical protein OsJ_13076 [Oryza sativa Japonica Group]
Length=184

 Score =   209 bits (532),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_177206.1| ARF GTPase family protein [Arabidopsis thaliana]
 ref|NP_564195.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 ref|NP_850975.1| ARF GTPase family protein [Arabidopsis thaliana]
 ref|NP_974120.1| ARF GTPase family protein [Arabidopsis thaliana]
 ref|XP_002890586.1| hypothetical protein ARALYDRAFT_472612 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_009127800.1| PREDICTED: ADP-ribosylation factor 2-B isoform X2 [Brassica rapa]
 ref|XP_009127801.1| PREDICTED: ADP-ribosylation factor 2-B isoform X2 [Brassica rapa]
 ref|XP_009103171.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
 ref|XP_009103173.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
 ref|XP_010498859.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010415728.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010415729.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010427826.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010427827.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010460136.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010471043.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010471044.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010477643.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 sp|P0DH91.1|ARF2B_ARATH RecName: Full=ADP-ribosylation factor 2-B; Short=AtARF2; AltName: 
Full=ARF1-like protein U5 [Arabidopsis thaliana]
 sp|Q9LQC8.2|ARF2A_ARATH RecName: Full=ADP-ribosylation factor 2-A; Short=AtARF2 [Arabidopsis 
thaliana]
 gb|AAG40035.1|AF324684_1 At1g23490 [Arabidopsis thaliana]
 gb|AAG40377.1|AF325025_1 At1g70490 [Arabidopsis thaliana]
 gb|AAG42921.1|AF329504_1 putative ADP-ribosylation factor [Arabidopsis thaliana]
 gb|AAG52463.1|AC010796_2 putative ADP-ribosylation factor 1; 15065-14075 [Arabidopsis 
thaliana]
 gb|AAK25874.1|AF360164_1 putative ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAK49591.1|AF372875_1 F28C11.30/F28C11.30 [Arabidopsis thaliana]
 gb|AAK49617.1|AF372901_1 F28C11.30/F28C11.30 [Arabidopsis thaliana]
 gb|AAL07190.1| putative ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAL15357.1| At1g23490/F5O8_5 [Arabidopsis thaliana]
 gb|AAM44988.1| putative ADP-ribosylation factor [Arabidopsis thaliana]
 gb|AAM64791.1| ADP-ribosylation factor 1-like [Arabidopsis thaliana]
 gb|EFH66845.1| hypothetical protein ARALYDRAFT_472612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30394.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AEE35068.1| ARF GTPase family protein [Arabidopsis thaliana]
 gb|AEE35069.1| ARF GTPase family protein [Arabidopsis thaliana]
 gb|AEE35070.1| ARF GTPase family protein [Arabidopsis thaliana]
 emb|CDY54291.1| BnaC07g48320D [Brassica napus]
 emb|CDY44152.1| BnaA09g31000D [Brassica napus]
 emb|CDY25787.1| BnaA07g09950D [Brassica napus]
 emb|CDY11588.1| BnaC06g31510D [Brassica napus]
 emb|CDY09441.1| BnaC02g19830D [Brassica napus]
 emb|CDY04706.1| BnaC05g18830D [Brassica napus]
 emb|CDY03747.1| BnaA02g14900D [Brassica napus]
Length=181

 Score =   209 bits (531),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|ABF99502.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
Length=194

 Score =   209 bits (532),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_003618207.1| ADP-ribosylation factor [Medicago truncatula]
Length=248

 Score =   211 bits (537),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  68   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  127

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  128  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  169



>gb|ACJ85257.1| unknown [Medicago truncatula]
Length=191

 Score =   209 bits (532),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_001290536.1| uncharacterized protein LOC105052388 [Elaeis guineensis]
 ref|XP_006438365.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 ref|XP_006438366.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 ref|XP_006483876.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006483877.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006483878.1| PREDICTED: ADP-ribosylation factor 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006842402.1| hypothetical protein AMTR_s00204p00014880 [Amborella trichopoda]
 ref|XP_008792471.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008792472.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008807332.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008807333.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 gb|AEQ94161.1| ADP-ribosylation factor [Elaeis guineensis]
 gb|ERN04077.1| hypothetical protein AMTR_s00204p00014880 [Amborella trichopoda]
 gb|ESR51605.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 gb|ESR51606.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
Length=181

 Score =   209 bits (531),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>gb|KHG28118.1| ARF2-B: ADP-ribosylation factor 2-B [Gossypium arboreum]
Length=190

 Score =   209 bits (532),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  10   MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  69

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  70   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  111



>gb|ADH44695.1| ADP-ribosylation factor [Salvia miltiorrhiza]
Length=181

 Score =   209 bits (531),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDK+RPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKVRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>pdb|3AQ4|A Chain A, Molecular Insights Into Plant Cell Proliferation Disturbance 
By Agrobacterium Protein 6b
 pdb|3AQ4|B Chain B, Molecular Insights Into Plant Cell Proliferation Disturbance 
By Agrobacterium Protein 6b
Length=184

 Score =   209 bits (531),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/103 (98%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = +3

Query  30   NMGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK  209
            +MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK
Sbjct  3    HMGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK  62

Query  210  NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  63   NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  105



>emb|CAD12855.1| ADP-ribosylation factor [Gossypium hirsutum]
 gb|AAO37820.1| ADP-ribosylation factor [Gossypium hirsutum]
 gb|AAO45616.1| ADP-ribosylation factor 1 [Gossypium hirsutum]
 gb|AAO62348.1| ADP-ribosylation factor 1 [Gossypium hirsutum]
 gb|KJB82422.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82423.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82426.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82427.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82428.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82429.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
Length=181

 Score =   209 bits (531),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_009393904.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393905.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   209 bits (531),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>ref|NP_196971.1| ADP-ribosylation factor A1B [Arabidopsis thaliana]
 emb|CAB87634.1| ADP-ribosylation factor-like protein [Arabidopsis thaliana]
 gb|AED92061.1| ADP-ribosylation factor A1B [Arabidopsis thaliana]
Length=188

 Score =   209 bits (532),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AAC98042.1| Strong similarity to gb|M95166 ADP-ribosylation factor from Arabidopsis 
thaliana. ESTs gb|Z25826, gb|R90191, gb|N65697, gb|AA713150, 
gb|T46332, gb|AA040967, gb|AA712956, gb|T46403, 
gb|T46050, gb|AI100391 and gb|Z25043 come from this gene [Arabidopsis 
thaliana]
Length=188

 Score =   209 bits (531),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KDP26602.1| hypothetical protein JCGZ_17760 [Jatropha curcas]
Length=181

 Score =   209 bits (531),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>ref|XP_004981306.1| PREDICTED: ADP-ribosylation factor-like isoform X3 [Setaria italica]
Length=198

 Score =   209 bits (532),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  18   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  77

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  78   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  119



>gb|AFW79620.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
Length=130

 Score =   207 bits (526),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|ACU13131.1| unknown [Glycine max]
Length=180

 Score =   209 bits (531),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MG SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGQSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AIX10946.1| putative ADP-ribosylation factor [Gardenia jasminoides]
Length=181

 Score =   209 bits (531),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>ref|XP_004981304.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Setaria italica]
Length=230

 Score =   210 bits (535),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  18   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  77

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  78   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  119



>gb|KJB15578.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
Length=192

 Score =   209 bits (531),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AGH68504.1| ADP-ribosylation factor, partial [Ipomoea batatas]
Length=180

 Score =   208 bits (530),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFKKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006841600.1| hypothetical protein AMTR_s00003p00209290 [Amborella trichopoda]
 gb|ERN03275.1| hypothetical protein AMTR_s00003p00209290 [Amborella trichopoda]
Length=172

 Score =   208 bits (529),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>emb|CDX69567.1| BnaA10g19160D [Brassica napus]
Length=206

 Score =   209 bits (532),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_001042668.1| Os01g0265100 [Oryza sativa Japonica Group]
 dbj|BAA90347.1| putative ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAA92519.1| putative ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAF04582.1| Os01g0265100 [Oryza sativa Japonica Group]
 dbj|BAG90318.1| unnamed protein product [Oryza sativa Japonica Group]
Length=181

 Score =   208 bits (530),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_008223454.1| PREDICTED: ADP-ribosylation factor-like [Prunus mume]
 ref|XP_008223455.1| PREDICTED: ADP-ribosylation factor-like [Prunus mume]
Length=181

 Score =   208 bits (530),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDA+GKTTILYKLKLGEIVTTIPTIGFNVET+EYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDASGKTTILYKLKLGEIVTTIPTIGFNVETLEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFV+DSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRVVE  102



>ref|XP_008812250.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008812251.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008812252.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
Length=181

 Score =   208 bits (530),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR++E
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIIE  102



>ref|XP_008806237.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
Length=181

 Score =   208 bits (530),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFV+DSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRIVE  102



>gb|AGV54289.1| ADP-ribosylation factor [Phaseolus vulgaris]
Length=209

 Score =   209 bits (532),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_008443527.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis melo]
 ref|XP_008443528.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis melo]
Length=181

 Score =   208 bits (530),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010491587.1| PREDICTED: ADP-ribosylation factor 1-like [Camelina sativa]
Length=181

 Score =   208 bits (530),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVE  102



>emb|CDY09875.1| BnaC09g42860D [Brassica napus]
Length=213

 Score =   209 bits (532),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_011087519.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Sesamum indicum]
 ref|XP_011087520.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Sesamum indicum]
Length=192

 Score =   208 bits (530),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  12   MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  71

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  72   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  113



>ref|XP_010553607.1| PREDICTED: ADP-ribosylation factor 2-B [Tarenaya hassleriana]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_182239.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 sp|P36397.2|ARF1_ARATH RecName: Full=ADP-ribosylation factor 1; Short=AtARF1 [Arabidopsis 
thaliana]
 gb|AAA32729.1| ADP-ribosylation factor [Arabidopsis thaliana]
 gb|AAB63817.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAL75910.1| At2g47170/T3D7.2 [Arabidopsis thaliana]
 gb|AAM15469.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAM64892.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAM98296.1| At2g47170/T3D7.2 [Arabidopsis thaliana]
 gb|AEC10810.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AEZ00866.1| putative ADP-ribosylation factor protein [Elaeis guineensis]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
             SFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   FSFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>ref|XP_009595261.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana tomentosiformis]
 ref|XP_009775097.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana sylvestris]
 dbj|BAF34209.1| ADP ribosylation factor [Nicotiana tabacum]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_009417875.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_001136508.1| uncharacterized protein LOC100216623 [Zea mays]
 ref|XP_008654461.1| PREDICTED: uncharacterized protein LOC100216623 isoform X1 [Zea 
mays]
 gb|ACF82071.1| unknown [Zea mays]
 gb|AFW79616.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
 gb|AFW79617.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
 gb|AFW79618.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006344797.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006344798.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_011087517.1| PREDICTED: ADP-ribosylation factor 1-like [Sesamum indicum]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AGV54515.1| ADP ribosylation factor [Phaseolus vulgaris]
Length=237

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006291918.1| hypothetical protein CARUB_v10018102mg [Capsella rubella]
 ref|XP_006295602.1| hypothetical protein CARUB_v10024713mg [Capsella rubella]
 ref|XP_006397909.1| hypothetical protein EUTSA_v10001656mg [Eutrema salsugineum]
 ref|XP_006402389.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 ref|XP_006402390.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 ref|XP_009599611.1| PREDICTED: ADP-ribosylation factor 1 [Nicotiana tomentosiformis]
 ref|XP_009599612.1| PREDICTED: ADP-ribosylation factor 1 [Nicotiana tomentosiformis]
 ref|XP_010506745.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010507921.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010512616.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010518410.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010413292.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010468970.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010544949.1| PREDICTED: ADP-ribosylation factor 1 [Tarenaya hassleriana]
 ref|XP_011087521.1| PREDICTED: ADP-ribosylation factor 1 isoform X3 [Sesamum indicum]
 gb|AAF65512.1| ADP-ribosylation factor [Capsicum annuum]
 gb|AAR03592.1| ARF-like small GTPase [Brassica juncea]
 gb|EOA24816.1| hypothetical protein CARUB_v10018102mg [Capsella rubella]
 gb|EOA28500.1| hypothetical protein CARUB_v10024713mg [Capsella rubella]
 gb|ESQ39362.1| hypothetical protein EUTSA_v10001656mg [Eutrema salsugineum]
 gb|ESQ43842.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 gb|ESQ43843.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 emb|CDX93979.1| BnaC04g21380D [Brassica napus]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006296139.1| hypothetical protein CARUB_v10025292mg, partial [Capsella rubella]
 gb|EOA29037.1| hypothetical protein CARUB_v10025292mg, partial [Capsella rubella]
Length=180

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_004967765.1| PREDICTED: ADP-ribosylation factor 2-like [Setaria italica]
 ref|XP_006644030.1| PREDICTED: ADP-ribosylation factor 2-like [Oryza brachyantha]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_002888469.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64728.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
Length=189

 Score =   208 bits (530),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_009410044.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>emb|CDY47221.1| BnaC09g14700D [Brassica napus]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_009110099.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Brassica rapa]
 gb|ACD37536.1| putative ADP-ribosylation factor [Brassica napus]
 emb|CDY41444.1| BnaA08g20460D [Brassica napus]
 emb|CDX91717.1| BnaC08g06360D [Brassica napus]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_001044599.1| Os01g0813400 [Oryza sativa Japonica Group]
 sp|Q06396.3|ARF1_ORYSJ RecName: Full=ADP-ribosylation factor 1; AltName: Full=13 kDa 
cold-induced protein [Oryza sativa Japonica Group]
 dbj|BAD68219.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAD82682.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAF06513.1| Os01g0813400 [Oryza sativa Japonica Group]
 dbj|BAG88255.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89491.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71689.1| hypothetical protein OsI_04181 [Oryza sativa Indica Group]
 gb|EEE55569.1| hypothetical protein OsJ_03844 [Oryza sativa Japonica Group]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>ref|XP_008444322.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis melo]
 ref|XP_008444323.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis melo]
 ref|XP_008444324.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis melo]
 ref|XP_010551584.1| PREDICTED: ADP-ribosylation factor 2-like [Tarenaya hassleriana]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|ABY76246.1| ADP-ribosylation factor [Brassica napus]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AAO62347.1| ARF1-like GTP-binding protein [Gossypium hirsutum]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQD+IRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDRIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_002876669.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52928.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
Length=189

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010551906.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Tarenaya hassleriana]
 ref|XP_010551907.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Tarenaya hassleriana]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV E
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGE  102



>ref|NP_001274834.1| ARF-like small GTPase-like protein [Solanum tuberosum]
 ref|XP_006344796.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Solanum tuberosum]
 ref|XP_009626500.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana tomentosiformis]
 ref|XP_009794408.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana sylvestris]
 ref|XP_009759065.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana sylvestris]
 ref|XP_010313700.1| PREDICTED: ADP-ribosylation factor 1 [Solanum lycopersicum]
 ref|XP_010313704.1| PREDICTED: ADP-ribosylation factor 1 [Solanum lycopersicum]
 ref|XP_010313716.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Solanum lycopersicum]
 ref|XP_010313724.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Solanum lycopersicum]
 gb|ABA40455.1| ARF-like small GTPase-like protein [Solanum tuberosum]
 gb|ABC01907.1| ARF-like small GTPase-like protein [Solanum tuberosum]
Length=181

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|EMT17349.1| ADP-ribosylation factor 2 [Aegilops tauschii]
Length=193

 Score =   208 bits (530),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>ref|XP_009110098.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Brassica rapa]
Length=182

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_009399937.1| PREDICTED: ADP-ribosylation factor 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009399938.1| PREDICTED: ADP-ribosylation factor 2-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   207 bits (528),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010922923.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010922924.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Elaeis 
guineensis]
Length=181

 Score =   207 bits (528),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>ref|NP_001055892.1| Os05g0489600 [Oryza sativa Japonica Group]
 ref|XP_002441289.1| hypothetical protein SORBIDRAFT_09g023880 [Sorghum bicolor]
 ref|XP_004961688.1| PREDICTED: ADP-ribosylation factor 2-like [Setaria italica]
 ref|XP_006644888.1| PREDICTED: ADP-ribosylation factor 2-like [Oryza brachyantha]
 ref|XP_006654568.1| PREDICTED: ADP-ribosylation factor 2-like [Oryza brachyantha]
 ref|XP_010232477.1| PREDICTED: ADP-ribosylation factor 2 [Brachypodium distachyon]
 ref|XP_010232479.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Brachypodium 
distachyon]
 sp|P51823.2|ARF2_ORYSJ RecName: Full=ADP-ribosylation factor 2 [Oryza sativa Japonica 
Group]
 dbj|BAA04607.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAB41081.1| ADP-ribosylation factor [Triticum aestivum]
 emb|CAD48129.2| ADP-ribosylation factor 1-like protein [Hordeum vulgare subsp. 
vulgare]
 gb|AAT77289.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAF17806.1| Os05g0489600 [Oryza sativa Japonica Group]
 gb|EAY98506.1| hypothetical protein OsI_20417 [Oryza sativa Indica Group]
 dbj|BAG88186.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90235.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99847.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64179.1| hypothetical protein OsJ_19011 [Oryza sativa Japonica Group]
 gb|EES19719.1| hypothetical protein SORBIDRAFT_09g023880 [Sorghum bicolor]
Length=181

 Score =   207 bits (528),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>ref|XP_009383762.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009383763.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
Length=180

 Score =   207 bits (528),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>emb|CDY47137.1| BnaA08g05460D [Brassica napus]
Length=181

 Score =   207 bits (528),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006305640.1| hypothetical protein CARUB_v10010344mg, partial [Capsella rubella]
 gb|EOA38538.1| hypothetical protein CARUB_v10010344mg, partial [Capsella rubella]
Length=197

 Score =   208 bits (530),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  17   MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  76

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VE
Sbjct  77   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVE  118



>gb|ABR17508.1| unknown [Picea sitchensis]
 gb|ABR17650.1| unknown [Picea sitchensis]
 gb|ABR18399.1| unknown [Picea sitchensis]
 gb|ACN39755.1| unknown [Picea sitchensis]
 gb|ACN39884.1| unknown [Picea sitchensis]
 gb|ACN40399.1| unknown [Picea sitchensis]
Length=181

 Score =   207 bits (528),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFQRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_010313707.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Solanum lycopersicum]
 ref|XP_010313711.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Solanum lycopersicum]
Length=183

 Score =   207 bits (528),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_001237492.1| uncharacterized protein LOC100499890 [Glycine max]
 gb|ACU14076.1| unknown [Glycine max]
Length=181

 Score =   207 bits (528),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRD VVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDLVVE  102



>emb|CDM84658.1| unnamed protein product [Triticum aestivum]
Length=182

 Score =   207 bits (528),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>gb|AAU82112.1| ADP-ribosylation factor [Triticum aestivum]
Length=181

 Score =   207 bits (528),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFGRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AFW79615.1| hypothetical protein ZEAMMB73_444016, partial [Zea mays]
Length=210

 Score =   208 bits (530),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_009381359.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381360.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FT+LFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTRLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR++E
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIIE  102



>ref|XP_009105711.1| PREDICTED: ADP-ribosylation factor 2-B-like [Brassica rapa]
Length=181

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_002962225.1| ARF family GTPase [Selaginella moellendorffii]
 ref|XP_002965138.1| ARF family GTPase [Selaginella moellendorffii]
 gb|EFJ33976.1| ARF family GTPase [Selaginella moellendorffii]
 gb|EFJ37485.1| ARF family GTPase [Selaginella moellendorffii]
Length=181

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFQRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AFK42466.1| unknown [Lotus japonicus]
Length=181

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDA GKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAVGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVE  102



>ref|XP_010232478.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Brachypodium 
distachyon]
Length=182

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>ref|XP_009391635.1| PREDICTED: ADP-ribosylation factor 2 [Musa acuminata subsp. malaccensis]
Length=181

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV+E
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVIE  102



>ref|NP_001059207.1| Os07g0223400 [Oryza sativa Japonica Group]
 ref|NP_001147310.1| ADP-ribosylation factor 1 [Zea mays]
 ref|NP_001146953.1| ADP-ribosylation factor 1 [Zea mays]
 ref|XP_002459554.1| hypothetical protein SORBIDRAFT_02g006540 [Sorghum bicolor]
 ref|XP_004955819.1| PREDICTED: ADP-ribosylation factor 1-like [Setaria italica]
 ref|XP_006657565.1| PREDICTED: ADP-ribosylation factor 1-like [Oryza brachyantha]
 gb|AAB65432.1| ADP-ribosylation factor 1 [Oryza sativa]
 dbj|BAC06914.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 dbj|BAC45192.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 dbj|BAD31195.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 dbj|BAF21121.1| Os07g0223400 [Oryza sativa Japonica Group]
 gb|ACF83333.1| unknown [Zea mays]
 gb|ACG24722.1| ADP-ribosylation factor 1 [Zea mays]
 gb|ACG26712.1| ADP-ribosylation factor 1 [Zea mays]
 dbj|BAH01227.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01635.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81745.1| hypothetical protein OsI_25399 [Oryza sativa Indica Group]
 gb|EEC81746.1| hypothetical protein OsI_25400 [Oryza sativa Indica Group]
 gb|ACN30622.1| unknown [Zea mays]
 gb|EER96075.1| hypothetical protein SORBIDRAFT_02g006540 [Sorghum bicolor]
 tpg|DAA60037.1| TPA: ADP-ribosylation factor 1 [Zea mays]
Length=181

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|EMT22177.1| ADP-ribosylation factor [Aegilops tauschii]
Length=263

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  24   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  83

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  84   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  125



>ref|XP_009394868.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FT+LFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTRLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR++E
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIIE  102



>gb|ACR37635.1| unknown [Zea mays]
 tpg|DAA57152.1| TPA: hypothetical protein ZEAMMB73_454864 [Zea mays]
Length=153

 Score =   206 bits (525),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>ref|XP_009629758.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Nicotiana tomentosiformis]
Length=244

 Score =   209 bits (533),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  64   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  123

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  124  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  165



>ref|XP_010551905.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Tarenaya hassleriana]
Length=208

 Score =   208 bits (529),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  28   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  87

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV E
Sbjct  88   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGE  129



>ref|XP_011462890.1| PREDICTED: ADP-ribosylation factor-like isoform X3 [Fragaria 
vesca subsp. vesca]
Length=181

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKL SRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLLSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVE  102



>gb|ABR25719.1| ADP-ribosylation factor 1 [Oryza sativa Indica Group]
Length=181

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_003557370.1| PREDICTED: ADP-ribosylation factor 1 [Brachypodium distachyon]
Length=181

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_006416080.1| hypothetical protein EUTSA_v10008884mg [Eutrema salsugineum]
 gb|ESQ34433.1| hypothetical protein EUTSA_v10008884mg [Eutrema salsugineum]
Length=181

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV E
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVSE  102



>ref|XP_003557369.1| PREDICTED: ADP-ribosylation factor 1-like [Brachypodium distachyon]
Length=181

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>dbj|BAJ87426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=181

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KJB81136.1| hypothetical protein B456_013G131000 [Gossypium raimondii]
Length=227

 Score =   209 bits (531),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  47   MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  106

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  107  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  148



>emb|CDX95712.1| BnaC03g25930D [Brassica napus]
Length=190

 Score =   207 bits (527),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KHG17087.1| ARF2-B: ADP-ribosylation factor 2-B [Gossypium arboreum]
Length=213

 Score =   208 bits (529),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  17   MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  76

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  77   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  118



>gb|EMS63688.1| ADP-ribosylation factor 2 [Triticum urartu]
Length=186

 Score =   207 bits (527),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>gb|ACM67554.1| ADP-ribosylation factor-like protein [Musa acuminata AAA Group]
Length=181

 Score =   207 bits (526),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFIRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_001168955.1| uncharacterized protein LOC100382775 [Zea mays]
 gb|ACN31185.1| unknown [Zea mays]
 gb|AFW84789.1| hypothetical protein ZEAMMB73_845118 [Zea mays]
Length=181

 Score =   207 bits (526),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>ref|XP_010694842.1| PREDICTED: ADP-ribosylation factor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=181

 Score =   207 bits (526),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|NP_191788.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 ref|NP_001190161.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 ref|NP_001190162.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 ref|XP_002880284.1| ADP-ribosylation factor A1E [Arabidopsis lyrata subsp. lyrata]
 ref|XP_009142560.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 ref|XP_009142561.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 ref|XP_010523901.1| PREDICTED: ADP-ribosylation factor 1 [Tarenaya hassleriana]
 gb|AAK49618.1|AF372902_1 AT3g62290/T17J13_250 [Arabidopsis thaliana]
 emb|CAB71889.1| ADP-ribosylation factor-like protein [Arabidopsis thaliana]
 gb|AAL15358.1| AT3g62290/T17J13_250 [Arabidopsis thaliana]
 gb|AAM62611.1| ADP-ribosylation factor-like protein [Arabidopsis thaliana]
 gb|ABL97964.1| ADP-ribosylation factor-like protein [Brassica rapa]
 gb|EFH56543.1| ADP-ribosylation factor A1E [Arabidopsis lyrata subsp. lyrata]
 gb|AEE80332.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 gb|AEE80333.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 gb|AEE80334.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 emb|CDY51415.1| BnaA04g26920D [Brassica napus]
 emb|CDY37791.1| BnaC04g00340D [Brassica napus]
 emb|CDY27506.1| BnaC04g51470D [Brassica napus]
 emb|CDX89139.1| BnaA04g00470D [Brassica napus]
 emb|CDX80083.1| BnaA05g00730D [Brassica napus]
Length=181

 Score =   206 bits (525),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_009113207.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 ref|XP_009113208.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 emb|CDY53050.1| BnaA09g14150D [Brassica napus]
Length=181

 Score =   206 bits (525),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_004228551.1| PREDICTED: ADP-ribosylation factor 2-like [Solanum lycopersicum]
Length=181

 Score =   206 bits (525),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV E
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGE  102



>gb|EEE66819.1| hypothetical protein OsJ_23579 [Oryza sativa Japonica Group]
Length=279

 Score =   209 bits (533),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  99   MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  158

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  159  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  200



>ref|NP_001149117.1| ADP-ribosylation factor [Zea mays]
 ref|XP_002456522.1| hypothetical protein SORBIDRAFT_03g037760 [Sorghum bicolor]
 ref|XP_008672877.1| PREDICTED: ADP-ribosylation factor isoform X1 [Zea mays]
 gb|ACF83883.1| unknown [Zea mays]
 gb|ACF88010.1| unknown [Zea mays]
 gb|ACG34254.1| ADP-ribosylation factor [Zea mays]
 gb|ACG42128.1| ADP-ribosylation factor [Zea mays]
 gb|EES01642.1| hypothetical protein SORBIDRAFT_03g037760 [Sorghum bicolor]
 tpg|DAA57153.1| TPA: ADP-ribosylation factor [Zea mays]
Length=181

 Score =   206 bits (525),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>ref|XP_004970328.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Setaria 
italica]
Length=181

 Score =   206 bits (525),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>ref|XP_009420958.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009420959.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   206 bits (525),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVE  102



>gb|ABF74733.1| ADP-ribosylation factor 1 [Nicotiana benthamiana]
Length=181

 Score =   206 bits (525),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEI TTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIGTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_004970327.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Setaria 
italica]
Length=182

 Score =   206 bits (524),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>gb|AFW79619.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
Length=278

 Score =   209 bits (533),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|EAY73411.1| hypothetical protein OsI_01294 [Oryza sativa Indica Group]
 gb|EAZ11343.1| hypothetical protein OsJ_01211 [Oryza sativa Japonica Group]
Length=216

 Score =   207 bits (527),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_009395959.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395960.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395962.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   206 bits (524),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FT+LFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTRLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR++E
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIIE  102



>ref|XP_009115521.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
 ref|XP_009115522.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
Length=181

 Score =   206 bits (524),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILM GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMGGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AAT08663.1| ADP-ribosylation factor [Hyacinthus orientalis]
Length=181

 Score =   206 bits (524),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F K+FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKIFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AFW78461.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
Length=148

 Score =   205 bits (521),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 104/112 (93%), Gaps = 4/112 (4%)
 Frame = +3

Query  3    PCRSVSSV*NMGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG  182
            PC     +  MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG
Sbjct  10   PC----DLSEMGLTFTKLFRRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG  65

Query  183  FNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            FNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  66   FNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  117



>ref|XP_004158320.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis sativus]
 ref|XP_008443537.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Cucumis 
melo]
 gb|KGN59683.1| hypothetical protein Csa_3G837640 [Cucumis sativus]
Length=181

 Score =   206 bits (524),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLF RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_001776146.1| predicted protein [Physcomitrella patens]
 gb|EDQ59057.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   206 bits (523),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLF+RLF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFTRLFSKQEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_008443534.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Cucumis 
melo]
 ref|XP_008443535.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Cucumis 
melo]
 ref|XP_008443536.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Cucumis 
melo]
Length=186

 Score =   206 bits (524),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLF RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>emb|CDX83340.1| BnaA03g21660D [Brassica napus]
Length=191

 Score =   206 bits (524),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MG+SF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGVSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AAF79587.1|AC007945_7 F28C11.12 [Arabidopsis thaliana]
Length=245

 Score =   208 bits (529),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AFW78462.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
Length=199

 Score =   206 bits (524),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 104/112 (93%), Gaps = 4/112 (4%)
 Frame = +3

Query  3    PCRSVSSV*NMGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG  182
            PC     +  MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG
Sbjct  10   PC----DLSEMGLTFTKLFRRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG  65

Query  183  FNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            FNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  66   FNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  117



>ref|NP_001170436.1| uncharacterized protein LOC100384428 [Zea mays]
 ref|XP_008648189.1| PREDICTED: uncharacterized protein LOC100384428 isoform X1 [Zea 
mays]
 ref|XP_008648190.1| PREDICTED: uncharacterized protein LOC100384428 isoform X1 [Zea 
mays]
 gb|ACN36989.1| unknown [Zea mays]
 gb|AFW78458.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
 gb|AFW78459.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
 gb|AFW78460.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
Length=184

 Score =   206 bits (523),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFRRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>gb|AFW78457.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
Length=182

 Score =   206 bits (523),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFRRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>ref|XP_001776112.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ59023.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   206 bits (523),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFS+LF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSKLFSKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|EMS51203.1| ADP-ribosylation factor 2 [Triticum urartu]
Length=233

 Score =   207 bits (527),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVE  102



>ref|XP_009133804.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
Length=181

 Score =   205 bits (522),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MG+SF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGVSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|KJB09503.1| hypothetical protein B456_001G146100 [Gossypium raimondii]
Length=181

 Score =   205 bits (522),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFS LF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSWLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_011462888.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=216

 Score =   206 bits (525),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKL SRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  36   MGLSFTKLLSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  95

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VE
Sbjct  96   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVE  137



>gb|EEE66818.1| hypothetical protein OsJ_23578 [Oryza sativa Japonica Group]
Length=241

 Score =   207 bits (527),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/102 (98%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  61   MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  120

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  121  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  162



>gb|ACG31280.1| ADP-ribosylation factor 1 [Zea mays]
Length=181

 Score =   205 bits (521),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+F KLFSRLFAKKEMRILM GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKLFSRLFAKKEMRILMFGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>sp|O23778.3|ARF1_CATRO RecName: Full=ADP-ribosylation factor 1 [Catharanthus roseus]
 gb|AAB62249.1| ADP-ribosylation factor 1 [Catharanthus roseus]
Length=181

 Score =   205 bits (521),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILY+LKLGEIVTTIPTIGFNVETVEY+ 
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYQLKLGEIVTTIPTIGFNVETVEYQY  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|AAD17207.1| ADP-ribosylation factor [Glycine max]
Length=178

 Score =   205 bits (521),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/99 (100%), Positives = 99/99 (100%), Gaps = 0/99 (0%)
 Frame = +3

Query  42   SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  221
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  1    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  60

Query  222  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  99



>ref|XP_001764375.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ70929.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   205 bits (521),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLF++LF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFTKLFSKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>gb|ABR17658.1| unknown [Picea sitchensis]
 gb|ACN40238.1| unknown [Picea sitchensis]
Length=181

 Score =   204 bits (520),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLF R+FAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFQRMFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV E
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVAE  102



>ref|XP_007147411.1| hypothetical protein PHAVU_006G122200g [Phaseolus vulgaris]
 gb|ESW19405.1| hypothetical protein PHAVU_006G122200g [Phaseolus vulgaris]
Length=184

 Score =   205 bits (521),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF K+FSRL AKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKIFSRLCAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



>ref|XP_009138731.1| PREDICTED: ADP-ribosylation factor 1 [Brassica rapa]
Length=181

 Score =   204 bits (520),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGLSF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQ+TQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQDTQGLIFVVDSNDRDRVVE  102



>ref|XP_001764701.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 ref|XP_001764769.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ70400.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ70468.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   204 bits (520),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = +3

Query  33   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  212
            MGL+FTKLF++LF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFTKLFSKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  213  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  338
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVE  102



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560672394880