BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF008L11

Length=377
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   3e-53   Nicotiana sylvestris
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    180   1e-51   Nicotiana tomentosiformis
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    180   2e-51   Nicotiana tomentosiformis
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    179   2e-51   
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    178   8e-51   
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    178   9e-51   Nicotiana sylvestris
gb|EYU41183.1|  hypothetical protein MIMGU_mgv1a025772mg                170   1e-50   Erythranthe guttata [common monkey flower]
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               176   3e-50   Solanum tuberosum [potatoes]
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    176   3e-50   Solanum tuberosum [potatoes]
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    176   3e-50   Solanum lycopersicum
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              174   3e-49   Scoparia dulcis [escobilla]
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    172   8e-49   Sesamum indicum [beniseed]
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    172   2e-48   Fragaria vesca subsp. vesca
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    172   2e-48   Prunus mume [ume]
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             171   2e-48   Prunus persica
gb|ABC68431.1|  putative glyceraldehyde 3-phosphate dehydrogenase       159   7e-47   Tragopogon pratensis [Jack-go-to-bed-at-noon]
gb|ABC68432.1|  putative glyceraldehyde 3-phosphate dehydrogenase       159   1e-46   Tragopogon dubius [yellow salsify]
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    167   1e-46   Malus domestica [apple tree]
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    167   1e-46   Pyrus x bretschneideri [bai li]
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              167   2e-46   Pyrus x bretschneideri [bai li]
ref|XP_003603852.1|  Glyceraldehyde-3-phosphate dehydrogenase           162   2e-46   
gb|ACJ85309.1|  unknown                                                 160   5e-46   Medicago truncatula
emb|CAN69459.1|  hypothetical protein VITISV_021576                     165   8e-46   Vitis vinifera
gb|KJB14201.1|  hypothetical protein B456_002G114000                    164   2e-45   Gossypium raimondii
emb|CAA33262.1|  unnamed protein product                                164   2e-45   Pisum sativum [garden pea]
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    164   2e-45   Pisum sativum [garden pea]
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    164   2e-45   Glycine soja [wild soybean]
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    163   3e-45   Gossypium arboreum [tree cotton]
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              162   5e-45   Medicago truncatula
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    162   7e-45   
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    162   8e-45   Vitis vinifera
gb|ACJ84309.1|  unknown                                                 162   1e-44   Medicago truncatula
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           162   1e-44   Medicago truncatula
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    160   1e-44   
gb|KJB57937.1|  hypothetical protein B456_009G186400                    157   1e-44   Gossypium raimondii
ref|NP_001240080.1|  uncharacterized protein LOC100806482               161   1e-44   Glycine max [soybeans]
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    161   1e-44   
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         166   2e-44   
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    161   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    160   2e-44   Pyrus x bretschneideri [bai li]
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    160   3e-44   
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           161   3e-44   
gb|ACU20783.1|  unknown                                                 160   3e-44   Glycine max [soybeans]
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    160   3e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB57939.1|  hypothetical protein B456_009G186400                    157   4e-44   Gossypium raimondii
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    160   4e-44   Glycine max [soybeans]
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    160   4e-44   Gossypium arboreum [tree cotton]
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             160   5e-44   Phaseolus vulgaris [French bean]
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    160   1e-43   Cicer arietinum [garbanzo]
gb|KJB57938.1|  hypothetical protein B456_009G186400                    157   2e-43   Gossypium raimondii
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    157   3e-43   Nicotiana tabacum [American tobacco]
emb|CDP07271.1|  unnamed protein product                                157   4e-43   Coffea canephora [robusta coffee]
gb|KJB57936.1|  hypothetical protein B456_009G186400                    157   4e-43   Gossypium raimondii
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    157   5e-43   Ricinus communis
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    157   6e-43   Spinacia oleracea
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         157   8e-43   Jatropha curcas
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    156   2e-42   Populus euphratica
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    156   2e-42   Elaeis guineensis
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    156   2e-42   Populus euphratica
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    155   5e-42   Cucumis melo [Oriental melon]
ref|XP_006383782.1|  hypothetical protein POPTR_0005s27550g             151   9e-42   
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    154   1e-41   Cucumis sativus [cucumbers]
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    154   1e-41   
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    153   1e-41   Phoenix dactylifera
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    153   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    152   4e-41   Populus euphratica
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    152   6e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             152   6e-41   
gb|KDO85181.1|  hypothetical protein CISIN_1g012940mg                   148   6e-41   Citrus sinensis [apfelsine]
gb|KDO85183.1|  hypothetical protein CISIN_1g012940mg                   148   6e-41   Citrus sinensis [apfelsine]
gb|KDO85179.1|  hypothetical protein CISIN_1g012940mg                   147   6e-41   Citrus sinensis [apfelsine]
gb|KDO85177.1|  hypothetical protein CISIN_1g012940mg                   148   7e-41   Citrus sinensis [apfelsine]
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    151   9e-41   Tarenaya hassleriana [spider flower]
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    151   1e-40   
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    151   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    150   2e-40   Populus trichocarpa [western balsam poplar]
gb|KDO85176.1|  hypothetical protein CISIN_1g012940mg                   146   8e-40   Citrus sinensis [apfelsine]
ref|XP_006435407.1|  hypothetical protein CICLE_v10001114mg             146   9e-40   
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   148   9e-40   Citrus sinensis [apfelsine]
gb|KDO85175.1|  hypothetical protein CISIN_1g012940mg                   145   1e-39   Citrus sinensis [apfelsine]
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                146   2e-39   Vicia sativa [spring vetch]
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    147   2e-39   Citrus sinensis [apfelsine]
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             147   2e-39   Citrus clementina [clementine]
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             147   3e-39   Eutrema salsugineum [saltwater cress]
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    146   5e-39   Eucalyptus grandis [rose gum]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    145   2e-38   Brassica rapa
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            144   5e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    142   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             141   4e-37   Capsella rubella
gb|EPS70760.1|  hypothetical protein M569_03997                         139   2e-36   Genlisea aurea
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    139   2e-36   
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    139   3e-36   Arabis alpina [alpine rockcress]
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             135   4e-35   
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    130   4e-33   Camelina sativa [gold-of-pleasure]
gb|ABF93790.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    124   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   4e-32   Setaria italica
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    126   9e-32   Triticum urartu
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    126   1e-31   
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    126   1e-31   
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    125   3e-31   
dbj|BAJ87214.1|  predicted protein                                      124   4e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86633.1|  predicted protein                                      124   4e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001048847.1|  Os03g0129300                                       123   1e-30   
gb|ABR16095.1|  unknown                                                 116   3e-29   Picea sitchensis
gb|ADE06487.1|  putative glyceraldehyde 3-phosphate dehydrogenase       111   7e-29   Tragopogon dubius [yellow salsify]
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    118   8e-29   
gb|ACN40006.1|  unknown                                                 118   8e-29   Picea sitchensis
gb|ABK24645.1|  unknown                                                 118   8e-29   Picea sitchensis
gb|ADE06488.1|  putative glyceraldehyde 3-phosphate dehydrogenase       111   9e-29   Tragopogon porrifolius [oyster plant]
gb|ACN40526.1|  unknown                                                 116   3e-28   Picea sitchensis
ref|XP_001779769.1|  predicted protein                                  115   8e-28   
emb|CDY69523.1|  BnaC08g46180D                                          114   2e-27   Brassica napus [oilseed rape]
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             114   3e-27   Selaginella moellendorffii
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             112   1e-26   
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      111   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    110   6e-26   Camelina sativa [gold-of-pleasure]
emb|CBI21236.3|  unnamed protein product                                106   7e-25   Vitis vinifera
ref|XP_001771209.1|  predicted protein                                  107   7e-25   
gb|ACN41006.1|  unknown                                                 107   9e-25   Picea sitchensis
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    106   1e-24   
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    106   1e-24   Vitis vinifera
emb|CAN78872.1|  hypothetical protein VITISV_021726                     106   1e-24   Vitis vinifera
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    105   2e-24   Marchantia polymorpha
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               105   4e-24   Marchantia polymorpha
gb|AAF03099.1|AF162198_1  NADP-dependent glyceraldehyde phosphate...  99.8    6e-24   Lactuca sativa [cultivated lettuce]
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    103   8e-24   Gossypium arboreum [tree cotton]
gb|ABR18416.1|  unknown                                                 104   1e-23   Picea sitchensis
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               103   2e-23   Marchantia polymorpha
gb|AAF19788.1|AF162202_1  NADP-dependent glyceraldehyde phosphate...  98.6    2e-23   Lactuca sativa [cultivated lettuce]
gb|KJB11771.1|  hypothetical protein B456_001G276400                    102   2e-23   Gossypium raimondii
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        102   3e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    102   4e-23   Arabis alpina [alpine rockcress]
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    102   5e-23   Eucalyptus grandis [rose gum]
emb|CDY48981.1|  BnaA02g28150D                                          101   6e-23   Brassica napus [oilseed rape]
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    101   7e-23   
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    101   7e-23   Glycine soja [wild soybean]
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    101   8e-23   Glycine soja [wild soybean]
gb|ACU21011.1|  unknown                                                 101   8e-23   Glycine max [soybeans]
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    101   8e-23   
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    100   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          100   2e-22   
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    100   2e-22   Malus domestica [apple tree]
ref|XP_002892719.1|  GAPA-2                                             100   2e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    100   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_001753934.1|  predicted protein                                  100   2e-22   
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    100   2e-22   Pyrus x bretschneideri [bai li]
emb|CDY16038.1|  BnaC08g40850D                                          100   2e-22   Brassica napus [oilseed rape]
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             100   2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.8    3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.8    3e-22   Brassica rapa
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680        99.4    4e-22   Amborella trichopoda
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A           99.0    5e-22   Cucumis sativus [cucumbers]
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.0    5e-22   Malus domestica [apple tree]
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...  99.0    6e-22   Nicotiana tabacum [American tobacco]
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.0    6e-22   Cucumis melo [Oriental melon]
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.0    6e-22   
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.0    6e-22   Cucumis melo [Oriental melon]
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.0    6e-22   Nicotiana sylvestris
emb|CDY26599.1|  BnaA09g46780D                                        98.6    7e-22   Brassica napus [oilseed rape]
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  98.6    8e-22   Brassica rapa
emb|CDY19412.1|  BnaC05g09210D                                        98.6    8e-22   Brassica napus [oilseed rape]
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A           98.6    8e-22   Nicotiana benthamiana
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  98.6    8e-22   Nicotiana tomentosiformis
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg           98.6    8e-22   
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase             98.6    9e-22   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  98.2    9e-22   Sesamum indicum [beniseed]
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg           98.6    9e-22   Prunus persica
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  98.2    1e-21   Prunus mume [ume]
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  98.2    1e-21   Tarenaya hassleriana [spider flower]
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase              98.2    1e-21   Mangifera indica
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825           97.4    2e-21   Selaginella moellendorffii
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A       97.4    2e-21   Morus notabilis
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561           97.4    2e-21   Selaginella moellendorffii
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.4    2e-21   
ref|XP_002875330.1|  gapa                                             97.1    3e-21   Arabidopsis lyrata subsp. lyrata
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit  97.1    3e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase              97.1    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.1    3e-21   
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg           97.1    3e-21   Capsella rubella
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase              97.1    3e-21   Arachis hypogaea [goober]
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg           96.7    3e-21   Eutrema salsugineum [saltwater cress]
gb|KHN00649.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  96.3    3e-21   Glycine soja [wild soybean]
ref|XP_001771246.1|  predicted protein                                96.7    3e-21   
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  96.7    4e-21   Camelina sativa [gold-of-pleasure]
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                  96.7    4e-21   Arabis alpina [alpine rockcress]
emb|CDP18560.1|  unnamed protein product                              96.3    4e-21   Coffea canephora [robusta coffee]
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                96.3    5e-21   Pinus sylvestris [Scotch pine]
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.5    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.5    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.5    1e-20   Fragaria vesca subsp. vesca
gb|EPS59235.1|  hypothetical protein M569_15573                       95.1    1e-20   Genlisea aurea
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A       95.1    2e-20   Medicago truncatula
dbj|BAJ34149.1|  unnamed protein product                              94.4    2e-20   Eutrema halophilum
emb|CDX83635.1|  BnaC07g23750D                                        94.4    2e-20   
gb|ACN40537.1|  unknown                                               94.4    2e-20   Picea sitchensis
gb|ACN40000.1|  unknown                                               94.4    3e-20   Picea sitchensis
gb|ABK25233.1|  unknown                                               94.4    3e-20   Picea sitchensis
gb|ABK24313.1|  unknown                                               94.4    3e-20   Picea sitchensis
emb|CDY28536.1|  BnaC02g36240D                                        94.0    3e-20   Brassica napus [oilseed rape]
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  94.4    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  94.0    4e-20   Setaria italica
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...  93.6    5e-20   Theobroma cacao [chocolate]
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.6    5e-20   Citrus sinensis [apfelsine]
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...  93.6    5e-20   Ricinus communis
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg           93.6    5e-20   Citrus clementina [clementine]
emb|CDY13649.1|  BnaA06g32740D                                        93.2    6e-20   Brassica napus [oilseed rape]
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                 94.0    6e-20   Citrus sinensis [apfelsine]
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                 93.6    7e-20   Citrus sinensis [apfelsine]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  93.2    7e-20   Brassica rapa
gb|AGJ50596.1|  GAPDH                                                 93.2    7e-20   Pericallis cruenta
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase     93.2    7e-20   Medicago sativa [alfalfa]
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A            92.8    8e-20   Scoparia dulcis [escobilla]
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  92.8    9e-20   Populus euphratica
gb|AGV54738.1|  glyceraldehyde-3-phosphate dehydrogenase A chloro...  92.4    9e-20   Phaseolus vulgaris [French bean]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g           92.4    1e-19   Phaseolus vulgaris [French bean]
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A            92.4    1e-19   Phaseolus vulgaris [French bean]
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  92.4    1e-19   Solanum tuberosum [potatoes]
gb|KJB70723.1|  hypothetical protein B456_011G088800                  92.4    2e-19   Gossypium raimondii
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B    92.4    2e-19   Mesostigma viride
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  92.0    2e-19   Solanum lycopersicum
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  91.7    2e-19   Gossypium arboreum [tree cotton]
gb|AAA33484.1|  glyceraldehyde-3-phosphate dehydrogenase precursor    88.2    2e-19   Zea mays [maize]
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1   91.7    2e-19   Physcomitrella patens
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase             92.8    2e-19   Chara vulgaris
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase              91.7    3e-19   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_001779753.1|  predicted protein                                91.7    3e-19   
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.3    3e-19   Cicer arietinum [garbanzo]
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.3    4e-19   Populus euphratica
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg              92.0    4e-19   Erythranthe guttata [common monkey flower]
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase              90.9    4e-19   Syntrichia caninervis
ref|XP_001766703.1|  predicted protein                                90.5    5e-19   
gb|ABK96725.1|  unknown                                               90.5    7e-19   Populus trichocarpa x Populus deltoides
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g           90.5    7e-19   Populus trichocarpa [western balsam poplar]
gb|ABK96233.1|  unknown                                               90.5    7e-19   Populus trichocarpa x Populus deltoides
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g           90.5    7e-19   
gb|ABK94956.1|  unknown                                               90.5    8e-19   Populus trichocarpa [western balsam poplar]
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.1    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.7    1e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  89.0    2e-18   Marchantia polymorpha
gb|KDP41897.1|  hypothetical protein JCGZ_26915                       89.0    2e-18   Jatropha curcas
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.0    3e-18   Solanum lycopersicum
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2   88.2    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458726.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  87.8    3e-18   Camelina sativa [gold-of-pleasure]
dbj|BAH57068.1|  AT1G12900                                            88.2    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  87.8    4e-18   Pyrus x bretschneideri [bai li]
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit    87.4    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg           87.4    5e-18   
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  88.2    8e-18   
gb|AFK38236.1|  unknown                                               83.6    1e-17   Medicago truncatula
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  87.0    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...  87.0    1e-17   Spinacia oleracea
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...  87.0    1e-17   Zea mays [maize]
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  86.3    2e-17   Triticum urartu
dbj|BAJ90530.1|  predicted protein                                    86.7    2e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90885.1|  predicted protein                                    86.7    2e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA30152.1|  GADPH (383 AA)                                       85.9    2e-17   Zea mays [maize]
gb|KHN13412.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  84.7    3e-17   Glycine soja [wild soybean]
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  86.7    3e-17   
dbj|BAK02737.1|  predicted protein                                    85.1    3e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  85.1    3e-17   
tpg|DAA37468.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1       84.3    5e-17   
gb|AAB23533.1|  glyceraldehyde-3-phosphate-dehydrogenase subunit ...  80.9    6e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CAA33264.1|  unnamed protein product                              85.1    6e-17   Pisum sativum [garden pea]
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...  85.1    7e-17   Pisum sativum [garden pea]
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  85.1    8e-17   
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  84.7    8e-17   Oryza brachyantha
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  84.7    8e-17   Mesostigma viride
ref|XP_010270465.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  81.6    2e-16   
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1       83.6    2e-16   
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  82.8    4e-16   Brachypodium distachyon [annual false brome]
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase              82.0    5e-16   Lilium regale
ref|NP_001052984.1|  Os04g0459500                                     82.8    5e-16   
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...  81.6    8e-16   Spinacia oleracea
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...  80.9    1e-15
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...  80.9    1e-15   Arabidopsis thaliana [mouse-ear cress]
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...  80.9    1e-15   Spinacia oleracea
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...  80.9    1e-15   Spinacia oleracea
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...  80.9    1e-15   Spinacia oleracea
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...  80.5    2e-15   Spinacia oleracea
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  80.5    3e-15   
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A            79.7    3e-15   
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B            79.3    7e-15   
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  78.6    1e-14   
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...  78.6    1e-14   
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  78.2    2e-14   
gb|AAB82133.1|  glyceralehyde-3-phosphate dehydrogenase subunit       77.0    3e-14   
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...  77.0    5e-14   
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase         76.6    8e-14   
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase             75.5    1e-13   
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403           76.3    1e-13   
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B    76.3    2e-13   
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...  74.3    3e-13   
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase             73.9    4e-13   
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  74.7    4e-13   
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase             73.6    5e-13   
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase  74.3    6e-13   
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase             72.8    8e-13   
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase         73.6    9e-13   
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    72.0    2e-12   
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.4    3e-12   
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase             70.9    4e-12   
gb|AAP80811.1|  glyceraldehyde-3-phosphate dehydrogenase precursor    68.6    6e-12   
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.2    6e-12   
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  70.9    7e-12   
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662            70.9    7e-12   
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase         70.9    8e-12   
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase              70.9    8e-12   
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  70.5    8e-12   
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase              70.5    8e-12   
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  70.9    9e-12   
gb|AAP32469.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    70.9    9e-12   
gb|KIY96104.1|  hypothetical protein MNEG_11860                       68.6    1e-11   
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    70.1    1e-11   
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                  69.7    2e-11   
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B    68.9    2e-11   
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    68.9    3e-11   
ref|XP_001420043.1|  predicted protein                                67.8    7e-11   
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase              67.4    8e-11   
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    67.4    9e-11   
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase              67.0    9e-11   
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase             67.0    1e-10   
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...  67.8    1e-10   
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    67.0    2e-10   
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase         67.0    2e-10   
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...  67.0    2e-10   
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase         66.6    2e-10   
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    66.2    4e-10   
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...  65.9    6e-10   
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  65.1    6e-10   
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase             65.1    6e-10   
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...  65.5    7e-10   
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...  65.1    1e-09   
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...  65.1    1e-09   
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase         64.3    1e-09   
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase         64.3    1e-09   
ref|WP_011140533.1|  glyceraldehyde-3-phosphate dehydrogenase         63.9    2e-09   
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase         63.9    2e-09   
ref|XP_001415434.1|  predicted protein                                63.9    2e-09   
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase             63.2    3e-09   
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2       63.2    3e-09   
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase         63.2    3e-09   
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    63.5    3e-09   
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase         63.2    4e-09   
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase         63.2    4e-09   
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  62.8    4e-09   
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...  62.8    4e-09   
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...  62.8    4e-09   
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  62.4    6e-09   
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase              62.0    6e-09   
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B       62.4    7e-09   
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  62.0    8e-09   
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           62.0    9e-09   
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           62.0    1e-08   
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           62.0    1e-08   
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           62.0    1e-08   
ref|WP_011244659.1|  glyceraldehyde-3-phosphate dehydrogenase         61.6    1e-08   
ref|WP_011378166.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  61.6    1e-08   
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  61.6    1e-08   
pdb|2D2I|A  Chain A, Crystal Structure Of Nadp-Dependent Glyceral...  61.6    1e-08   
gb|ACN39951.1|  unknown                                               61.2    1e-08   
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-08   
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-08   
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-08   
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-08   
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-08   
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-08   
ref|WP_039728353.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  61.2    2e-08   
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-08   
ref|WP_037218187.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-08   
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...  61.2    2e-08   
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-08   
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)      61.2    2e-08   
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  60.8    2e-08   
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase         60.8    2e-08   
ref|XP_005843104.1|  hypothetical protein CHLNCDRAFT_49269            60.5    3e-08   
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase         60.5    3e-08   
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase         60.5    3e-08   
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase         60.5    3e-08   
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase         60.5    3e-08   
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339           60.8    3e-08   
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase         60.5    3e-08   
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase         60.5    3e-08   
ref|WP_008311916.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  60.5    3e-08   
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...  60.5    3e-08   
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase         60.1    4e-08   
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  60.1    4e-08   
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase         60.1    4e-08   
ref|WP_011429234.1|  glyceraldehyde-3-phosphate dehydrogenase         60.1    4e-08   
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  60.1    4e-08   
ref|WP_011433307.1|  glyceraldehyde-3-phosphate dehydrogenase         60.1    4e-08   
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase         60.5    4e-08   
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase         59.7    5e-08   
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  60.5    5e-08   
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase         59.7    5e-08   
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  59.7    5e-08   
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  59.7    5e-08   
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase         59.7    5e-08   
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase         59.7    6e-08   
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase         59.7    6e-08   
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  59.7    6e-08   
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase         59.7    6e-08   
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase         59.3    7e-08   
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase         59.3    7e-08   
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase         59.3    7e-08   
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase         59.3    8e-08   
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase         59.3    8e-08   
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  59.3    8e-08   
gb|AAA21996.1|  glyceraldehyde-3-phosphate dehydrogenase              59.3    8e-08   
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [       58.9    9e-08   
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase         58.9    9e-08   
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+       58.9    1e-07   
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  58.9    1e-07   
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  58.9    1e-07   
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  58.9    1e-07   
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase         58.9    1e-07   
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  58.9    1e-07   
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase              58.9    1e-07   
gb|ADB81486.1|  glyceraldehyde-3-phosphate dehydrogenase              58.5    1e-07   
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    1e-07   
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  58.5    1e-07   
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    1e-07   
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    1e-07   
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  58.5    1e-07   
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    1e-07   
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    1e-07   
ref|WP_017327507.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    1e-07   
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    1e-07   
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    1e-07   
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  58.5    2e-07   
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  58.2    2e-07   
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-07   
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-07   
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  58.2    2e-07   
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-07   
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  58.2    2e-07   
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-07   
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-07   
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-07   
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  57.8    2e-07   
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  57.8    2e-07   
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase         57.8    2e-07   
ref|WP_042341685.1|  glyceraldehyde-3-phosphate dehydrogenase         57.8    2e-07   
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase         57.8    2e-07   
gb|AFY30551.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)      57.8    3e-07   
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase         57.4    3e-07   
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase         57.4    3e-07   
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase         57.4    3e-07   
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase         57.4    3e-07   
ref|WP_015228987.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  57.4    4e-07   
ref|WP_015224818.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  57.4    4e-07   
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  57.4    4e-07   
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase         57.4    4e-07   
ref|WP_025781786.1|  glyceraldehyde-3-phosphate dehydrogenase         57.4    4e-07   
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase         57.0    4e-07   
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  57.0    4e-07   
ref|WP_015156647.1|  MULTISPECIES: glyceraldehyde 3-phosphate deh...  57.0    4e-07   
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase         55.8    1e-06   
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase              55.8    1e-06   
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase              55.8    1e-06   
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  55.8    1e-06   
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase         55.8    1e-06   
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase  55.8    1e-06   
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase         55.5    2e-06   
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  55.5    2e-06   
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase         55.1    2e-06   
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase         55.1    2e-06   
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase         55.1    2e-06   
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase             55.1    2e-06   
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase         55.1    2e-06   
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase         55.1    2e-06   
ref|WP_011057306.1|  glyceraldehyde-3-phosphate dehydrogenase         54.7    3e-06   
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  54.7    3e-06   
ref|WP_041429017.1|  glyceraldehyde-3-phosphate dehydrogenase         54.7    3e-06   
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I      54.7    3e-06   
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...  54.7    3e-06   
pdb|3ZCX|A  Chain A, Structure Of Gapdh From Thermosynechococcus ...  54.7    3e-06   
ref|WP_012164673.1|  glyceraldehyde-3-phosphate dehydrogenase         54.3    4e-06   
ref|WP_010475353.1|  glyceraldehyde-3-phosphate dehydrogenase         54.3    4e-06   
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...  53.9    5e-06   
ref|WP_015125741.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  53.9    5e-06   
emb|CAC81001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  53.5    6e-06   
emb|CAC85938.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  53.5    6e-06   
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  53.5    8e-06   
ref|WP_043714610.1|  glyceraldehyde-3-phosphate dehydrogenase         53.1    8e-06   
emb|CAC81003.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  52.8    1e-05   
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase         52.8    1e-05   
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase         52.8    1e-05   
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase         52.8    1e-05   
ref|WP_006911098.1|  glyceraldehyde-3-phosphate dehydrogenase         52.4    1e-05   
ref|WP_007101108.1|  glyceraldehyde-3-phosphate dehydrogenase         52.4    2e-05   
ref|WP_006172746.1|  glyceraldehyde-3-phosphate dehydrogenase         52.4    2e-05   
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  52.0    2e-05   
emb|CAC41001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  52.0    2e-05   
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  52.0    2e-05   
gb|AAB66887.1|  glyceraldehyde-3-phosphate dehydrogenase              51.6    2e-05   
ref|WP_011934446.1|  glyceraldehyde-3-phosphate dehydrogenase         51.6    3e-05   
gb|KGG26981.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...  51.6    3e-05   
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase         51.6    3e-05   
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase         51.2    4e-05   
gb|AAD10216.1|  glyceraldehyde-3-phosphate dehydrogenase              51.6    4e-05   



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 98/111 (88%), Gaps = 4/111 (4%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRLP+K S     QCFSK+ EVAEFSGLRSSGCVTFSNRE+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLPAKNSHSFPTQCFSKKFEVAEFSGLRSSGCVTFSNRESSFFDVVSAQLTPK  69

Query  228  ATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  70   TTGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  120



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 97/111 (87%), Gaps = 4/111 (4%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRLPSK S     QC SK+ EVAEF+GLRSSGCVTFSN+E+SF DVV+AQLTPK
Sbjct  10   SRIPTTTRLPSKNSHSFPTQCLSKKFEVAEFAGLRSSGCVTFSNKESSFFDVVSAQLTPK  69

Query  228  ATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   TTGLAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  120



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 96/111 (86%), Gaps = 4/111 (4%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRLPSK S     QCFSK+ EVAEFSGLRSSG VTFSNRE+S  DVV+AQLTPK
Sbjct  10   SRIPTSTRLPSKNSQSFPTQCFSKKFEVAEFSGLRSSGYVTFSNRESSLFDVVSAQLTPK  69

Query  228  ATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  70   TTGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  120



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 97/112 (87%), Gaps = 5/112 (4%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIPT TRLPS  ++     QC SK+ EVAEFSGLRSSGCVTFSNRE+SF DVV+AQLTP
Sbjct  10   SRIPTSTRLPSNKNSYSFPTQCLSKKFEVAEFSGLRSSGCVTFSNRESSFFDVVSAQLTP  69

Query  225  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            K TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   KTTGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  121



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 96/112 (86%), Gaps = 5/112 (4%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIPT TRLPS  ++     QC SK+ EVAEFSGLRSSGCVTFSNRE+SF DVV+AQLTP
Sbjct  10   SRIPTSTRLPSNKNSYSFPTQCLSKKFEVAEFSGLRSSGCVTFSNRESSFFDVVSAQLTP  69

Query  225  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            K TG AP KG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   KTTGSAPAKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  121



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   178 bits (451),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 97/111 (87%), Gaps = 4/111 (4%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRLP+K S     QC SK+ EVAEF+GLRSSGCVTFSN+E+SF DVV+AQLTPK
Sbjct  10   SRIPTTTRLPTKNSHSFPTQCLSKKFEVAEFAGLRSSGCVTFSNKESSFFDVVSAQLTPK  69

Query  228  ATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             TG+ PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   TTGSTPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  120



>gb|EYU41183.1| hypothetical protein MIMGU_mgv1a025772mg, partial [Erythranthe 
guttata]
Length=182

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTS---TPQCFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAAQLT  221
            SRIPT TRLPSKT+   + QCFSK++EVAEFSGL+S+GCV F+  +REAS  DVVAAQLT
Sbjct  10   SRIPTSTRLPSKTTHSFSAQCFSKKVEVAEFSGLKSNGCVAFTKNSREASLFDVVAAQLT  69

Query  222  PKATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             K +G  APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS G
Sbjct  70   TKTSGESAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGG  123



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 96/112 (86%), Gaps = 5/112 (4%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRL SK S     QCFSK+ EVAEFSGLRSSGCVTF N+E+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLLSKNSYSFPTQCFSKKFEVAEFSGLRSSGCVTFCNKESSFFDVVSAQLTPK  69

Query  228  ATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             TG+  PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   TTGSAGPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  121



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 96/112 (86%), Gaps = 5/112 (4%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRL SK S     QCFSK+ EVAEFSGLRSSGCVTF N+E+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLLSKNSYSFPTQCFSKKFEVAEFSGLRSSGCVTFCNKESSFFDVVSAQLTPK  69

Query  228  ATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             TG+  PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   TTGSAGPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  121



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 96/112 (86%), Gaps = 5/112 (4%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  227
            SRIPT TRL SK S     QCFSK+ EVAEFSGLRSSGCVTF N+E+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLLSKNSYSFPTQCFSKKFEVAEFSGLRSSGCVTFCNKESSFFDVVSAQLTPK  69

Query  228  ATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             TG+  PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   TTGSAGPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  121



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 96/113 (85%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTS----TPQCFSKRLEVAEFSGLRSSGCVTFS-NREASFSDVVAAQLT  221
            SRIPT TRLPSKTS      QCFSK+LEVAEFSGLRSSGCVTF+ N+EASF D VAAQLT
Sbjct  10   SRIPTSTRLPSKTSHSFPAAQCFSKKLEVAEFSGLRSSGCVTFAKNKEASFFDAVAAQLT  69

Query  222  PKATGAP-VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             K  G+  VKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   LKTAGSTTVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   172 bits (437),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 95/113 (84%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SR+PT TRLPSK S     QCFSK+LEVAEFSGLR  G VTF+   REASF DVVAAQLT
Sbjct  10   SRVPTSTRLPSKASNAFPAQCFSKKLEVAEFSGLRVGGSVTFAKNGREASFFDVVAAQLT  69

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PKA G+ PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   PKAAGSTPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=452

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 96/113 (85%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIP  TRLPSKTS     QCFSKRLEVAEFSGLRSS C+T+++  REAS  D VAAQLT
Sbjct  10   TRIPANTRLPSKTSHSYPTQCFSKRLEVAEFSGLRSSSCLTYASNGREASLFDAVAAQLT  69

Query  222  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            P+ +G APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   PQTSGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 95/113 (84%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST---PQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIP  TRLPSK+S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   TRIPANTRLPSKSSHSFPAQCFSKRLEVGEFSGLRSSSCVTYASNGRETSFFDAVAAQLT  69

Query  222  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  70   PKTTGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  122



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 95/113 (84%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST---PQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIP  TRLPSK+S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   TRIPANTRLPSKSSHSFPAQCFSKRLEVGEFSGLRSSSCVTYASNGRETSFFDAVAAQLT  69

Query  222  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  70   PKTTGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  122



>gb|ABC68431.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
pratensis]
Length=143

 Score =   159 bits (403),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 95/115 (83%), Gaps = 8/115 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSK----TSTP-QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            +RIPT TRLPSK    TS P QC +KRLEVAEFSGLRSSG VT++   +++SF DVV+AQ
Sbjct  10   TRIPTITRLPSKLSLSTSFPSQCSTKRLEVAEFSGLRSSGSVTYAKYVKDSSFFDVVSAQ  69

Query  216  LTPKATGAPVKGV-TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             TPKA G+ V  V TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   FTPKAAGSTVAKVETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  124



>gb|ABC68432.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
dubius]
Length=143

 Score =   159 bits (401),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 95/115 (83%), Gaps = 8/115 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSK----TSTP-QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            +RIPT TRLPSK    TS P QC +KRLEVAEFSGLRSSG VT++   +++SF DVV+AQ
Sbjct  10   TRIPTITRLPSKPSLSTSFPSQCSTKRLEVAEFSGLRSSGSVTYAKYVKDSSFFDVVSAQ  69

Query  216  LTPKATGAPVKGV-TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             TPKA G+ V  V TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   FTPKAAGSTVAKVETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  124



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 92/113 (81%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SR+P  TRLPSK S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   SRVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRSSSCVTYASNGREQSFFDTVAAQLT  69

Query  222  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  G  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   PKTAGPTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 92/113 (81%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SR+P  TRLPSK S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   SRVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRSSSCVTYASNGREQSFFDTVAAQLT  69

Query  222  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  G  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   PKTAGPTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 92/113 (81%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SR+P  TRLPSK S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   SRVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRSSSCVTYASNGREQSFFDTVAAQLT  69

Query  222  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  G  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   PKTAGPTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>ref|XP_003603852.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=283

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>gb|ACJ85309.1| unknown [Medicago truncatula]
Length=229

 Score =   160 bits (404),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 94/113 (83%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC S+RLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASRRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score =   165 bits (417),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 95/114 (83%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPT-RTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  218
            SRIPT  TRLPSK S     Q F+KRLEVAEFSGLRS GCVTF+   RE SF DVVA+QL
Sbjct  10   SRIPTTNTRLPSKASHSFPTQFFAKRLEVAEFSGLRSGGCVTFAKNAREPSFFDVVASQL  69

Query  219  TPKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            TPKA G APV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  70   TPKAGGPAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  123



>gb|KJB14201.1| hypothetical protein B456_002G114000 [Gossypium raimondii]
Length=454

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 93/115 (81%), Gaps = 8/115 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TRLPSKT+     QC SKRLEV EFSGLRSS CVTF+   R+ASF DV+AAQL+
Sbjct  10   SRIPANTRLPSKTTHSFPTQCPSKRLEVTEFSGLRSSSCVTFAKNVRDASFFDVLAAQLS  69

Query  222  PKATGAP---VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  G P   V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  70   PKGVGVPSTSVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGG  124



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 94/113 (83%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLT  221
            +RIPT TR PSKTS     QC SKRLEV EFSGL+S+ C+++  S R++SF DVVAAQLT
Sbjct  6    TRIPTNTRFPSKTSHSFPSQCASKRLEVGEFSGLKSTSCISYVHSARDSSFYDVVAAQLT  65

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             KA G+  VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  66   SKANGSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  118



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 94/113 (83%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLT  221
            +RIPT TR PSKTS     QC SKRLEV EFSGL+S+ C+++  S R++SF DVVAAQLT
Sbjct  10   TRIPTNTRFPSKTSHSFPSQCASKRLEVGEFSGLKSTSCISYVHSARDSSFYDVVAAQLT  69

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             KA G+  VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   SKANGSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 94/114 (82%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT T+ PSK S     QC SKRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPTNTKFPSKASHSFPTQCASKRLEVTEFSGLRSTSCVTYANDARESSFFDLVASQLT  69

Query  222  PKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  G+  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  70   PKTNGSSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGG  123



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 93/115 (81%), Gaps = 8/115 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            S+IP  TRLPSKT+     QC SKRLEV EFSGLRSS CVTF+   R+ SF DV+AAQLT
Sbjct  10   SKIPANTRLPSKTTHSFPTQCSSKRLEVTEFSGLRSSSCVTFAKNVRDTSFFDVLAAQLT  69

Query  222  PKATGAP---VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK+ G P   V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  70   PKSEGVPSASVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGG  124



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score =   162 bits (410),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 93/115 (81%), Gaps = 8/115 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT T+ PSK S     QC SKRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPTNTKFPSKASHSFPTQCASKRLEVTEFSGLRSTSCVTYANDARESSFFDLVASQLT  69

Query  222  PKATGA---PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK T     PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  70   PKQTNGSSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGG  124



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   162 bits (410),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 94/114 (82%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPT-RTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  218
            SRIPT  TR PSK S     Q F+KRLEVAEFSGLRS GCVTF+   RE SF DVVA+QL
Sbjct  10   SRIPTTNTRHPSKASHSFPTQFFAKRLEVAEFSGLRSGGCVTFAKNAREPSFFDVVASQL  69

Query  219  TPKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            TPKA G APV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  70   TPKAGGPAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  123



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 6/112 (5%)
 Frame = +3

Query  60   RIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTP  224
            ++P  TRLPSK S     QCFSKRLEV EFSGLR S C+T+++  R+ SF + VAAQLTP
Sbjct  11   KVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRLSSCMTYASNGRDQSFFEAVAAQLTP  70

Query  225  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            K  G APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  71   KTAGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>gb|KJB57937.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=278

 Score =   157 bits (398),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 91/116 (78%), Gaps = 9/116 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  216  LTPKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS G
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGG  125



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 93/113 (82%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIP+ TR PSK S     QC  KRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPSNTRFPSKASHSFPTQCALKRLEVTEFSGLRSTSCVTYANSARESSFFDLVASQLT  69

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  70   PKTNGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGG  122



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 93/113 (82%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIP+ TR PSK S     QC  KRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPSNTRFPSKASHSFPTQCALKRLEVTEFSGLRSTSCVTYANSARESSFFDLVASQLT  69

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  70   PKTNGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGG  122



>ref|XP_010094540.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
 gb|EXB56294.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
Length=1333

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 96/114 (84%), Gaps = 8/114 (7%)
 Frame = +3

Query  60   RIPTRTRLPSKT----STP-QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  218
            RIPT TRLPS +    S P QCFSK+LEVAEFSGLRSS CVT++   REASF DVVAAQL
Sbjct  12   RIPTNTRLPSNSKPSHSFPTQCFSKKLEVAEFSGLRSSSCVTYAKNAREASFFDVVAAQL  71

Query  219  TPKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            TP+  G APVKG TVAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI+VNDS G
Sbjct  72   TPRTAGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRQNSPLDVIIVNDSGG  125



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 92/113 (81%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTS---TPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TRLPS++S     QCFSKRLEVA+FSGLRSS  VTF    RE+SF DVVA+QL 
Sbjct  10   SRIPANTRLPSRSSHSHATQCFSKRLEVADFSGLRSSTSVTFGKNARESSFFDVVASQLA  69

Query  222  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK A   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   PKVAASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  122



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 6/112 (5%)
 Frame = +3

Query  60   RIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTP  224
            ++P  TRLPSK S     QCFSKRLEV EFSGLR S C+T+++  R+ SF + VAAQLTP
Sbjct  11   KVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRLSSCMTYASNGRDQSFFEAVAAQLTP  70

Query  225  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            K  G APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  71   KTAGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 6/112 (5%)
 Frame = +3

Query  60   RIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTP  224
            ++P  TRLPSK S     QCFSKRLEV EFSGLR S C+T+++  R+ SF + VAAQLTP
Sbjct  11   KVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRLSSCMTYASNGRDQSFFEAVAAQLTP  70

Query  225  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            K  G APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  71   KTAGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 93/114 (82%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT T+ PSK S     QC SKRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPTNTKFPSKASHSFPTQCASKRLEVTEFSGLRSTSCVTYANDARESSFFDLVASQLT  69

Query  222  PKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  G+  PV+G TVAKLKVAINGFGRIG NFLRCWHGRKDSPLEV+VVNDS G
Sbjct  70   PKTNGSSTPVRGETVAKLKVAINGFGRIGGNFLRCWHGRKDSPLEVVVVNDSGG  123



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 93/113 (82%), Gaps = 7/113 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP-----QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLT  221
            +RIP  TRLP+K +       QC  K+L+VA+FSGLRSS CVTF+ REASF DV+AAQLT
Sbjct  10   TRIPASTRLPTKAAQQHSFPTQCSFKKLDVADFSGLRSSNCVTFT-REASFHDVIAAQLT  68

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             K TGA PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  69   TKTTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  121



>gb|KJB57939.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=320

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 91/116 (78%), Gaps = 9/116 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  216  LTPKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS G
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGG  125



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 92/114 (81%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIP+ TR PSK S     QC  KRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPSNTRFPSKASHSFPTQCALKRLEVTEFSGLRSTSCVTYANSARESSFFDLVASQLT  69

Query  222  PKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK T    PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  70   PKQTNGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGG  123



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 91/116 (78%), Gaps = 9/116 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            SRIP  TRLPSK      S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIPATTRLPSKATHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFYDVVAAQ  69

Query  216  LTPKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS G
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGG  125



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score =   160 bits (404),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 92/113 (81%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT T  PSK S     QC SKRLEV +FSGLRS+ CVT+++  RE+SF D VAAQLT
Sbjct  10   TRIPTNTSFPSKASHSFPTQCTSKRLEVNDFSGLRSTSCVTYASNARESSFFDTVAAQLT  69

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  70   PKTNGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  122



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 92/114 (81%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST---PQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TR PSK S     QC SKRLEVAEF GL+S+ C+T++N  R++SFSDVVAAQLT
Sbjct  83   TRIPTNTRFPSKASHNFPTQCASKRLEVAEFCGLKSTSCITYANNARDSSFSDVVAAQLT  142

Query  222  PKAT--GAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             KA     PV+G TVAKLKVAINGFGRIGRNFLRCWH RKDSPLEVIVVNDS G
Sbjct  143  SKAAVGSIPVRGETVAKLKVAINGFGRIGRNFLRCWHERKDSPLEVIVVNDSGG  196



>gb|KJB57938.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=399

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 91/116 (78%), Gaps = 9/116 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  216  LTPKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS G
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGG  125



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 82/91 (90%), Gaps = 1/91 (1%)
 Frame = +3

Query  108  CFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKAT-GAPVKGVTVAKLKVAIN  284
            C SK+ EVAEF+GLRSSGCVTFSN+E+SF DVV+AQLTPK T   PVKG TVAKLKVAIN
Sbjct  1    CLSKKFEVAEFAGLRSSGCVTFSNKESSFFDVVSAQLTPKTTRSTPVKGETVAKLKVAIN  60

Query  285  GFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  61   GFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  91



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 91/118 (77%), Gaps = 11/118 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTS------TPQCFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAA  212
            SRIP  TRL SKTS      T   FSKRLEV E+SGLRSSGCVTF+  +RE SF D  A 
Sbjct  11   SRIPANTRLVSKTSHYNSFPTQYSFSKRLEVDEYSGLRSSGCVTFATNSRETSFFDAAAV  70

Query  213  QLTPK---ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            QLTPK   A   PVKG TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDSAG
Sbjct  71   QLTPKRQNAGSTPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSAG  128



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 91/116 (78%), Gaps = 9/116 (8%)
 Frame = +3

Query  57   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  215
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  216  LTPKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS G
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGG  125



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 91/113 (81%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSK++     QC SKRLEVAEFSGLR+S C+T++    EASF D+VAAQ+ 
Sbjct  10   SRIPASTRLPSKSAHSFPTQCSSKRLEVAEFSGLRASSCMTYAKNASEASFFDLVAAQMA  69

Query  222  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK AT  P +  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  70   PKVATSTPTRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  122



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 91/113 (81%), Gaps = 7/113 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP-----QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLT  221
            SRIP  TRL SK S       QC  KRL+VA+FSGLRSS  VTF+ REASF DV+AAQLT
Sbjct  10   SRIPASTRLASKASQQYSFLTQCSFKRLDVADFSGLRSSNSVTFT-REASFHDVIAAQLT  68

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             K TGA PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  69   TKPTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  121



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   157 bits (396),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 91/113 (81%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSKT+     QC SKRLEVAEFSGLR++  V+++    E SF DVVAAQ+T
Sbjct  10   SRIPASTRLPSKTTYSFPSQCSSKRLEVAEFSGLRATSHVSYAKNATEGSFFDVVAAQMT  69

Query  222  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK A   P++  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG
Sbjct  70   PKVAASTPIRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  122



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 90/113 (80%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSKT+     QC SKRLEVAEFSGLR+S CVT++    E SF D+VA+QL 
Sbjct  10   SRIPANTRLPSKTNHSFPTQCSSKRLEVAEFSGLRASSCVTYAKNACEGSFFDMVASQLA  69

Query  222  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK A   PV+  TV+KLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  70   PKVAVSTPVRAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  122



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 93/114 (82%), Gaps = 8/114 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTS----TPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  218
            SRIP+ TR  SK +    TP  F+KRLEVAEFSGLRSS CVTF+   REASFSDV+AAQL
Sbjct  10   SRIPSNTRFHSKATHSHPTPS-FTKRLEVAEFSGLRSSTCVTFATQGREASFSDVLAAQL  68

Query  219  TPKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
              K  GA PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+V+VVNDS G
Sbjct  69   ASKTVGASPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVVVVNDSGG  122



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 90/113 (80%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSKT+     QC SKRLEVAEFSGLR+S CVT++    E SF D+VA+QL 
Sbjct  10   SRIPANTRLPSKTNHSFPTQCSSKRLEVAEFSGLRASSCVTYAKNACEGSFFDMVASQLA  69

Query  222  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK A   PV+  TV+KLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  70   PKVAVSTPVRAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  122



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 94/113 (83%), Gaps = 7/113 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TRLPSKTS     +C +KRL+VAEF+GLRS+  ++F N  RE SF DVVAAQLT
Sbjct  10   TRIPTNTRLPSKTSYSFPTRCSAKRLDVAEFNGLRSAS-LSFPNNGREGSFFDVVAAQLT  68

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  69   PKVVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  121



>ref|XP_006383782.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61579.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=308

 Score =   151 bits (381),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 87/113 (77%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSK +     Q   KRLEVAEFSGLR+S CVT++    E SF DVVA+QL 
Sbjct  10   SRIPANTRLPSKINHSFPTQSSLKRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLA  69

Query  222  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK A   PV+  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  70   PKVAVSTPVRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  122



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 91/112 (81%), Gaps = 5/112 (4%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN-REASFSDVVAAQLTP  224
            +RIPT TRLPSKTS     +C SKRL VAEF+GLRS+   + +N RE SF D VAAQLTP
Sbjct  10   TRIPTNTRLPSKTSYSFPTRCSSKRLNVAEFNGLRSASLSSSNNGREGSFFDAVAAQLTP  69

Query  225  KATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            KA  + PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   KAVASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  121



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 92/113 (81%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  T LPSK++     QC +KRLEVAEFSGLRSS  VTF+    EASF DVVAAQLT
Sbjct  10   SRIPASTTLPSKSTHSFPTQCSTKRLEVAEFSGLRSSSRVTFARNVGEASFFDVVAAQLT  69

Query  222  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGR++SPL+VIVVNDS G
Sbjct  70   PKTGGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRENSPLDVIVVNDSGG  122



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 92/114 (81%), Gaps = 8/114 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTS----TPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  218
            SRIP+ TR  SK +    TP  F+KRLEVAEF GLRSS CVTF+   REASFSDV+AAQL
Sbjct  10   SRIPSNTRFHSKATHVPPTPS-FTKRLEVAEFLGLRSSTCVTFATQGREASFSDVLAAQL  68

Query  219  TPKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
              K  GA PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+V+VVNDS G
Sbjct  69   ASKTVGASPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVVVVNDSGG  122



>ref|XP_009382077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 88/113 (78%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQ---CFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL-  218
            SRIP+ T   SK +      CFSKRLEVAEFSGLRSS CVTF+   R+ASFSDV+AAQL 
Sbjct  10   SRIPSNTWFHSKAAHSHPTSCFSKRLEVAEFSGLRSSACVTFATNGRDASFSDVLAAQLS  69

Query  219  TPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            T  A    VKG TVAKLKVAINGFGRIGRNFLRCWHGR DSPLEV+VVNDS G
Sbjct  70   TETARAVLVKGETVAKLKVAINGFGRIGRNFLRCWHGRNDSPLEVVVVNDSGG  122



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 89/113 (79%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKT--STP-QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSK   S P Q  SKRLEVAEFSGLR+S CVT++    E SF DVVA+QL 
Sbjct  10   SRIPATTRLPSKINRSFPTQSSSKRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLA  69

Query  222  PKA-TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PKA    PV+  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  70   PKAAVSTPVRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  122



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 90/110 (82%), Gaps = 5/110 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTPK-  227
            SRIP+ TR   K +T   FSKRLEVAEFSGLRSS  +TF+   REASFSDV+A+QL+ K 
Sbjct  10   SRIPSNTRFHCKANT--SFSKRLEVAEFSGLRSSTSLTFATHGREASFSDVLASQLSTKT  67

Query  228  ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            A   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  68   ARAVPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVLVVNDSGG  117



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 88/111 (79%), Gaps = 6/111 (5%)
 Frame = +3

Query  63   IPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLTPK  227
            IP  TRLPSKT+     QC SKRLEVAEFSGLR+S CVT++    E SF D+VA+QL PK
Sbjct  34   IPANTRLPSKTNHSFPTQCSSKRLEVAEFSGLRASSCVTYAKNASEGSFFDMVASQLAPK  93

Query  228  -ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             A   PV+  TV+KLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  94   VAVSTPVRAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  144



>gb|KDO85181.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85182.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=269

 Score =   148 bits (373),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  123



>gb|KDO85183.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85184.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=275

 Score =   148 bits (373),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  123



>gb|KDO85179.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85180.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=248

 Score =   147 bits (371),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  123



>gb|KDO85177.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85178.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=304

 Score =   148 bits (374),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  123



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   151 bits (382),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQL  218
            SRIP   R  SK++      QC SKR+E AEF+GLRSSGC+ +S    ++SF D VA+QL
Sbjct  10   SRIPVNPRFHSKSNVNSFHAQCSSKRVEFAEFAGLRSSGCMVYSKNGGDSSFFDAVASQL  69

Query  219  TPKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            TPKA  A PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  70   TPKAVAAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGG  123



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 92/114 (81%), Gaps = 8/114 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            +RIPT TRLPSKTS     +C +KRL+VAEF+GLRS+  ++F N  RE SF DVVAAQLT
Sbjct  10   TRIPTNTRLPSKTSYSFPTRCSAKRLDVAEFNGLRSAS-LSFPNNGREGSFFDVVAAQLT  68

Query  222  PKAT--GAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK      PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  69   PKQVVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  122



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 90/112 (80%), Gaps = 7/112 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTPK-  227
            SRIP+ TR   K +T   FSKRLEVAEFSGLRSS  +TF+   REASFSDV+A+QL+ K 
Sbjct  10   SRIPSNTRFHCKANT--SFSKRLEVAEFSGLRSSTSLTFATHGREASFSDVLASQLSTKL  67

Query  228  --ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
              A   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  68   QTARAVPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVLVVNDSGG  119



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 87/113 (77%), Gaps = 6/113 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  221
            SRIP  TRLPSK +     Q   KRLEVAEFSGLR+S CVT++    E SF DVVA+QL 
Sbjct  10   SRIPANTRLPSKINHSFPTQSSLKRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLA  69

Query  222  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK A   PV+  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  70   PKVAVSTPVRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  122



>gb|KDO85176.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=329

 Score =   146 bits (369),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  123



>ref|XP_006435407.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48647.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=329

 Score =   146 bits (369),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  123



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score =   148 bits (373),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  123



>gb|KDO85175.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=309

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  123



>gb|ADH43199.1| glyceraldehyde-3-phosphate dehydrogenase [Vicia sativa]
Length=380

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 82/94 (87%), Gaps = 3/94 (3%)
 Frame = +3

Query  105  QCFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAAQLTPKATGA-PVKGVTVAKLKV  275
            QC SKRLEV EFSGL+S+ CVT++   RE+SF DVVAAQL+ K TG+ PV+G TVAKLKV
Sbjct  7    QCGSKRLEVPEFSGLKSTSCVTYAINARESSFYDVVAAQLSTKRTGSTPVRGETVAKLKV  66

Query  276  AINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            AINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  67   AINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  100



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  123



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  221
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  222  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS G
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  123



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 87/113 (77%), Gaps = 10/113 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP   RL SK++      QC SKRLEVAEFSGLR    V+ +  EASF D +AAQ+TP
Sbjct  10   SRIPVNPRLQSKSAIHSFPAQCSSKRLEVAEFSGLR----VSNNGGEASFFDAIAAQITP  65

Query  225  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            KA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  66   KAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  118



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 79/94 (84%), Gaps = 3/94 (3%)
 Frame = +3

Query  105  QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLTPKATG-APVKGVTVAKLKV  275
            QCFSKRLEVAEFSGLR+  CVT++    E SF D VAAQLTPK +  AP KG TVAKLKV
Sbjct  30   QCFSKRLEVAEFSGLRAGSCVTYAKNAGEGSFFDAVAAQLTPKTSAPAPAKGETVAKLKV  89

Query  276  AINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            AINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS G
Sbjct  90   AINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGG  123



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 88/113 (78%), Gaps = 10/113 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP + RL SK++      QC SKRLEVA FSGLR    V+ +  EASF D +AAQ+TP
Sbjct  10   SRIPVKPRLQSKSAIHSFPAQCSSKRLEVAAFSGLR----VSSNGGEASFFDAIAAQITP  65

Query  225  KATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            KA G  +PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS G
Sbjct  66   KAVGTSSPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGG  118



>ref|NP_174996.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
 sp|P25857.2|G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPB, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51517.1|AC068324_5 glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAA32795.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAK62594.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAK64065.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL85133.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM19948.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAM98232.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72278.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 dbj|BAF02115.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE31933.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
Length=447

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 84/113 (74%), Gaps = 10/113 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP   RL SK++      QC SKRLEVAEFSGLR S        EASF D VAAQ+ P
Sbjct  10   SRIPVTQRLQSKSAIHSFPAQCSSKRLEVAEFSGLRMSSI----GGEASFFDAVAAQIIP  65

Query  225  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            KA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS G
Sbjct  66   KAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGG  118



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 85/113 (75%), Gaps = 10/113 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP   RL SK++      QC SKRLEVAEFSGLR S     +  EASF D VAAQ+T 
Sbjct  10   SRIPVAQRLQSKSAVHSFPAQCSSKRLEVAEFSGLRMSS----NGGEASFFDAVAAQITA  65

Query  225  KATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            KA  A  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS G
Sbjct  66   KAVTASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGG  118



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 86/113 (76%), Gaps = 10/113 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP   RL SK++      QC SKRLEVAEFSGLR S     ++ EASF D VA+Q+T 
Sbjct  10   SRIPVAQRLQSKSAIHSFPAQCSSKRLEVAEFSGLRMSS----NSGEASFFDAVASQITT  65

Query  225  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            KA  T  P++G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS G
Sbjct  66   KAVTTSTPIRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGG  118



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = +3

Query  75   TRLPSKTS-TPQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKG  251
            +R+P+  + T QCFSKR+EV +FSGL+SS  ++F+ +E SF D VA +L   ++  PVKG
Sbjct  9    SRIPATPAFTSQCFSKRVEVGDFSGLKSSRGLSFAAKEVSFFDAVAPKLAGPSSSPPVKG  68

Query  252  VTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  69   ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGG  110



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 83/113 (73%), Gaps = 10/113 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP   RL SK++      Q  SKRLEVAEFSGLR S        EASF D VAAQ+ P
Sbjct  10   SRIPVTQRLQSKSAIHSFPAQWSSKRLEVAEFSGLRMSSI----GGEASFFDAVAAQIIP  65

Query  225  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            KA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS G
Sbjct  66   KAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGG  118



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 85/113 (75%), Gaps = 10/113 (9%)
 Frame = +3

Query  57   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  224
            SRIP   RL SK++      QC SKRL+VAEFSGLR+S     ++ +ASF D + AQ+  
Sbjct  10   SRIPANPRLQSKSAIHSFPAQCSSKRLQVAEFSGLRASN----NSGDASFFDAIVAQIAS  65

Query  225  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            KA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS G
Sbjct  66   KAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGG  118



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = +3

Query  117  KRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLTPK-ATGAPVKGVTVAKLKVAING  287
            +RLEVAEFSGLR+S CVT++    E SF DVVA+QL PK A   PV+  TVAKLKVAING
Sbjct  2    QRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLAPKVAVSTPVRAETVAKLKVAING  61

Query  288  FGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            FGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  62   FGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  91



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 83/111 (75%), Gaps = 8/111 (7%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSK--RLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKA  230
            SRIP   R+ SK++     ++  RLEVA+FSGLR S     +  EASF D VAAQ+T KA
Sbjct  10   SRIPVTQRVQSKSAIHSFPAQXPRLEVADFSGLRMSS----NGGEASFFDAVAAQITAKA  65

Query  231  TGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
              A  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS G
Sbjct  66   VTASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGG  116



>gb|ABF93790.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
Length=207

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 80/109 (73%), Gaps = 6/109 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            SRIP   RL SK ++ Q    R++ A+FSGLR   C ++ + REASFSDV+ +QL  +AT
Sbjct  10   SRIPATARLHSKAASKQ----RVDFADFSGLRPGSCSISHAAREASFSDVLGSQLVARAT  65

Query  234  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            G   V+    AKLKVAINGFGRIGRNFLRCWH R++SPLEV+VVNDS G
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHERENSPLEVVVVNDSGG  114



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 81/109 (74%), Gaps = 6/109 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            SRIPT  RL S+ ++ Q    R++ A+FSGLR   C V+ + REASF DV+ AQL  KAT
Sbjct  10   SRIPTSARLNSRAASRQ----RVDFADFSGLRPGSCSVSTAAREASFYDVLGAQLVAKAT  65

Query  234  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR+DSPL+V+VVNDS G
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPLDVVVVNDSGG  114



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 82/109 (75%), Gaps = 6/109 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            +RIPT  RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPTSARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  234  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIV+NDS G
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGG  114



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 82/109 (75%), Gaps = 6/109 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            +RIPT  RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPTSARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  234  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIV+NDS G
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGG  114



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 81/109 (74%), Gaps = 6/109 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            SRIP   RL S+ ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ +QL  +AT
Sbjct  10   SRIPATARLHSRAASKQ----RVDFADFSGLRPGSCSVSHAAREASFSDVLGSQLVARAT  65

Query  234  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIVVNDS G
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVVNDSGG  114



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 82/110 (75%), Gaps = 3/110 (3%)
 Frame = +3

Query  57   SRIPTRTRLPSKT-STPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKA  230
            SRIP   RL S+  ++ +   +RL+ A+FSGLR   C V+ + REASFSDV+ AQL  KA
Sbjct  10   SRIPAGARLHSRAPASSRHGVQRLDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVAKA  69

Query  231  TGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            TG   V+    AKLKVAINGFGRIGRNFLRCWHGR+DSP++V+VVNDS G
Sbjct  70   TGENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPIDVVVVNDSGG  119



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 81/109 (74%), Gaps = 6/109 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            +RIP   RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPASARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  234  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIV+NDS G
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGG  114



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 81/109 (74%), Gaps = 6/109 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            +RIP   RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPASARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  234  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIV+NDS G
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGG  114



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 80/109 (73%), Gaps = 6/109 (6%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  233
            SRIP   RL SK ++ Q    R++ A+FSGLR   C ++ + REASFSDV+ +QL  +AT
Sbjct  10   SRIPATARLHSKAASKQ----RVDFADFSGLRPGSCSISHAAREASFSDVLGSQLVARAT  65

Query  234  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            G   V+    AKLKVAINGFGRIGRNFLRCWH R++SPLEV+VVNDS G
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHERENSPLEVVVVNDSGG  114



>gb|ABR16095.1| unknown [Picea sitchensis]
Length=229

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 6/93 (6%)
 Frame = +3

Query  117  KRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVTVAKLKVA  278
            KR+E++EF+GL+S SGC+T+    RE + +  D +A+Q+  KA     +KG TVAKLKVA
Sbjct  38   KRVEISEFAGLKSTSGCITYGRQARENNLNLFDALASQVVAKAGNSGAIKGETVAKLKVA  97

Query  279  INGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            INGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  98   INGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGG  130



>gb|ADE06487.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
dubius]
Length=90

 Score =   111 bits (278),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = +3

Query  180  REASFSDVVAAQLTPKATGAPVKGV-TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  356
            +++SF DVV+AQ TPKA G+ V  V TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI
Sbjct  5    KDSSFFDVVSAQFTPKAAGSTVAKVETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  64

Query  357  VVNDSAG  377
            VVNDS G
Sbjct  65   VVNDSGG  71



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 79/110 (72%), Gaps = 5/110 (5%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVT--FSNREASFSDVVAAQLTPKA  230
            SRIPT      K ++ +   +RL++A+FSGLR   C     + REASFSDV+ AQL  +A
Sbjct  10   SRIPTGRLQHGKAASSKL--QRLDLADFSGLRPGSCSVSVAATREASFSDVLGAQLVARA  67

Query  231  TGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            +G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEV+V+NDS G
Sbjct  68   SGENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVVVINDSGG  117



>gb|ACN40006.1| unknown [Picea sitchensis]
Length=460

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 77/100 (77%), Gaps = 7/100 (7%)
 Frame = +3

Query  96   STPQCFSKRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVT  257
            S P  F KR+E++EF+GL+S SGC+T+    RE + +  D +A+Q+  KA     +KG T
Sbjct  32   SLPSTF-KRVEISEFAGLKSTSGCITYGRQARENNLNLFDALASQVVAKAGNSGAIKGET  90

Query  258  VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  91   VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGG  130



>gb|ABK24645.1| unknown [Picea sitchensis]
Length=460

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 77/100 (77%), Gaps = 7/100 (7%)
 Frame = +3

Query  96   STPQCFSKRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVT  257
            S P  F KR+E++EF+GL+S SGC+T+    RE + +  D +A+Q+  KA     +KG T
Sbjct  32   SLPSTF-KRVEISEFAGLKSTSGCITYGRQARENNLNLFDALASQVVAKAGNSGAIKGET  90

Query  258  VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  91   VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGG  130



>gb|ADE06488.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
porrifolius]
Length=86

 Score =   111 bits (277),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = +3

Query  180  REASFSDVVAAQLTPKATGAPVKGV-TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  356
            +++SF DVV+AQ TPKA G+ V  V TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI
Sbjct  1    KDSSFFDVVSAQFTPKAAGSTVAKVETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  60

Query  357  VVNDSAG  377
            VVNDS G
Sbjct  61   VVNDSGG  67



>gb|ACN40526.1| unknown [Picea sitchensis]
Length=460

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 6/93 (6%)
 Frame = +3

Query  117  KRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVTVAKLKVA  278
            KR+E++EF+GL+S SGC+T+    RE + +  D +A+Q+  KA     +KG TVAKLKVA
Sbjct  38   KRVEISEFAGLKSTSGCITYGRQARENNLNLFDALASQVVAKAGNSGAIKGETVAKLKVA  97

Query  279  INGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            INGFGRIGRNFLRCWHGRKDSPLEV+VVNDS G
Sbjct  98   INGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGG  130



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   115 bits (288),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  129  VAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  308
            +AEFSG++S  CVTF  R    S +VAAQ    A+    + VT AK+KVAINGFGRIGRN
Sbjct  19   LAEFSGMKSVNCVTFEKRSDDLSTIVAAQTVVAASSGASRAVTEAKIKVAINGFGRIGRN  78

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            F+RCWHGRKDSPL+V+V+ND+ G
Sbjct  79   FIRCWHGRKDSPLDVVVINDTGG  101



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 2/67 (3%)
 Frame = +3

Query  183  EASFSDVVAAQLTPKATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  356
            EASF D +AAQ+TPKA G  +PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+
Sbjct  6    EASFFDAIAAQITPKAVGTPSPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVV  65

Query  357  VVNDSAG  377
            V+NDS G
Sbjct  66   VLNDSGG  72



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  RLEVAEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGR  296
            ++E+AEFSGL++S  + F+ R +A+  D V  Q++   +G  +KG T AKLKVAINGFGR
Sbjct  15   KMELAEFSGLKASSSMPFAARNDATLFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGR  74

Query  297  IGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            IGRNFLRCWHGRKDSPL+VI VNDS G
Sbjct  75   IGRNFLRCWHGRKDSPLDVIAVNDSGG  101



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   112 bits (280),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  RLEVAEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGR  296
            ++E+AEFSGL++S  + F+ R +A+  D V  Q++   +G  +KG T AKLKVAINGFGR
Sbjct  15   KMELAEFSGLKASSSMPFAARNDATLFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGR  74

Query  297  IGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            IGRNFLRCWHGRKDSPL+VI VNDS G
Sbjct  75   IGRNFLRCWHGRKDSPLDVIAVNDSGG  101



>gb|AAD10210.1| glyceraldehyde 3-phosphate dehydrogenase B subunit [Arabidopsis 
thaliana]
Length=402

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 2/67 (3%)
 Frame = +3

Query  183  EASFSDVVAAQLTPKA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  356
            EASF D VAAQ+ PKA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+
Sbjct  7    EASFFDAVAAQIIPKAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVV  66

Query  357  VVNDSAG  377
            V+NDS G
Sbjct  67   VLNDSGG  73



>ref|XP_010478985.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X1 [Camelina sativa]
Length=402

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 2/67 (3%)
 Frame = +3

Query  183  EASFSDVVAAQLTPKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  356
            EASF D VAAQ+T KA  A  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+
Sbjct  7    EASFFDAVAAQITAKAVTASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVV  66

Query  357  VVNDSAG  377
            V+NDS G
Sbjct  67   VLNDSGG  73



>emb|CBI21236.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 67/87 (77%), Gaps = 6/87 (7%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGR  296
            AEFSGLR SS C++F NR+ S  F  VVA Q +     +G   KGVT AKLKVAINGFGR
Sbjct  21   AEFSGLRNSSACLSF-NRKTSDDFLSVVAFQTSAVGSNSGGYRKGVTEAKLKVAINGFGR  79

Query  297  IGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            IGRNFLRCWHGRKDSPL+VIVVND+ G
Sbjct  80   IGRNFLRCWHGRKDSPLDVIVVNDTGG  106



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +3

Query  108  CFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAING  287
            C  K    +EFSG++S+  VTF  R    + +V AQ    A+    + VT AK+KVAING
Sbjct  11   CAVKASGFSEFSGIKSTNSVTFGKRHDDLTTIVTAQSAVAASSGAKRAVTEAKIKVAING  70

Query  288  FGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            FGRIGRNF+RCWHGRKDSPL+V+V+ND+ G
Sbjct  71   FGRIGRNFVRCWHGRKDSPLDVVVINDTGG  100



>gb|ACN41006.1| unknown [Picea sitchensis]
Length=471

 Score =   107 bits (267),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 56/93 (60%), Positives = 69/93 (74%), Gaps = 6/93 (6%)
 Frame = +3

Query  117  KRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVTVAKLKVA  278
            K +E++EF+GL+S SGC+T+    RE+S    D +A+Q+  KA     VKG TVAK+KVA
Sbjct  38   KSVEISEFAGLKSTSGCITYGRQVRESSLGLFDALASQVIAKAGNSGAVKGETVAKMKVA  97

Query  279  INGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            INGFGRIGRNFLRCWHG K SPLEV+ VND  G
Sbjct  98   INGFGRIGRNFLRCWHGHKRSPLEVVAVNDIIG  130



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 68/86 (79%), Gaps = 5/86 (6%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKA-TGAPVKGVTVAKLKVAINGFGRI  299
            AEFSGLR SS C++F NR+ S  F  VVA Q +  + +G   KGVT AKLKVAINGFGRI
Sbjct  21   AEFSGLRNSSACLSF-NRKTSDDFLSVVAFQTSVGSNSGGYRKGVTEAKLKVAINGFGRI  79

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGRKDSPL+VIVVND+ G
Sbjct  80   GRNFLRCWHGRKDSPLDVIVVNDTGG  105



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 67/87 (77%), Gaps = 6/87 (7%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGR  296
            AEFSGLR SS C++F NR+ S  F  VVA Q +     +G   KGVT AKLKVAINGFGR
Sbjct  21   AEFSGLRNSSACLSF-NRKTSDDFLSVVAFQTSAVGSNSGGYRKGVTEAKLKVAINGFGR  79

Query  297  IGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            IGRNFLRCWHGRKDSPL+VIVVND+ G
Sbjct  80   IGRNFLRCWHGRKDSPLDVIVVNDTGG  106



>emb|CAN78872.1| hypothetical protein VITISV_021726 [Vitis vinifera]
Length=404

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 67/87 (77%), Gaps = 6/87 (7%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGR  296
            AEFSGLR SS C++F NR+ S  F  VVA Q +     +G   KGVT AKLKVAINGFGR
Sbjct  21   AEFSGLRNSSACLSF-NRKTSDDFLSVVAFQTSAVGSNSGGYRKGVTEAKLKVAINGFGR  79

Query  297  IGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            IGRNFLRCWHGRKDSPL+VIVVND+ G
Sbjct  80   IGRNFLRCWHGRKDSPLDVIVVNDTGG  106



>gb|ABK00053.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=393

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 66/91 (73%), Gaps = 4/91 (4%)
 Frame = +3

Query  117  KRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLTPKA-TGAPVKGVTVAKLKVAING  287
            KR  + EFSGL++S  VTF  S+ E  F D VA+Q+  KA     +KG T AKL+VAING
Sbjct  9    KRSSLGEFSGLKASSAVTFGKSSSENGFFDAVASQVAVKAGASGAIKGETSAKLRVAING  68

Query  288  FGRIGRNFLRCWHGRKD-SPLEVIVVNDSAG  377
            FGRIGRNFLRCWHGR D SPLEV+ VNDS G
Sbjct  69   FGRIGRNFLRCWHGRGDESPLEVVAVNDSGG  99



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 66/91 (73%), Gaps = 4/91 (4%)
 Frame = +3

Query  117  KRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLTPKA-TGAPVKGVTVAKLKVAING  287
            KR  + EFSGL++S  VTF  S+ E  F D VA+Q+  KA     +KG T AKL+VAING
Sbjct  38   KRSSLGEFSGLKASSAVTFGKSSSENGFFDAVASQVAVKAGASGAIKGETSAKLRVAING  97

Query  288  FGRIGRNFLRCWHGRKD-SPLEVIVVNDSAG  377
            FGRIGRNFLRCWHGR D SPLEV+ VNDS G
Sbjct  98   FGRIGRNFLRCWHGRGDESPLEVVAVNDSGG  128



>gb|AAF03099.1|AF162198_1 NADP-dependent glyceraldehyde phosphate dehydrogenase [Lactuca 
sativa]
Length=113

 Score = 99.8 bits (247),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  305
            +EF+GLRSS       R+ S  F+ +VA Q T        KGVT AKLKVAINGFGRIGR
Sbjct  21   SEFAGLRSSSASLPFGRKGSDDFASMVAFQTTLVGGSKTPKGVTEAKLKVAINGFGRIGR  80

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   NFLRCWHGRKDSPLDVIAINDTGG  104



>gb|KHG29734.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=360

 Score =   103 bits (258),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKA--TGAPVKGVTVAKLKVAINGFGRIG  302
            AEFSGLR+S  +TF+ + +  F  V+A Q +      G   KGV  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRNSASLTFARKTSDDFQSVIAFQTSALGINNGGYQKGVVEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGG  105



>gb|ABR18416.1| unknown [Picea sitchensis]
 gb|ACN40948.1| unknown [Picea sitchensis]
Length=471

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 8/94 (9%)
 Frame = +3

Query  117  KRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA--TGAPVKGVTVAKLKV  275
            KR+E++EF+GL+S SGC+T+    RE S    D +A+Q+  KA  +GA VKG TVAK+KV
Sbjct  38   KRVEISEFAGLKSTSGCITYGRQVRENSLGLFDALASQVIAKAGKSGA-VKGETVAKMKV  96

Query  276  AINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            AINGFGRIGRNFLR WHG K SPLEV+ VND  G
Sbjct  97   AINGFGRIGRNFLRSWHGHKRSPLEVVAVNDIIG  130



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +3

Query  135  EFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFL  314
            +FSGL+S+   TF  R       VAAQ     +GA  + V  AK+KVAINGFGRIGRNF+
Sbjct  20   DFSGLKSTSVATFGKRSDDLLTRVAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFI  79

Query  315  RCWHGRKDSPLEVIVVNDSAG  377
            RCWHGRKDSPLEV+V+ND+ G
Sbjct  80   RCWHGRKDSPLEVVVINDTGG  100



>gb|AAF19788.1|AF162202_1 NADP-dependent glyceraldehyde phosphate dehydrogenase [Lactuca 
sativa]
Length=113

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  305
            +EF+GLRSS       R+ S  F  +VA Q T        KGVT AKLKVAINGFGRIGR
Sbjct  21   SEFAGLRSSSASLPFGRKGSDDFVSMVAFQTTLVGGSKTPKGVTEAKLKVAINGFGRIGR  80

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   NFLRCWHGRKDSPLDVIAINDTGG  104



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKA--TGAPVKGVTVAKLKVAINGFGRIG  302
            AEFSGLR+S  +TF+ + +  F  V+A Q +      G   KGV  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRNSASLTFARKTSDDFQSVIAFQTSALGINNGGYRKGVVEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGG  105



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIG  302
            +EFSGLR+S  + F+ R +S  F   V+ Q +  ++ G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMRSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+V+V+ND+ G
Sbjct  77   RNFLRCWHGRKDSPLDVVVINDTGG  101



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  302
            +EFSGLR+S  + F+ R +S  F   V+ Q +   + GA  KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMGSNGAYRKGVTEAKIKVAINGFGRIG  76

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGG  101



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREA-SFSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGR  305
            AEFSGLR+S  V+F  + +  F  V+A Q +   + G   KGV  AKLKVAINGFGRIGR
Sbjct  21   AEFSGLRNSASVSFGRKNSEDFLSVIAFQTSAVGSNGGYRKGVVEAKLKVAINGFGRIGR  80

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPL++I +ND+ G
Sbjct  81   NFLRCWHGRKDSPLDIIAINDTGG  104



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNF  311
            EFSGLRSS   + F N++ S  + V+A     +  + +KGVT AKLKVAINGFGRIGRNF
Sbjct  18   EFSGLRSSSASLPFGNKKLSSDEFVSAVTFQTSAVSSLKGVTEAKLKVAINGFGRIGRNF  77

Query  312  LRCWHGRKDSPLEVIVVNDSAG  377
            LRCWHGRKDSP +VI +ND+ G
Sbjct  78   LRCWHGRKDSPFDVIAINDTGG  99



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSS-GCVTFSNREA-SFSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  302
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGG  105



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSS-GCVTFSNREA-SFSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  302
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGG  105



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSS-GCVTFSNREA-SFSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  302
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGG  105



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSS-GCVTFSNREA-SFSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  302
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGG  105



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSS-GCVTFSNREA-SFSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  302
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGG  105



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +3

Query  129  VAEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRI  299
            +AEFSGLR SS C+ F  + +   FS +        + G   KGVT AKLKVAINGFGRI
Sbjct  20   LAEFSGLRTSSACLPFGKKTSDDLFSVITFQTSALGSNGGYKKGVTEAKLKVAINGFGRI  79

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  80   GRNFLRCWHGRKDSPLDVIAINDTGG  105



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 63/107 (59%), Gaps = 32/107 (30%)
 Frame = +3

Query  57   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATG  236
            SR+PT T LPS+++  Q  S        S  R+ G V                       
Sbjct  10   SRVPTTTGLPSRSTQSQAHS--------SFFRTEGSV-----------------------  38

Query  237  APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS G
Sbjct  39   -PVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGG  84



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIG  302
            AEFSGLR SS C+ F  + +   FS +     +  + G   KGVT AKLKVAINGFGRIG
Sbjct  21   AEFSGLRTSSACLPFGRKTSDDLFSVIAFQTSSVGSNGGYKKGVTEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGG  105



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  302
            +EFSGLR+S  + F+ + +S  F   V+ Q +   + G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+V+V+ND+ G
Sbjct  77   RNFLRCWHGRKDSPLDVVVINDTGG  101



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  302
            +EFSGLR+S  + F+ + +S  F   V+ Q +   + G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+V+V+ND+ G
Sbjct  77   RNFLRCWHGRKDSPLDVVVINDTGG  101



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 69/103 (67%), Gaps = 2/103 (2%)
 Frame = +3

Query  69   TRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVK  248
            T   +PS  S     SK L  +EFSG++S+  VTF  R    + +VAAQ    A+    +
Sbjct  7    TAVSVPSNASLKVAGSKGL--SEFSGMKSTNAVTFGKRSDDLASIVAAQSAVSASSGATR  64

Query  249  GVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
             VT AK+KVAINGFGRIGRNF+RCW GRKDSPL+V+V+ND+ G
Sbjct  65   AVTEAKIKVAINGFGRIGRNFIRCWQGRKDSPLDVVVINDTGG  107



>ref|NP_001289256.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Pyrus 
x bretschneideri]
 gb|AFG28404.1| glyceraldehyde-3-phosphate dehydrogenase A [Pyrus x bretschneideri]
Length=403

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 64/86 (74%), Gaps = 5/86 (6%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRI  299
            AEFSGLR SS C+ F  + +   FS V+A Q +   + G   KGVT AKLKVAINGFGRI
Sbjct  21   AEFSGLRTSSACLPFGRKTSDDLFS-VIAFQTSAVGSNGGYKKGVTEAKLKVAINGFGRI  79

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  80   GRNFLRCWHGRKDSPLDVIAINDTGG  105



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  302
            +EFSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYSKGVTEAKLKVAINGFGRIG  76

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGG  101



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 3/84 (4%)
 Frame = +3

Query  135  EFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIGR  305
            EFSGLR+S  + F+ + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIGR
Sbjct  18   EFSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIGR  77

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPL+VI +ND+ G
Sbjct  78   NFLRCWHGRKDSPLDVIAINDTGG  101



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 63/85 (74%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  302
            +EFSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+V+V+ND+ G
Sbjct  77   RNFLRCWHGRKDSPLDVVVINDTGG  101



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  302
            +EFSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIG  76

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGG  101



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREA-SFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  308
            +EFSGLRSS  + FS + +  F  VVA Q +        +GV  AK+KVAINGFGRIGRN
Sbjct  18   SEFSGLRSSASIPFSRKPSEDFLSVVAFQTSVVWGSGYKRGVVEAKIKVAINGFGRIGRN  77

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            FLRCWHGRKDSPL+VI +ND+ G
Sbjct  78   FLRCWHGRKDSPLDVIAINDTGG  100



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIG  302
            AEFSGLR SS  ++F+ R +  F  V+A Q +   ++G   KG+  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRNSSTSLSFARRTSDDFLSVIAFQTSAVGSSGGYKKGIVEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGG  105



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 64/86 (74%), Gaps = 5/86 (6%)
 Frame = +3

Query  132  AEFSGLRSS-GCVTFSNREAS--FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRI  299
            AEFSGLR+S  C+ F  + +   FS V+A Q +   + G   KGVT AKLKVAINGFGRI
Sbjct  21   AEFSGLRTSLACLPFGRKTSDDLFS-VIAFQTSALGSNGVYKKGVTEAKLKVAINGFGRI  79

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  80   GRNFLRCWHGRKDSPLDVIAINDTGG  105



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  308
            +EFSGLR+S  + F  +       VVA Q +    G   +GV  AKLKVAINGFGRIGRN
Sbjct  12   SEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNSKRGVVEAKLKVAINGFGRIGRN  71

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            FLRCWHGRKDSPL+VI +ND+ G
Sbjct  72   FLRCWHGRKDSPLDVIAINDTGG  94



>ref|XP_008449975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Cucumis melo]
Length=403

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 3/84 (4%)
 Frame = +3

Query  135  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGR  305
            EFSGLR SS C+ F+ R +  F  ++A Q +   + G   KG+  AKLKVAINGFGRIGR
Sbjct  22   EFSGLRNSSTCLPFARRTSDDFLSIIAFQTSAVGSNGGYKKGIVEAKLKVAINGFGRIGR  81

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPL+VI +ND+ G
Sbjct  82   NFLRCWHGRKDSPLDVIAINDTGG  105



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIG  302
            AEFSGLR SS  ++F+ R +  F  V+A Q +   ++G   KG+  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRNSSTSLSFARRTSDDFLSVIAFQTSAVGSSGGYKKGIVEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGG  105



>ref|XP_008449974.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Cucumis melo]
Length=404

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = +3

Query  63   IPTRTRLPSKTSTPQCFSKRLEVAEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KAT  233
            + T T   +K S  Q   K     EFSGLR SS C+ F+ R +  F  ++A Q +   + 
Sbjct  1    MATATLSVAKPSIQQANGKGF--GEFSGLRNSSTCLPFARRTSDDFLSIIAFQTSAVGSN  58

Query  234  GAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            G   KG+  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  59   GGYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG  106



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  308
            +EFSGLR+S  + F  +       VVA Q +    G   +GV  AKLKVAINGFGRIGRN
Sbjct  21   SEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNSKRGVVEAKLKVAINGFGRIGRN  80

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            FLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   FLRCWHGRKDSPLDVIAINDTGG  103



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  302
            ++FSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SDFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYKKGVTEAKLKVAINGFGRIG  76

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGG  101



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  302
            ++FSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SDFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIG  76

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGG  101



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  302
            ++FSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SDFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIG  76

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGG  101



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  308
            +EFSGLR+S  + F  +       VVA Q +    G   +GV  AKLKVAINGFGRIGRN
Sbjct  21   SEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNNKRGVVEAKLKVAINGFGRIGRN  80

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            FLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   FLRCWHGRKDSPLDVIAINDTGG  103



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  308
            +EFSGLR+S  + F  +       VVA Q +    G   +GV  AKLKVAINGFGRIGRN
Sbjct  21   SEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNNKRGVVEAKLKVAINGFGRIGRN  80

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            FLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   FLRCWHGRKDSPLDVIAINDTGG  103



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 63/85 (74%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  302
            +EFSGLR+S  + F+ + +S  F   V+ Q +   + G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKKSSSDEFVSFVSFQTSSMGSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+V+ +ND+ G
Sbjct  77   RNFLRCWHGRKDSPLDVVAINDTGG  101



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score = 98.6 bits (244),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVAKLKVAINGFGRIG  302
            ++FSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SDFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIG  76

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGG  101



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  305
            +EFSGLR SS  + F+ R    F  V+A Q +    G   +GV  AKLKVAINGFGRIGR
Sbjct  18   SEFSGLRGSSSALPFAKRANDDFVSVIAFQTSVVGGGKNKRGVVEAKLKVAINGFGRIGR  77

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPL+VI +ND+ G
Sbjct  78   NFLRCWHGRKDSPLDVIAINDTGG  101



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score = 98.6 bits (244),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIG  302
            AEFSGLR SS C+ F  + +   FS +        ++G   KG+  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRTSSACLPFGRKTSDDLFSVISFQTSAVGSSGGYKKGIAEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+V+V+ND+ G
Sbjct  81   RNFLRCWHGRKDSPLDVVVINDTGG  105



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIG  302
            AEFSGLR SS C+ F  + +   FS +        ++G   KG+  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRTSSACLPFGRKTSDDLFSVISFQTSAVGSSGGYKKGIAEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+V+V+ND+ G
Sbjct  81   RNFLRCWHGRKDSPLDVVVINDTGG  105



>ref|XP_010528117.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=402

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 60/86 (70%), Gaps = 4/86 (5%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKA----TGAPVKGVTVAKLKVAINGFGRI  299
            +EFSGLRSS  + F+ + +S   V       KA     G   KGVT AK+KVAINGFGRI
Sbjct  19   SEFSGLRSSSGLPFAKKPSSDEFVSFVTFQTKALGNNNGGYRKGVTEAKIKVAINGFGRI  78

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  79   GRNFLRCWHGRKDSPLDVIAINDTGG  104



>gb|ADX97321.1| glyceraldehyde-3-phosphate dehydrogenase [Mangifera indica]
Length=401

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = +3

Query  135  EFSGLRSSGCVTFSNREA-SFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNF  311
            +FSGLR+S  + FS + +  F  V+A Q +        KG   AKLKVAINGFGRIGRNF
Sbjct  22   DFSGLRNSASLPFSRKTSEDFLSVIAFQTSAVGNSGYRKGAAEAKLKVAINGFGRIGRNF  81

Query  312  LRCWHGRKDSPLEVIVVNDSAG  377
            LRCWHGRKDSPL+VI +ND+ G
Sbjct  82   LRCWHGRKDSPLDVIAINDTGG  103



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREASFSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGRN  308
            ++FSGL+S   VTF       +  VAAQ     ++G   + V  AK+KVAINGFGRIGRN
Sbjct  22   SDFSGLKSKNAVTFGRGAEDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRN  81

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            F+RCWHGRKDSPL+VIV+ND+ G
Sbjct  82   FIRCWHGRKDSPLDVIVINDTGG  104



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 62/86 (72%), Gaps = 4/86 (5%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREASFSD---VVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRI  299
            +EFSGLRSS       R+AS  D   V+A Q +   ++G   KGV  AKLKVAINGFGRI
Sbjct  21   SEFSGLRSSTASLPFARKASSDDFLSVIAFQTSAVGSSGGYKKGVVEAKLKVAINGFGRI  80

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   GRNFLRCWHGRKDSPLDVIAINDTGG  106



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREASFSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGRN  308
            ++FSGL+S   VTF       +  VAAQ     ++G   + V  AK+KVAINGFGRIGRN
Sbjct  22   SDFSGLKSKNAVTFGRGAEDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRN  81

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            F+RCWHGRKDSPL+VIV+ND+ G
Sbjct  82   FIRCWHGRKDSPLDVIVINDTGG  104



>ref|XP_004145622.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57690.1| hypothetical protein Csa_3G252490 [Cucumis sativus]
Length=403

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 3/84 (4%)
 Frame = +3

Query  135  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGR  305
            EFSGLR SS  ++F+ R +  F  V+A Q +   ++G   KG+  AKLKVAINGFGRIGR
Sbjct  22   EFSGLRNSSTSLSFARRTSDDFLSVIAFQTSAVGSSGGYKKGIVEAKLKVAINGFGRIGR  81

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPL+VI +ND+ G
Sbjct  82   NFLRCWHGRKDSPLDVIAINDTGG  105



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +3

Query  96   STPQCFSKRLEVAEFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVA  263
            S P+ F+      EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT A
Sbjct  7    SVPKGFT------EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEA  60

Query  264  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            KLKVAINGFGRIGRNFLRCWHGRKDSPL++I +ND+ G
Sbjct  61   KLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGG  98



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +3

Query  96   STPQCFSKRLEVAEFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVA  263
            S P+ F+      EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT A
Sbjct  7    SVPKGFT------EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEA  60

Query  264  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            KLKVAINGFGRIGRNFLRCWHGRKDSPL++I +ND+ G
Sbjct  61   KLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGG  98



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = +3

Query  96   STPQCFSKRLEVAEFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVA  263
            S P+ F+      EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT A
Sbjct  7    SVPKGFT------EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEA  60

Query  264  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            KLKVAINGFGRIGRNFLRCWHGRKDSPL++I +ND+ G
Sbjct  61   KLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGG  98



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  302
            EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSAFLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGG  102



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  302
            EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGG  102



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 4/86 (5%)
 Frame = +3

Query  132  AEFSGLR--SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRI  299
            +EFSGLR  SS  + FS + +  F  +++ Q +   ++G   KGVT AKLKVAINGFGRI
Sbjct  22   SEFSGLRNSSSSYLPFSRKTSDDFHSIISFQTSAVGSSGGYRKGVTEAKLKVAINGFGRI  81

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  82   GRNFLRCWHGRKDSPLDVIAINDTGG  107



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 62/85 (73%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  302
            EFSGLRSS   + F  + +S  F  VV  Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGG  102



>gb|KHN00649.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=290

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 9/89 (10%)
 Frame = +3

Query  132  AEFSGLRSS--GCVTFSNREAS--FSDVVAAQLTPKATGA---PVKGVTVAKLKVAINGF  290
            +EFSGLR+S  G ++FS+R++S  F  V+A Q +  A G      KGV  AKLKVAINGF
Sbjct  22   SEFSGLRNSSIGYLSFSSRKSSEDFHSVIAFQTS--AVGGREGNTKGVVEAKLKVAINGF  79

Query  291  GRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRIGRNFLRCW+GRKDSPL +I +ND+ G
Sbjct  80   GRIGRNFLRCWNGRKDSPLHIIAINDTTG  108



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNF  311
            ++FSG++S+  VTF  R    + +V+AQ    A+    + VT AK+KVAINGFGRIGRNF
Sbjct  26   SDFSGIKSTSAVTFGKRSEDLASIVSAQSAVSASSGAKRAVTEAKIKVAINGFGRIGRNF  85

Query  312  LRCWHGRKDSPLEVIVVNDSAG  377
            +RCWHGRKDSPL+V+V+ND+ G
Sbjct  86   VRCWHGRKDSPLDVVVINDTGG  107



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  302
            EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL++I +ND+ G
Sbjct  78   RNFLRCWHGRKDSPLDIIAINDTGG  102



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 61/87 (70%), Gaps = 8/87 (9%)
 Frame = +3

Query  135  EFSGLRSSGCVT-----FSNREASFSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGR  296
            EFSGLRSS         FS+ E  F  VV  Q +   ++G   KGVT AKLKVAINGFGR
Sbjct  18   EFSGLRSSSASLPFGKKFSSDE--FVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGR  75

Query  297  IGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            IGRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  76   IGRNFLRCWHGRKDSPLDVIAINDTGG  102



>emb|CDP18560.1| unnamed protein product [Coffea canephora]
Length=386

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNF  311
            +EF+GLRSS              VVA Q +    G   +GV  AKLKVAINGFGRIGRNF
Sbjct  21   SEFAGLRSSSLPFARKASDDLLSVVAFQTSVIGGGKNKRGVVEAKLKVAINGFGRIGRNF  80

Query  312  LRCWHGRKDSPLEVIVVNDSAG  377
            LRCWHGRKDSPL+V+V+ND+ G
Sbjct  81   LRCWHGRKDSPLDVVVINDTGG  102



>gb|AAA33780.1| glyceraldehyde-phosphate dehydrogenase [Pinus sylvestris]
Length=411

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 60/85 (71%), Gaps = 4/85 (5%)
 Frame = +3

Query  132  AEFSGLRSSG---CVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIG  302
            +E+SGL+SS    C+   N E  F  +VA Q     +    +GV  AK+KVAINGFGRIG
Sbjct  29   SEYSGLKSSSGFPCLRKYNEELRFQ-LVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIG  87

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+V+V+ND+ G
Sbjct  88   RNFLRCWHGRKDSPLDVVVINDTGG  112



>ref|XP_010249379.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Nelumbo nucifera]
Length=402

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 61/84 (73%), Gaps = 2/84 (2%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  305
            ++FSGLR SS  + F+ + +  F  V+A Q +        +GV  AKLKVAINGFGRIGR
Sbjct  21   SDFSGLRISSASLPFARKTSDDFLSVIAFQTSAVGGSGQKRGVVEAKLKVAINGFGRIGR  80

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPL+V+V+ND+ G
Sbjct  81   NFLRCWHGRKDSPLDVVVINDTGG  104



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  302
            EFSGLRSS   + F  + +S  F   V+ Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSAFLPFGKKLSSDEFVSFVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGG  102



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 67/98 (68%), Gaps = 8/98 (8%)
 Frame = +3

Query  99   TPQCFSKRLEVAEFSGLRSSGCVT--FSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVA  263
            +PQ   K    AEF+GLR+S   +  F  R +   FS V+A Q +   T G   +G+T A
Sbjct  12   SPQANGKGF--AEFAGLRNSSAASLCFGRRTSDDLFS-VIAFQTSAVGTNGGYKRGITEA  68

Query  264  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            KLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  69   KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG  106



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +3

Query  132  AEFSGLRSS-GCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  305
            +EFSGLRSS   + F  R    F  V+A Q +        +GV  AKLKVAINGFGRIGR
Sbjct  14   SEFSGLRSSSAALPFPRRPNDDFFSVIAFQTSSVGGDKNSRGVVEAKLKVAINGFGRIGR  73

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPL+VI +ND+ G
Sbjct  74   NFLRCWHGRKDSPLDVIAINDTGG  97



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 64/86 (74%), Gaps = 4/86 (5%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTV-AKLKVAINGFGRI  299
            +EFSGLR SSG + FS + +  F  V++ Q     ++G   KGV V AK+KVAINGFGRI
Sbjct  21   SEFSGLRNSSGYLPFSRKTSDDFHSVISFQTNAVGSSGRSKKGVVVEAKIKVAINGFGRI  80

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   GRNFLRCWHGRKDSPLDVIAINDTGG  106



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  302
            EFSGLRSS   + F  + +S  F  VV  Q +   ++G   KGVT AKLKVAI+GFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAISGFGRIG  77

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGG  102



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREASFSDVVAAQLTPKATGAPV---KGVTVAKLKVAINGFGRIG  302
            +FSGLRSS   + F+ + +S   V A      A G+     KGVT AKLKVAINGFGRIG
Sbjct  18   DFSGLRSSSASLPFAKKLSSDEFVSAVSFQTSAMGSSSGYRKGVTEAKLKVAINGFGRIG  77

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSP ++I +ND+ G
Sbjct  78   RNFLRCWHGRKDSPFDIIAINDTGG  102



>gb|ACN40537.1| unknown [Picea sitchensis]
Length=410

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSS-GCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  308
            +E+SGL+SS G  +          VVA Q     +    +GV  AK+KVAINGFGRIGRN
Sbjct  29   SEYSGLKSSIGFPSLRKYNEDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRN  88

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            FLRCWHGRKDSPL+V+V+ND+ G
Sbjct  89   FLRCWHGRKDSPLDVVVINDTGG  111



>gb|ACN40000.1| unknown [Picea sitchensis]
Length=410

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSS-GCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  308
            +E+SGL+SS G  +          VVA Q     +    +GV  AK+KVAINGFGRIGRN
Sbjct  29   SEYSGLKSSIGFPSLRKYNEDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRN  88

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            FLRCWHGRKDSPL+V+V+ND+ G
Sbjct  89   FLRCWHGRKDSPLDVVVINDTGG  111



>gb|ABK25233.1| unknown [Picea sitchensis]
 gb|ABK26169.1| unknown [Picea sitchensis]
 gb|ACN40026.1| unknown [Picea sitchensis]
 gb|ACN40459.1| unknown [Picea sitchensis]
Length=410

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSS-GCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  308
            +E+SGL+SS G  +          VVA Q     +    +GV  AK+KVAINGFGRIGRN
Sbjct  29   SEYSGLKSSIGFPSLRKYNEDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRN  88

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            FLRCWHGRKDSPL+V+V+ND+ G
Sbjct  89   FLRCWHGRKDSPLDVVVINDTGG  111



>gb|ABK24313.1| unknown [Picea sitchensis]
Length=410

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSS-GCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  308
            +E+SGL+SS G  +          VVA Q     +    +GV  AK+KVAINGFGRIGRN
Sbjct  29   SEYSGLKSSIGFPSLRKYNEDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRN  88

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            FLRCWHGRKDSPL+V+V+ND+ G
Sbjct  89   FLRCWHGRKDSPLDVVVINDTGG  111



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREASFSDVVAAQLTPKATGAP---VKGVTVAKLKVAINGFGRIG  302
            EFSGLRSS   + F  + +S   V A      A G+     KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSAITFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSP +VI +ND+ G
Sbjct  78   RNFLRCWHGRKDSPFDVIAINDTGG  102



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  305
            +EFSGLR+S       R+AS     V+A Q +        +GV  AKLKVAINGFGRIGR
Sbjct  21   SEFSGLRNSSASLPFARKASDDLLSVIAFQTSVVGGNGQKRGVVEAKLKVAINGFGRIGR  80

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   NFLRCWHGRKDSPLDVIAINDTGG  104



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = +3

Query  129  VAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKA---TGAPVKGVTVAKLKVAINGFGRI  299
            ++EFSGLRSS  +       S   V A      A   +G P +  T AKLKVAINGFGRI
Sbjct  18   LSEFSGLRSSASLPLRRNATSDDFVNAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRI  77

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGR DSPLEVI +ND+ G
Sbjct  78   GRNFLRCWHGRDDSPLEVIAINDTGG  103



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 60/85 (71%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKAT--GAPVKGVTVAKLKVAINGFGRIG  302
            EFSGLR SS  + F  + +  F  VVA Q +   +  G   KGV  AKLKVAINGFGRIG
Sbjct  22   EFSGLRNSSSSLPFPRKTSDDFLSVVAFQTSALGSNNGGYRKGVVEAKLKVAINGFGRIG  81

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGG  106



>ref|XP_006468948.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Citrus sinensis]
 gb|KDO63478.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=403

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 7/87 (8%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGR  296
            +EFSGLR+S  + F  + +  F  V+A Q +  A G+   G       AKLKVAINGFGR
Sbjct  21   SEFSGLRNSASLPFGRKSSDDFHSVIALQTS--ALGSSSSGYRKVAAQAKLKVAINGFGR  78

Query  297  IGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            IGRNFLRCWHGRKDSPLEV+ +ND+ G
Sbjct  79   IGRNFLRCWHGRKDSPLEVVAINDTGG  105



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 60/85 (71%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGRIG  302
            EFSGLR SS  + FS + +  F  VVA Q +    + G   K V  AKLKVAINGFGRIG
Sbjct  22   EFSGLRNSSAFLPFSKKTSDDFLSVVAFQTSAVGSSNGGYRKTVAEAKLKVAINGFGRIG  81

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGG  106



>ref|XP_006446865.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
 gb|ESR60105.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
Length=403

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 7/87 (8%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGR  296
            +EFSGLR+S  + F  + +  F  V+A Q +  A G+   G       AKLKVAINGFGR
Sbjct  21   SEFSGLRNSASLPFGRKSSDDFHSVIALQTS--ALGSSSSGYRKVAAQAKLKVAINGFGR  78

Query  297  IGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            IGRNFLRCWHGRKDSPLEV+ +ND+ G
Sbjct  79   IGRNFLRCWHGRKDSPLEVVAINDTGG  105



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREASFSDVVAAQLTPKATGAP---VKGVTVAKLKVAINGFGRIG  302
            +FSGLRSS   + F  + +S   V A      A G+     KGVT AKLKVAINGFGRIG
Sbjct  18   DFSGLRSSSASLPFGKKLSSDEFVSAVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSP +VI +ND+ G
Sbjct  78   RNFLRCWHGRKDSPFDVIAINDTGG  102



>gb|KDO63476.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=442

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 7/87 (8%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGR  296
            +EFSGLR+S  + F  + +  F  V+A Q +  A G+   G       AKLKVAINGFGR
Sbjct  21   SEFSGLRNSASLPFGRKSSDDFHSVIALQTS--ALGSSSSGYRKVAAQAKLKVAINGFGR  78

Query  297  IGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            IGRNFLRCWHGRKDSPLEV+ +ND+ G
Sbjct  79   IGRNFLRCWHGRKDSPLEVVAINDTGG  105



>gb|KDO63477.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=416

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 7/87 (8%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGR  296
            +EFSGLR+S  + F  + +  F  V+A Q +  A G+   G       AKLKVAINGFGR
Sbjct  21   SEFSGLRNSASLPFGRKSSDDFHSVIALQTS--ALGSSSSGYRKVAAQAKLKVAINGFGR  78

Query  297  IGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            IGRNFLRCWHGRKDSPLEV+ +ND+ G
Sbjct  79   IGRNFLRCWHGRKDSPLEVVAINDTGG  105



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREASFSDVVAAQLTPKATGAP---VKGVTVAKLKVAINGFGRIG  302
            +FSGLRSS   + F  + +S   V A      A G+     KGVT AKLKVAINGFGRIG
Sbjct  18   DFSGLRSSSASLPFGKKLSSDEFVSAVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSP +VI +ND+ G
Sbjct  78   RNFLRCWHGRKDSPFDVIAINDTGG  102



>gb|AGJ50596.1| GAPDH [Pericallis cruenta]
Length=399

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREASFSDVVA-AQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  308
            +EF+GLRSS     + +  S  D V+   L     G   KG   AKLKVAINGFGRIGRN
Sbjct  18   SEFAGLRSSSASLPAFQMKSCDDFVSMVALQTSFVGKNSKGPVEAKLKVAINGFGRIGRN  77

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            FLRCWHGRKDSPL+VIV+ND+ G
Sbjct  78   FLRCWHGRKDSPLDVIVINDTGG  100



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 4/86 (5%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTV-AKLKVAINGFGRI  299
            +EFSGLR SSG + FS + +  F  V++ Q     ++G   KGV V AK+KVAINGFGR 
Sbjct  21   SEFSGLRNSSGYLPFSRKTSDDFHSVISVQTNAVGSSGRSRKGVVVEAKIKVAINGFGRT  80

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  81   GRNFLRCWHGRKDSPLDVIAINDTGG  106



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +3

Query  132  AEFSGLRSS-GCVTFSNRE-ASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  305
            +EF+GLRSS   + F+ ++   F  V+A Q T        +GV  AKLKVAINGFGRIGR
Sbjct  18   SEFAGLRSSSAALPFARKQNEDFLSVIAFQ-TSAIDSKNKRGVVEAKLKVAINGFGRIGR  76

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPL+VI +ND+ G
Sbjct  77   NFLRCWHGRKDSPLDVIAINDTGG  100



>ref|XP_011033706.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Populus euphratica]
Length=404

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPV----KGVTVAKLKVAINGFGRIG  302
            +FSGLRSS       ++ S   V A  L   A G+      KG   AKLKVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSAVSLQTSALGSSSGGYRKGAAEAKLKVAINGFGRIG  81

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGG  106



>gb|AGV54738.1| glyceraldehyde-3-phosphate dehydrogenase A chloroplastic-like 
protein [Phaseolus vulgaris]
Length=316

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTV-AKLKVAINGFGRIG  302
            ++FSGLRSS      +R+ S  F+ V+A Q +        K V V AKLKVAINGFGRIG
Sbjct  21   SDFSGLRSSSSYLPFSRKTSEDFNSVIAFQTSAVGNSGGYKKVVVEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRK+SPL+VI +ND+ G
Sbjct  81   RNFLRCWHGRKESPLDVIAINDTGG  105



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTV-AKLKVAINGFGRIG  302
            ++FSGLRSS      +R+ S  F+ V+A Q +        K V V AKLKVAINGFGRIG
Sbjct  21   SDFSGLRSSSSYLPFSRKTSEDFNSVIAFQTSAVGNSGGYKKVVVEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRK+SPL+VI +ND+ G
Sbjct  81   RNFLRCWHGRKESPLDVIAINDTGG  105



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTV-AKLKVAINGFGRIG  302
            ++FSGLRSS      +R+ S  F+ V+A Q +        K V V AKLKVAINGFGRIG
Sbjct  21   SDFSGLRSSSSYLPFSRKTSEDFNSVIAFQTSAVGNSGGYKKVVVEAKLKVAINGFGRIG  80

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRK+SPL+VI +ND+ G
Sbjct  81   RNFLRCWHGRKESPLDVIAINDTGG  105



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKG-VTVAKLKVAINGFGRIGRN  308
            +EFSGLR+S  V F  +       VA   T    G   K  VT AKLKVAINGFGRIGRN
Sbjct  19   SEFSGLRTSSAVPFGRKTNDDLFSVAGLQTSAIGGRKNKRIVTEAKLKVAINGFGRIGRN  78

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            FLRCWHGRKDSPL+VI +ND+ G
Sbjct  79   FLRCWHGRKDSPLDVIAINDTGG  101



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 64/95 (67%), Gaps = 4/95 (4%)
 Frame = +3

Query  105  QCFSKRLEVAEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKAT--GAPVKGVTVAKLK  272
            Q   K +  A+FSGL  SS  + F+ + +  F  +VA Q +   +  G   KG+  AKLK
Sbjct  16   QAKGKGVGFADFSGLHNSSTSLPFARKTSDDFHSLVAFQTSALGSNNGGYRKGMAEAKLK  75

Query  273  VAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            VAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  76   VAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG  110



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 62/83 (75%), Gaps = 5/83 (6%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREASFSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGRN  308
            A F+GL+++   +  + + +F    AA+L P +ATG+  K VT AKLKVAINGFGRIGRN
Sbjct  7    ANFTGLKATSLFSAKSADEAF----AARLAPVQATGSSQKQVTEAKLKVAINGFGRIGRN  62

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            FLRCW GR++SPLEV+ +NDS G
Sbjct  63   FLRCWVGRENSPLEVVAINDSGG  85



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKG-VTVAKLKVAINGFGRIGRN  308
            +EFSGLR+S  V F  +       VA   T    G   K  VT AKLKVAINGFGRIGRN
Sbjct  19   SEFSGLRTSSAVPFGRKTNDDLFSVAGLQTSAIGGRKNKRIVTEAKLKVAINGFGRIGRN  78

Query  309  FLRCWHGRKDSPLEVIVVNDSAG  377
            FLRCWHGRKDSPL+VI +ND+ G
Sbjct  79   FLRCWHGRKDSPLDVIAINDTGG  101



>gb|KHG21941.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=363

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 64/95 (67%), Gaps = 4/95 (4%)
 Frame = +3

Query  105  QCFSKRLEVAEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKAT--GAPVKGVTVAKLK  272
            Q   K +  A+FSGL  SS  + F+ + +  F  +VA Q +   +  G   KG+  AK+K
Sbjct  16   QAKGKGVGFADFSGLHNSSTSLPFARKTSDDFHSLVAFQTSALGSNNGGYRKGMAEAKVK  75

Query  273  VAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            VAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  76   VAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG  110



>gb|AAA33484.1| glyceraldehyde-3-phosphate dehydrogenase precursor, partial [Zea 
mays]
Length=125

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 59/88 (67%), Gaps = 6/88 (7%)
 Frame = +3

Query  129  VAEFSGLRSSGCVTFSNREASFSDVVAA----QLTPKATGAPVKGVTVAKLKVAINGFGR  296
            ++EFSGLRSS  +    R A+  D ++A          +G P +  T AKLKVAINGFGR
Sbjct  19   LSEFSGLRSSASLPM-RRNATSDDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGR  77

Query  297  IGRNFLRCWHGRKD-SPLEVIVVNDSAG  377
            IGRNFLRCWHGR D SPL+VI +ND+ G
Sbjct  78   IGRNFLRCWHGRGDASPLDVIAINDTGG  105



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +3

Query  141  SGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRC  320
            SG++S+  VTF  R    + +VAAQ    A+    + VT AK+KVAINGFGRIGRNF+RC
Sbjct  1    SGMKSTNAVTFGKRSDDLASIVAAQSAVSASSGATRAVTEAKIKVAINGFGRIGRNFIRC  60

Query  321  WHGRKDSPLEVIVVNDSAG  377
            W GRKDSPL+V+V+ND+ G
Sbjct  61   WQGRKDSPLDVVVINDTGG  79



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 61/91 (67%), Gaps = 8/91 (9%)
 Frame = +3

Query  129  VAEFSGLRSSGCVTF---SNREAS-----FSDVVAAQLTPKATGAPVKGVTVAKLKVAIN  284
            + E+ GL++S    F   + R+A+     F D V   ++ K  G+  +G T AKL+VAIN
Sbjct  58   LCEYKGLKASTAHVFGGVTGRDAADASDLFVDSVTRDVSSKVIGSGHRGETEAKLRVAIN  117

Query  285  GFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GFGRIGRNFLRCWHGR DSPLEVI +NDS G
Sbjct  118  GFGRIGRNFLRCWHGRPDSPLEVIAINDSGG  148



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 60/85 (71%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKAT--GAPVKGVTVAKLKVAINGFGRIG  302
            EFSGLR SS  + F+ + +  F  VVA Q +  A+  G   +    AKLKVAINGFGRIG
Sbjct  23   EFSGLRNSSAFLPFAKKTSDDFLSVVAFQTSALASSSGGYRRAAAEAKLKVAINGFGRIG  82

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  83   RNFLRCWHGRKDSPLDVIAINDTGG  107



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 51/99 (52%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = +3

Query  81   LPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTV  260
            +PS  S     SK    +EFSG++S+   TF  +    + +VAAQ    A+    + VT 
Sbjct  11   VPSTASLKGAGSKGF--SEFSGMKSTSIATFGKQIDDLASIVAAQSAVSASSGASRAVTE  68

Query  261  AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            AK+KVAINGFGRIGRNF+RCWHGRKDSPL+V+V+ND+ G
Sbjct  69   AKIKVAINGFGRIGRNFIRCWHGRKDSPLDVVVINDTGG  107



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 62/87 (71%), Gaps = 5/87 (6%)
 Frame = +3

Query  132  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKATGAPVK--GVTV-AKLKVAINGFGR  296
            +EFSGLR S+G + FS + +  F  VV+ Q     +    K  GV V AKLKVAINGFGR
Sbjct  21   SEFSGLRNSTGYLPFSRKTSDDFHSVVSFQTNAVGSNGGYKRGGVVVEAKLKVAINGFGR  80

Query  297  IGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            IGRNFLRCWHGRK+SPL+VI +ND+ G
Sbjct  81   IGRNFLRCWHGRKESPLDVIAINDTGG  107



>ref|XP_011003600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Populus euphratica]
Length=404

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 60/85 (71%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREAS-FSDVVAAQL--TPKATGAPVKGVTVAKLKVAINGFGRIG  302
            +FSGLRSS   + F+ + +  F  VVA Q   T  ++G   K    AK+KVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSATGNSSGGYRKSAAEAKIKVAINGFGRIG  81

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGG  106



>gb|EYU35565.1| hypothetical protein MIMGU_mgv1a005886mg [Erythranthe guttata]
Length=466

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 58/86 (67%), Gaps = 4/86 (5%)
 Frame = +3

Query  132  AEFSGLRSSG-CVTF---SNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRI  299
            +EFSGLRSS   + F   +N  A F   V+ Q +        K V  AKLKVAINGFGRI
Sbjct  83   SEFSGLRSSSSALPFGKRANSNADFVSFVSFQTSLVGGEKNQKVVVEAKLKVAINGFGRI  142

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  143  GRNFLRCWHGRKDSPLDVIAINDTGG  168



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +3

Query  141  SGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRC  320
            SG++++  VTF  R      VVAAQ    A+    + VT AK++VAINGFGRIGRNF+RC
Sbjct  1    SGIKNTNAVTFGKRTDDLVSVVAAQSAVSASSGATRAVTEAKIRVAINGFGRIGRNFVRC  60

Query  321  WHGRKDSPLEVIVVNDSAG  377
            WHGRKDSPLEV+V+ND+ G
Sbjct  61   WHGRKDSPLEVVVINDTGG  79



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  147  LRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWH  326
            ++S+  VTF  R    + +V+AQ    A+    + VT AK+KVAINGFGRIGRNF+RCWH
Sbjct  1    MKSTNAVTFGKRSDDLATIVSAQSAVAASSGATRAVTEAKIKVAINGFGRIGRNFVRCWH  60

Query  327  GRKDSPLEVIVVNDSAG  377
            GRKDSPL+++V+ND+ G
Sbjct  61   GRKDSPLDIVVINDTGG  77



>gb|ABK96725.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 60/85 (71%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREAS-FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGRIG  302
            +FSGLRSS   + F+ + +  F  VVA Q +    ++G   K    AK+KVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSAMGNSSGGYRKSAAEAKIKVAINGFGRIG  81

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGG  106



>ref|XP_002321065.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
 gb|ABK96062.1| unknown [Populus trichocarpa]
 gb|ABK96120.1| unknown [Populus trichocarpa]
 gb|EEE99380.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
Length=404

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGRIG  302
            +FSGLRSS       ++ S   V A  L   A G+   G       AKLKVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSAVSLQTSALGSSSGGYRKSAAEAKLKVAINGFGRIG  81

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGG  106



>gb|ABK96233.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 60/85 (71%), Gaps = 4/85 (5%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREAS-FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGRIG  302
            +FSGLRSS   + F+ + +  F  VVA Q +    ++G   K    AK+KVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSAMGNSSGGYRKSAAEAKIKVAINGFGRIG  81

Query  303  RNFLRCWHGRKDSPLEVIVVNDSAG  377
            RNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGG  106



>ref|XP_006386825.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
 gb|ERP64622.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
Length=403

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGR  305
            +FSGLRSS   + F+ + +  F  VVA Q +   ++G   K    AK+KVAINGFGRIGR
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSMGNSSGGYRKSAAEAKIKVAINGFGRIGR  81

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPL+VI +ND+ G
Sbjct  82   NFLRCWHGRKDSPLDVIAINDTGG  105



>gb|ABK94956.1| unknown [Populus trichocarpa]
Length=403

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +3

Query  135  EFSGLRSSGC-VTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGR  305
            +FSGLRSS   + F+ + +  F  VVA Q +   ++G   K    AK+KVAINGFGRIGR
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSMGNSSGGYRKSAAEAKIKVAINGFGRIGR  81

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPL+VI +ND+ G
Sbjct  82   NFLRCWHGRKDSPLDVIAINDTGG  105



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 56/86 (65%), Gaps = 4/86 (5%)
 Frame = +3

Query  132  AEFSGLRSSGCVT----FSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRI  299
            ++FSGLRS+ C        + +   S V        ++G   KG   AK+KVAINGFGRI
Sbjct  21   SDFSGLRSASCSIPLRKIHSSDDFLSTVAFRTAAESSSGGYRKGAAEAKIKVAINGFGRI  80

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGRKDSPL+V+ +ND+ G
Sbjct  81   GRNFLRCWHGRKDSPLDVVAINDTGG  106



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATG--APVKGVTVAKLKVAINGFGRIGR  305
            +EF+GL +S  + F+ R +     + A  T    G  +   GV  AKLKVAINGFGRIGR
Sbjct  21   SEFAGLHTS-SLPFARRGSDDLVALVAFQTNALAGKRSTQNGVVEAKLKVAINGFGRIGR  79

Query  306  NFLRCWHGRKDSPLEVIVVNDSAG  377
            NFLRCWHGRKDSPLEV+V+NDS G
Sbjct  80   NFLRCWHGRKDSPLEVVVINDSGG  103



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +3

Query  204  VAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            VAAQ     +GA  + V  AK+KVAINGFGRIGRNF+RCWHGRKDSPLEV+V+ND+ G
Sbjct  2    VAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFIRCWHGRKDSPLEVVVINDTGG  59



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 59/92 (64%), Gaps = 11/92 (12%)
 Frame = +3

Query  135  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPK---------ATGAPVKGVTVAKLKVAI  281
            EFSGLR SS  + F+ + +  F  VVA Q + K           G   K    AKLKVAI
Sbjct  22   EFSGLRNSSAFLPFAKKTSDDFLSVVAFQTSAKRILTVKVGSNNGGYRKTAAEAKLKVAI  81

Query  282  NGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            NGFGRIGRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  82   NGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG  113



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 59/89 (66%), Gaps = 7/89 (8%)
 Frame = +3

Query  132  AEFSGLRSSGCVTFSNREASFSDVVA--AQLTPKATGAPVKG-----VTVAKLKVAINGF  290
            +EF+GLR+S  V F     +  D+++  A  T   +GA         V  AKLKVAINGF
Sbjct  23   SEFTGLRTSSAVPFGVGWKTNVDLLSLVAYQTSVISGAGKNNNNNSRVVEAKLKVAINGF  82

Query  291  GRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRIGRNFLRCWHGRKDSPL+VI +NDS G
Sbjct  83   GRIGRNFLRCWHGRKDSPLDVIAINDSGG  111



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +3

Query  225  KATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            ++ G   KGVT AK+KVAINGFGRIGRNFLRCWHGRKDSPL+V+V+ND+ G
Sbjct  2    RSNGGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGG  52



>ref|XP_010458726.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010458727.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=283

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  228  ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            + G   KGVT AK+KVAINGFGRIGRNFLRCWHGRKDSPL+V+V+ND+ G
Sbjct  3    SNGGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGG  52



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +3

Query  225  KATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            ++ G   KGVT AK+KVAINGFGRIGRNFLRCWHGRKDSPL+V+V+ND+ G
Sbjct  2    RSNGGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGG  52



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  228  ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            + G   KGVT AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  8    SNGGYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG  57



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  228  ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            ++G   KGVT AKLKVAINGFGRIGRNFLRCWHGRKDSPL++I +ND+ G
Sbjct  3    SSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGG  52



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  228  ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAG  377
            + G   KGVT AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ G
Sbjct  3    SNGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG  52



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 58/86 (67%), Gaps = 4/86 (5%)
 Frame = +3

Query  132  AEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKATGAPV---KGVTVAKLKVAINGFGRI  299
            +EFSGLRSS   +   N    F  V+A + +  A G      KG   AK+KVAINGFGRI
Sbjct  62   SEFSGLRSSSLPLRKINTSDDFLSVIAFKTSAVAGGGGGGYRKGPAEAKIKVAINGFGRI  121

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGRKDSPL+V+ +ND+ G
Sbjct  122  GRNFLRCWHGRKDSPLDVVAINDTGG  147



>gb|AFK38236.1| unknown [Medicago truncatula]
Length=111

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -2

Query  376  PALSLTTITSNGESLRPCQQRRKFLPMRPKPLIATFNLATVTPLTGA-PVALGVS  215
            P LSLTTITS+GES RPCQ  RKFLPMRPKPLIATFNLATV+PLT   P+AL  S
Sbjct  57   PPLSLTTITSSGESFRPCQHLRKFLPMRPKPLIATFNLATVSPLTAVDPMALVAS  111



>ref|XP_009420999.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=402

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = +3

Query  132  AEFSGLRSSGC---VTFSNREASFSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRI  299
            ++FSGLRS+     +   N    F  VVA + +   ++G   KG   AK+KVAINGFGRI
Sbjct  19   SDFSGLRSASSSIPLRRINSSDDFLSVVAFRTSAVGSSGGYRKGAAEAKVKVAINGFGRI  78

Query  300  GRNFLRCWHGRKDSPLEVIVVNDSAG  377
            GRNFLRCWHGRKDSPL+V+ +ND+ G
Sbjct  79   GRNFLRCWHGRKDSPLDVVAINDTGG  104



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553125100440