BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF008J02

Length=372
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001275154.1|  mitochondrial outer membrane protein porin o...    186   1e-55   Solanum tuberosum [potatoes]
ref|XP_004233349.1|  PREDICTED: mitochondrial outer membrane prot...    186   1e-55   Solanum lycopersicum
ref|XP_010087805.1|  Mitochondrial outer membrane protein porin o...    183   1e-54   Morus notabilis
gb|AIL25718.1|  voltage-dependent anion channel                         181   6e-54   Nicotiana tabacum [American tobacco]
ref|XP_009779190.1|  PREDICTED: mitochondrial outer membrane prot...    181   7e-54   Nicotiana sylvestris
dbj|BAF95070.1|  voltage-dependent anion channel                        181   7e-54   Nicotiana tabacum [American tobacco]
gb|AAB38498.1|  porin                                                   181   1e-53   Mesembryanthemum crystallinum
ref|XP_009587690.1|  PREDICTED: mitochondrial outer membrane prot...    181   1e-53   Nicotiana tomentosiformis
ref|XP_009798894.1|  PREDICTED: mitochondrial outer membrane prot...    180   2e-53   Nicotiana sylvestris
ref|XP_009596455.1|  PREDICTED: mitochondrial outer membrane prot...    180   3e-53   Nicotiana tomentosiformis
ref|XP_006431074.1|  hypothetical protein CICLE_v10012445mg             179   6e-53   Citrus clementina [clementine]
ref|XP_006482536.1|  PREDICTED: mitochondrial outer membrane prot...    179   6e-53   Citrus sinensis [apfelsine]
ref|XP_006361834.1|  PREDICTED: uncharacterized LOC102577832            177   2e-52   Solanum tuberosum [potatoes]
gb|ABC01904.1|  34 kDa outer mitochondrial membrane protein porin...    177   2e-52   Solanum tuberosum [potatoes]
ref|XP_010029375.1|  PREDICTED: mitochondrial outer membrane prot...    176   8e-52   Eucalyptus grandis [rose gum]
ref|XP_008443436.1|  PREDICTED: mitochondrial outer membrane prot...    176   8e-52   Cucumis melo [Oriental melon]
ref|XP_004147460.1|  PREDICTED: mitochondrial outer membrane prot...    176   8e-52   
ref|XP_011098570.1|  PREDICTED: mitochondrial outer membrane prot...    176   1e-51   Sesamum indicum [beniseed]
ref|XP_007215668.1|  hypothetical protein PRUPE_ppa008585mg             177   2e-51   
ref|XP_007032450.1|  Voltage dependent anion channel 1                  174   4e-51   
ref|XP_004234781.2|  PREDICTED: mitochondrial outer membrane prot...    174   7e-51   Solanum lycopersicum
gb|KJB33661.1|  hypothetical protein B456_006G024700                    172   3e-50   Gossypium raimondii
gb|EPS57816.1|  hypothetical protein M569_17001                         172   3e-50   Genlisea aurea
ref|XP_010256458.1|  PREDICTED: mitochondrial outer membrane prot...    172   4e-50   Nelumbo nucifera [Indian lotus]
gb|KHG03636.1|  Mitochondrial outer membrane porin of 34 kDa            171   1e-49   Gossypium arboreum [tree cotton]
emb|CDP00287.1|  unnamed protein product                                170   1e-49   Coffea canephora [robusta coffee]
gb|AFK37646.1|  unknown                                                 167   2e-49   Lotus japonicus
sp|P42054.2|VDAC_PEA  RecName: Full=Outer plastidial membrane pro...    169   2e-49   Pisum sativum [garden pea]
dbj|BAG09387.1|  peroxisomal voltage-dependent anion-selective ch...    167   3e-49   Glycine max [soybeans]
gb|KDP45473.1|  hypothetical protein JCGZ_09722                         169   3e-49   Jatropha curcas
emb|CBI32017.3|  unnamed protein product                                168   3e-49   Vitis vinifera
ref|XP_011010796.1|  PREDICTED: mitochondrial outer membrane prot...    169   4e-49   Populus euphratica
gb|KJB11402.1|  hypothetical protein B456_001G256800                    169   4e-49   Gossypium raimondii
ref|XP_002276636.1|  PREDICTED: mitochondrial outer membrane prot...    169   4e-49   Vitis vinifera
gb|KJB11403.1|  hypothetical protein B456_001G256800                    169   5e-49   Gossypium raimondii
gb|AAQ87020.1|  VDAC1.2                                                 168   9e-49   Lotus japonicus
ref|XP_003554316.1|  PREDICTED: mitochondrial outer membrane prot...    168   1e-48   Glycine max [soybeans]
emb|CAJ42303.1|  VDAC-like porin                                        167   1e-48   Plantago major [cart-track plant]
emb|CAN67632.1|  hypothetical protein VITISV_019646                     164   2e-48   Vitis vinifera
ref|XP_002517470.1|  voltage-dependent anion-selective channel, p...    167   2e-48   Ricinus communis
gb|EYU34113.1|  hypothetical protein MIMGU_mgv1a011597mg                167   2e-48   Erythranthe guttata [common monkey flower]
ref|XP_008379329.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    167   2e-48   Malus domestica [apple tree]
emb|CDP02196.1|  unnamed protein product                                167   2e-48   Coffea canephora [robusta coffee]
ref|XP_003543710.1|  PREDICTED: outer plastidial membrane protein...    167   2e-48   Glycine max [soybeans]
gb|KHN13242.1|  Outer plastidial membrane protein porin                 167   2e-48   Glycine soja [wild soybean]
gb|AFK40985.1|  unknown                                                 167   2e-48   Lotus japonicus
gb|AAA96275.1|  voltage-dependent anion channel protein                 167   3e-48   Spinacia oleracea
ref|XP_011085778.1|  PREDICTED: mitochondrial outer membrane prot...    167   3e-48   Sesamum indicum [beniseed]
ref|XP_009627246.1|  PREDICTED: mitochondrial outer membrane prot...    167   3e-48   Nicotiana tomentosiformis
ref|XP_009772199.1|  PREDICTED: mitochondrial outer membrane prot...    167   3e-48   Nicotiana sylvestris
gb|KJB60740.1|  hypothetical protein B456_009G323300                    164   3e-48   Gossypium raimondii
ref|XP_004489166.1|  PREDICTED: outer plastidial membrane protein...    167   3e-48   Cicer arietinum [garbanzo]
ref|XP_011034213.1|  PREDICTED: mitochondrial outer membrane prot...    166   4e-48   Populus euphratica
ref|XP_002312708.1|  porin family protein                               166   5e-48   Populus trichocarpa [western balsam poplar]
gb|AAY82249.1|  mitochrondrial voltage-dependent anion-selective ...    166   6e-48   Phaseolus coccineus [scarlet runner bean]
ref|XP_011085779.1|  PREDICTED: mitochondrial outer membrane prot...    166   7e-48   Sesamum indicum [beniseed]
ref|XP_010242364.1|  PREDICTED: mitochondrial outer membrane prot...    166   7e-48   Nelumbo nucifera [Indian lotus]
ref|XP_002282471.1|  PREDICTED: mitochondrial outer membrane prot...    166   9e-48   Vitis vinifera
gb|KJB60742.1|  hypothetical protein B456_009G323300                    163   1e-47   Gossypium raimondii
ref|XP_002520135.1|  voltage-dependent anion-selective channel, p...    166   1e-47   Ricinus communis
ref|XP_006378154.1|  porin family protein                               166   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_010683253.1|  PREDICTED: mitochondrial outer membrane prot...    165   1e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008456460.1|  PREDICTED: mitochondrial outer membrane prot...    165   1e-47   Cucumis melo [Oriental melon]
gb|KDO82798.1|  hypothetical protein CISIN_1g0238541mg                  162   1e-47   Citrus sinensis [apfelsine]
gb|KJB60739.1|  hypothetical protein B456_009G323300                    165   2e-47   Gossypium raimondii
ref|NP_001275134.1|  mitochondrial outer membrane protein porin o...    165   2e-47   Solanum tuberosum [potatoes]
ref|XP_007139603.1|  hypothetical protein PHAVU_008G043800g             164   2e-47   Phaseolus vulgaris [French bean]
gb|KDP21225.1|  hypothetical protein JCGZ_21696                         164   2e-47   Jatropha curcas
ref|XP_010096343.1|  Mitochondrial outer membrane protein porin o...    164   3e-47   Morus notabilis
gb|ACU24178.1|  unknown                                                 164   4e-47   Glycine max [soybeans]
ref|XP_003552508.1|  PREDICTED: outer plastidial membrane protein...    164   4e-47   Glycine max [soybeans]
ref|NP_001238377.1|  peroxisomal voltage-dependent anion-selectiv...    164   5e-47   Glycine max [soybeans]
ref|XP_009360395.1|  PREDICTED: mitochondrial outer membrane prot...    164   5e-47   Pyrus x bretschneideri [bai li]
ref|XP_004228386.1|  PREDICTED: mitochondrial outer membrane prot...    164   5e-47   Solanum lycopersicum
ref|XP_011005064.1|  PREDICTED: mitochondrial outer membrane prot...    164   5e-47   Populus euphratica
ref|XP_004297335.1|  PREDICTED: mitochondrial outer membrane prot...    164   6e-47   Fragaria vesca subsp. vesca
ref|XP_002324035.1|  hypothetical protein POPTR_0017s11430g             163   6e-47   Populus trichocarpa [western balsam poplar]
ref|XP_004489372.1|  PREDICTED: outer plastidial membrane protein...    163   6e-47   Cicer arietinum [garbanzo]
ref|XP_004146750.1|  PREDICTED: mitochondrial outer membrane prot...    163   6e-47   Cucumis sativus [cucumbers]
emb|CAA56601.1|  36kDa porin I                                          163   6e-47   Solanum tuberosum [potatoes]
ref|XP_006483230.1|  PREDICTED: mitochondrial outer membrane prot...    163   7e-47   Citrus sinensis [apfelsine]
ref|XP_006438620.1|  hypothetical protein CICLE_v10032366mg             163   7e-47   Citrus clementina [clementine]
gb|KHG20441.1|  Mitochondrial outer membrane porin of 36 kDa            163   8e-47   Gossypium arboreum [tree cotton]
ref|XP_008230727.1|  PREDICTED: mitochondrial outer membrane prot...    163   9e-47   Prunus mume [ume]
gb|AAQ87019.1|  VDAC1.1                                                 163   1e-46   Lotus japonicus
emb|CDP00288.1|  unnamed protein product                                163   1e-46   Coffea canephora [robusta coffee]
ref|XP_010066951.1|  PREDICTED: mitochondrial outer membrane prot...    163   1e-46   Eucalyptus grandis [rose gum]
gb|KJB11404.1|  hypothetical protein B456_001G256800                    163   1e-46   Gossypium raimondii
gb|AFK39621.1|  unknown                                                 163   1e-46   Lotus japonicus
ref|XP_008389525.1|  PREDICTED: mitochondrial outer membrane prot...    162   1e-46   Malus domestica [apple tree]
gb|KHN11584.1|  Outer plastidial membrane protein porin                 162   2e-46   Glycine soja [wild soybean]
gb|ACU20122.1|  unknown                                                 162   2e-46   Glycine max [soybeans]
ref|XP_010524325.1|  PREDICTED: mitochondrial outer membrane prot...    162   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_010550070.1|  PREDICTED: mitochondrial outer membrane prot...    162   2e-46   Tarenaya hassleriana [spider flower]
gb|KGN47800.1|  hypothetical protein Csa_6G404150                       163   3e-46   Cucumis sativus [cucumbers]
ref|XP_004302356.1|  PREDICTED: mitochondrial outer membrane prot...    161   4e-46   Fragaria vesca subsp. vesca
ref|XP_007046222.1|  Mitochondrial outer membrane protein porin 1...    159   6e-46   
ref|XP_010670319.1|  PREDICTED: mitochondrial outer membrane prot...    160   8e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU34669.1|  hypothetical protein MIMGU_mgv1a011608mg                160   8e-46   Erythranthe guttata [common monkey flower]
ref|XP_008339931.1|  PREDICTED: mitochondrial outer membrane prot...    160   8e-46   
gb|EYU22439.1|  hypothetical protein MIMGU_mgv1a011543mg                160   1e-45   Erythranthe guttata [common monkey flower]
gb|AAD38145.1|AF139498_1  porin                                         160   1e-45   Prunus armeniaca
ref|XP_008221678.1|  PREDICTED: mitochondrial outer membrane prot...    160   1e-45   Prunus mume [ume]
gb|AFK34190.1|  unknown                                                 160   2e-45   Medicago truncatula
ref|XP_009797869.1|  PREDICTED: mitochondrial outer membrane prot...    160   2e-45   Nicotiana sylvestris
gb|AID59897.1|  voltage-dependent anion channel protein                 160   2e-45   Prunus persica
ref|XP_008341536.1|  PREDICTED: outer plastidial membrane protein...    159   2e-45   Malus domestica [apple tree]
ref|XP_010033217.1|  PREDICTED: mitochondrial outer membrane prot...    159   2e-45   Eucalyptus grandis [rose gum]
ref|XP_007046221.1|  Voltage dependent anion channel 1 isoform 1        158   6e-45   Theobroma cacao [chocolate]
pir||B55017  porin, plastid - garden pea                                158   8e-45
ref|XP_009599229.1|  PREDICTED: mitochondrial outer membrane prot...    158   8e-45   Nicotiana tomentosiformis
ref|XP_007222361.1|  hypothetical protein PRUPE_ppa008111mg             159   9e-45   
ref|XP_011086392.1|  PREDICTED: mitochondrial outer membrane prot...    157   1e-44   Sesamum indicum [beniseed]
ref|XP_006842115.1|  hypothetical protein AMTR_s00078p00100600          157   2e-44   Amborella trichopoda
gb|KJB50696.1|  hypothetical protein B456_008G182700                    157   2e-44   Gossypium raimondii
gb|KJB30016.1|  hypothetical protein B456_005G139100                    153   6e-44   Gossypium raimondii
gb|KHG13762.1|  Mitochondrial outer membrane porin of 36 kDa            155   7e-44   Gossypium arboreum [tree cotton]
ref|XP_003621109.1|  Outer plastidial membrane protein porin            155   9e-44   Medicago truncatula
gb|AFK38338.1|  unknown                                                 155   1e-43   Medicago truncatula
ref|XP_011071026.1|  PREDICTED: mitochondrial outer membrane prot...    155   2e-43   Sesamum indicum [beniseed]
gb|AAQ87021.1|  VDAC1.3                                                 154   2e-43   Lotus japonicus
gb|ACJ85253.1|  unknown                                                 154   2e-43   Medicago truncatula
gb|KJB30018.1|  hypothetical protein B456_005G139100                    154   3e-43   Gossypium raimondii
gb|KHG10147.1|  Mitochondrial outer membrane porin of 34 kDa            153   4e-43   Gossypium arboreum [tree cotton]
gb|ACU19720.1|  unknown                                                 152   6e-43   Glycine max [soybeans]
gb|EYU28705.1|  hypothetical protein MIMGU_mgv1a011554mg                153   8e-43   Erythranthe guttata [common monkey flower]
ref|XP_003532049.1|  PREDICTED: mitochondrial outer membrane prot...    152   1e-42   Glycine max [soybeans]
ref|XP_006408480.1|  hypothetical protein EUTSA_v10021076mg             153   3e-42   
ref|NP_001241054.1|  uncharacterized protein LOC100805016               150   7e-42   Glycine max [soybeans]
ref|XP_009131920.1|  PREDICTED: mitochondrial outer membrane prot...    149   3e-41   Brassica rapa
emb|CDY28690.1|  BnaCnng05760D                                          149   3e-41   Brassica napus [oilseed rape]
ref|XP_004514771.1|  PREDICTED: mitochondrial outer membrane prot...    149   3e-41   Cicer arietinum [garbanzo]
emb|CDY66736.1|  BnaCnng52100D                                          148   4e-41   Brassica napus [oilseed rape]
ref|XP_006298185.1|  hypothetical protein CARUB_v10014234mg             149   4e-41   
gb|AAW22621.1|  outer mitochondrial membrane protein porin 1            148   4e-41   Brassica napus [oilseed rape]
ref|XP_010512938.1|  PREDICTED: mitochondrial outer membrane prot...    148   7e-41   Camelina sativa [gold-of-pleasure]
emb|CDX91952.1|  BnaC03g32540D                                          147   1e-40   
emb|CDY68122.1|  BnaA05g37480D                                          147   2e-40   Brassica napus [oilseed rape]
ref|XP_009125035.1|  PREDICTED: mitochondrial outer membrane prot...    146   2e-40   Brassica rapa
ref|XP_007153842.1|  hypothetical protein PHAVU_003G069300g             146   2e-40   Phaseolus vulgaris [French bean]
ref|XP_009147408.1|  PREDICTED: mitochondrial outer membrane prot...    146   2e-40   Brassica rapa
ref|XP_002884286.1|  hypothetical protein ARALYDRAFT_477400             145   4e-40   
gb|AAS48868.1|  voltage-dependent anion-selective channel               145   4e-40   Brassica rapa subsp. pekinensis [bai cai]
gb|ABK24200.1|  unknown                                                 145   4e-40   Picea sitchensis
ref|XP_010463547.1|  PREDICTED: mitochondrial outer membrane prot...    145   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010485517.1|  PREDICTED: mitochondrial outer membrane prot...    145   6e-40   Camelina sativa [gold-of-pleasure]
gb|KFK25745.1|  hypothetical protein AALP_AA8G154100                    145   9e-40   Arabis alpina [alpine rockcress]
ref|NP_001288856.1|  mitochondrial outer membrane protein porin 3...    144   1e-39   Brassica rapa
gb|AAM62480.1|  voltage-dependent anion-selective channel protein...    144   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492333.1|  PREDICTED: mitochondrial outer membrane prot...    144   2e-39   Camelina sativa [gold-of-pleasure]
gb|KHG01383.1|  Mitochondrial outer membrane porin of 36 kDa            144   2e-39   Gossypium arboreum [tree cotton]
ref|XP_009134621.1|  PREDICTED: mitochondrial outer membrane prot...    144   2e-39   Brassica rapa
gb|KFK37589.1|  hypothetical protein AALP_AA3G002700                    144   2e-39   Arabis alpina [alpine rockcress]
emb|CDY59668.1|  BnaCnng35410D                                          144   2e-39   Brassica napus [oilseed rape]
ref|NP_186777.1|  voltage dependent anion channel 1                     143   5e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65525.1|  putative porin                                          143   5e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KEH19833.1|  porin/voltage-dependent anion-selective channel p...    142   6e-39   Medicago truncatula
gb|ACJ85279.1|  unknown                                                 142   6e-39   Medicago truncatula
gb|EAZ08792.1|  hypothetical protein OsI_31052                          142   8e-39   Oryza sativa Indica Group [Indian rice]
emb|CDY63765.1|  BnaCnng42590D                                          142   8e-39   Brassica napus [oilseed rape]
ref|NP_001062983.1|  Os09g0361400                                       142   8e-39   
ref|XP_006660565.1|  PREDICTED: mitochondrial outer membrane prot...    142   9e-39   Oryza brachyantha
gb|EAZ44453.1|  hypothetical protein OsJ_29066                          142   9e-39   Oryza sativa Japonica Group [Japonica rice]
ref|NP_197013.1|  voltage dependent anion channel 3                     142   9e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288964.1|  mitochondrial outer membrane protein porin 3       142   1e-38   Brassica rapa
emb|CDX85566.1|  BnaA02g02470D                                          142   1e-38   
ref|XP_002873707.1|  voltage-dependent anion-selective channel pr...    142   1e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_004956656.1|  PREDICTED: mitochondrial outer membrane prot...    141   2e-38   Setaria italica
emb|CDX74294.1|  BnaA03g27530D                                          141   3e-38   
ref|XP_003578022.1|  PREDICTED: mitochondrial outer membrane porin      140   7e-38   Brachypodium distachyon [annual false brome]
ref|XP_010420161.1|  PREDICTED: mitochondrial outer membrane prot...    139   1e-37   Camelina sativa [gold-of-pleasure]
gb|ACF85328.1|  unknown                                                 139   2e-37   Zea mays [maize]
ref|NP_001105619.1|  voltage-dependent anion channel protein1a          139   2e-37   Zea mays [maize]
gb|EPS68383.1|  hypothetical protein M569_06388                         138   3e-37   Genlisea aurea
ref|XP_006286537.1|  hypothetical protein CARUB_v10001678mg             138   4e-37   Capsella rubella
ref|XP_010453637.1|  PREDICTED: mitochondrial outer membrane prot...    138   4e-37   Camelina sativa [gold-of-pleasure]
gb|KHN45480.1|  Mitochondrial outer membrane protein porin of 34 kDa    137   6e-37   Glycine soja [wild soybean]
ref|XP_006400027.1|  hypothetical protein EUTSA_v10014354mg             137   7e-37   Eutrema salsugineum [saltwater cress]
tpg|DAA61162.1|  TPA: voltage-dependent anion-selective channel p...    135   4e-36   
ref|NP_001104948.1|  voltage-dependent anion channel protein1b          135   5e-36   
ref|XP_009410756.1|  PREDICTED: mitochondrial outer membrane prot...    135   5e-36   Musa acuminata subsp. malaccensis [pisang utan]
sp|P46274.1|VDAC1_WHEAT  RecName: Full=Mitochondrial outer membra...    135   5e-36   Triticum aestivum [Canadian hard winter wheat]
gb|AAC64164.1|  voltage-dependent anion-selective channel protein       130   6e-36   Zea mays [maize]
ref|XP_002460110.1|  hypothetical protein SORBIDRAFT_02g022910          134   1e-35   Sorghum bicolor [broomcorn]
gb|EMS51310.1|  Mitochondrial outer membrane porin                      138   1e-35   Triticum urartu
ref|XP_001779057.1|  predicted protein                                  134   1e-35   
gb|ABK23226.1|  unknown                                                 134   1e-35   Picea sitchensis
gb|EMT02908.1|  Mitochondrial outer membrane porin                      137   3e-35   
ref|XP_008786741.1|  PREDICTED: mitochondrial outer membrane prot...    131   2e-34   Phoenix dactylifera
gb|KHG07129.1|  Mitochondrial outer membrane protein porin of 34 kDa    132   2e-34   Gossypium arboreum [tree cotton]
ref|XP_010932447.1|  PREDICTED: mitochondrial outer membrane prot...    131   2e-34   Elaeis guineensis
ref|XP_010925058.1|  PREDICTED: mitochondrial outer membrane prot...    130   5e-34   Elaeis guineensis
ref|XP_008808420.1|  PREDICTED: mitochondrial outer membrane prot...    129   8e-34   Phoenix dactylifera
ref|XP_008775594.1|  PREDICTED: mitochondrial outer membrane prot...    129   9e-34   Phoenix dactylifera
ref|XP_001781995.1|  predicted protein                                  129   2e-33   
ref|XP_010925360.1|  PREDICTED: mitochondrial outer membrane prot...    128   2e-33   Elaeis guineensis
ref|XP_009408682.1|  PREDICTED: mitochondrial outer membrane prot...    128   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006826371.1|  hypothetical protein AMTR_s00004p00132290          122   6e-33   
gb|ADE77918.1|  unknown                                                 126   1e-32   Picea sitchensis
ref|XP_009393634.1|  PREDICTED: mitochondrial outer membrane prot...    126   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008338437.1|  PREDICTED: mitochondrial outer membrane prot...    123   2e-31   
gb|KHG07130.1|  Mitochondrial outer membrane protein porin of 34 kDa    122   5e-31   Gossypium arboreum [tree cotton]
ref|XP_009408829.1|  PREDICTED: mitochondrial outer membrane prot...    122   6e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009150694.1|  PREDICTED: mitochondrial outer membrane prot...    121   1e-30   Brassica rapa
ref|NP_201551.1|  voltage dependent anion channel 2                     121   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280940.1|  hypothetical protein CARUB_v10026938mg             120   2e-30   Capsella rubella
dbj|BAJ99489.1|  predicted protein                                      120   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS47295.1|  Outer plastidial membrane protein porin                 120   2e-30   Triticum urartu
ref|XP_010550330.1|  PREDICTED: mitochondrial outer membrane prot...    120   2e-30   Tarenaya hassleriana [spider flower]
emb|CDY08723.1|  BnaA06g25010D                                          120   2e-30   Brassica napus [oilseed rape]
emb|CDM83072.1|  unnamed protein product                                120   2e-30   Triticum aestivum [Canadian hard winter wheat]
emb|CAA57646.1|  Voltage dependent anion channel (VDAC)                 120   3e-30   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006393957.1|  hypothetical protein EUTSA_v10004631mg             120   3e-30   
ref|XP_008354718.1|  PREDICTED: mitochondrial outer membrane prot...    120   3e-30   Malus domestica [apple tree]
ref|XP_009354614.1|  PREDICTED: mitochondrial outer membrane prot...    120   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_007205702.1|  hypothetical protein PRUPE_ppa009821mg             120   3e-30   Prunus persica
ref|XP_010484488.1|  PREDICTED: mitochondrial outer membrane prot...    120   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010463972.1|  PREDICTED: mitochondrial outer membrane prot...    120   4e-30   Camelina sativa [gold-of-pleasure]
ref|NP_001043433.1|  Os01g0588200                                       119   4e-30   
ref|XP_010444638.1|  PREDICTED: mitochondrial outer membrane prot...    119   5e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008238010.1|  PREDICTED: mitochondrial outer membrane prot...    119   7e-30   Prunus mume [ume]
ref|XP_002866701.1|  hypothetical protein ARALYDRAFT_496845             119   8e-30   
ref|XP_004231921.1|  PREDICTED: mitochondrial outer membrane prot...    120   9e-30   
emb|CBI33688.3|  unnamed protein product                                115   1e-29   Vitis vinifera
ref|XP_010231957.1|  PREDICTED: mitochondrial outer membrane prot...    118   1e-29   Brachypodium distachyon [annual false brome]
emb|CDY18662.1|  BnaA09g07330D                                          118   2e-29   Brassica napus [oilseed rape]
ref|XP_009112213.1|  PREDICTED: mitochondrial outer membrane prot...    118   2e-29   Brassica rapa
gb|AAW22622.1|  porin-like protein                                      117   2e-29   Brassica napus [oilseed rape]
emb|CDY36497.1|  BnaC03g48560D                                          117   2e-29   Brassica napus [oilseed rape]
emb|CDY02103.1|  BnaA03g40640D                                          117   3e-29   
gb|KJB30017.1|  hypothetical protein B456_005G139100                    116   4e-29   Gossypium raimondii
ref|XP_010547555.1|  PREDICTED: mitochondrial outer membrane prot...    117   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_009136524.1|  PREDICTED: mitochondrial outer membrane prot...    117   5e-29   Brassica rapa
ref|XP_004969385.1|  PREDICTED: mitochondrial outer membrane prot...    117   5e-29   Setaria italica
ref|XP_002458065.1|  hypothetical protein SORBIDRAFT_03g026350          116   9e-29   Sorghum bicolor [broomcorn]
emb|CDX81312.1|  BnaC09g07230D                                          116   9e-29   
gb|KJB34748.1|  hypothetical protein B456_006G081500                    114   1e-28   Gossypium raimondii
ref|XP_008457836.1|  PREDICTED: mitochondrial outer membrane prot...    115   1e-28   Cucumis melo [Oriental melon]
ref|XP_002279650.2|  PREDICTED: mitochondrial outer membrane prot...    115   2e-28   Vitis vinifera
ref|XP_010652706.1|  PREDICTED: mitochondrial outer membrane prot...    115   2e-28   Vitis vinifera
ref|XP_009403419.1|  PREDICTED: mitochondrial outer membrane prot...    115   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007047520.1|  Voltage dependent anion channel 2                  115   2e-28   
emb|CAA63968.1|  pom30                                                  115   2e-28   Solanum tuberosum [potatoes]
ref|XP_004288248.1|  PREDICTED: mitochondrial outer membrane prot...    115   2e-28   Fragaria vesca subsp. vesca
ref|XP_006426127.1|  hypothetical protein CICLE_v10026251mg             114   3e-28   Citrus clementina [clementine]
ref|XP_004148030.1|  PREDICTED: mitochondrial outer membrane prot...    114   3e-28   Cucumis sativus [cucumbers]
gb|AFW83107.1|  outer plastidial membrane protein porin                 114   4e-28   
gb|KFK28435.1|  hypothetical protein AALP_AA8G514300                    114   4e-28   Arabis alpina [alpine rockcress]
ref|XP_006845625.1|  hypothetical protein AMTR_s00019p00217910          114   4e-28   Amborella trichopoda
ref|NP_001278544.1|  outer plastidial membrane protein porin            114   4e-28   Zea mays [maize]
gb|KJB48714.1|  hypothetical protein B456_008G082900                    114   6e-28   Gossypium raimondii
gb|ACG45954.1|  outer plastidial membrane protein porin                 114   6e-28   Zea mays [maize]
ref|XP_010942794.1|  PREDICTED: mitochondrial outer membrane prot...    114   8e-28   
ref|XP_009604076.1|  PREDICTED: mitochondrial outer membrane prot...    113   9e-28   Nicotiana tomentosiformis
ref|XP_006841082.1|  hypothetical protein AMTR_s00086p00035910          113   1e-27   Amborella trichopoda
ref|XP_002964960.1|  hypothetical protein SELMODRAFT_143103             113   1e-27   Selaginella moellendorffii
ref|XP_006646048.1|  PREDICTED: mitochondrial outer membrane prot...    113   1e-27   Oryza brachyantha
ref|XP_009770519.1|  PREDICTED: mitochondrial outer membrane prot...    112   2e-27   Nicotiana sylvestris
gb|ACG25664.1|  outer plastidial membrane protein porin                 112   2e-27   Zea mays [maize]
ref|NP_001141587.1|  outer plastidial membrane protein porin            112   2e-27   Zea mays [maize]
ref|XP_010102769.1|  Mitochondrial outer membrane protein porin 2       112   3e-27   Morus notabilis
ref|XP_002525270.1|  voltage-dependent anion-selective channel, p...    111   5e-27   Ricinus communis
ref|XP_002877711.1|  hypothetical protein ARALYDRAFT_323570             111   6e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_002306507.2|  hypothetical protein POPTR_0005s19050g             111   9e-27   
ref|XP_006404089.1|  hypothetical protein EUTSA_v10010622mg             110   1e-26   Eutrema salsugineum [saltwater cress]
sp|P42057.1|VDAC_MAIZE  RecName: Full=Outer plastidial membrane p...    110   1e-26   Zea mays [maize]
ref|XP_009801997.1|  PREDICTED: mitochondrial outer membrane prot...    110   1e-26   Nicotiana sylvestris
ref|XP_009615970.1|  PREDICTED: mitochondrial outer membrane prot...    110   1e-26   Nicotiana tomentosiformis
ref|XP_002984740.1|  hypothetical protein SELMODRAFT_156847             110   1e-26   
ref|XP_010943374.1|  PREDICTED: mitochondrial outer membrane prot...    110   1e-26   Elaeis guineensis
emb|CDP02599.1|  unnamed protein product                                110   2e-26   Coffea canephora [robusta coffee]
ref|XP_008787191.1|  PREDICTED: mitochondrial outer membrane prot...    109   3e-26   Phoenix dactylifera
gb|KHG14881.1|  Mitochondrial outer membrane porin 2 -like protein      109   4e-26   Gossypium arboreum [tree cotton]
ref|NP_001048902.1|  Os03g0137500                                       109   4e-26   
gb|EEC74475.1|  hypothetical protein OsI_09925                          108   4e-26   Oryza sativa Indica Group [Indian rice]
gb|KJB43907.1|  hypothetical protein B456_007G223000                    108   4e-26   Gossypium raimondii
ref|XP_006291699.1|  hypothetical protein CARUB_v10017863mg             108   5e-26   
ref|XP_010247341.1|  PREDICTED: mitochondrial outer membrane prot...    108   5e-26   Nelumbo nucifera [Indian lotus]
ref|XP_008805725.1|  PREDICTED: mitochondrial outer membrane prot...    108   6e-26   Phoenix dactylifera
ref|XP_011008399.1|  PREDICTED: mitochondrial outer membrane prot...    108   7e-26   
gb|KDP32072.1|  hypothetical protein JCGZ_12533                         108   9e-26   
gb|ABA26972.1|  TO25b-23rc                                              102   1e-25   
gb|KFK34258.1|  hypothetical protein AALP_AA5G121500                    108   1e-25   
ref|XP_004961383.1|  PREDICTED: mitochondrial outer membrane prot...    107   1e-25   
ref|XP_006298184.1|  hypothetical protein CARUB_v10014234mg             107   1e-25   
ref|XP_010272561.1|  PREDICTED: mitochondrial outer membrane prot...    107   2e-25   
ref|XP_004511842.1|  PREDICTED: mitochondrial outer membrane prot...    107   2e-25   
ref|XP_002272180.1|  PREDICTED: mitochondrial outer membrane prot...    107   3e-25   
emb|CAN64922.1|  hypothetical protein VITISV_017201                     107   3e-25   
ref|XP_010938962.1|  PREDICTED: mitochondrial outer membrane prot...    106   5e-25   
ref|XP_006381815.1|  VDAC3.1 family protein                             106   5e-25   
gb|KCW78721.1|  hypothetical protein EUGRSUZ_C00165                     106   6e-25   
ref|XP_008777255.1|  PREDICTED: mitochondrial outer membrane prot...    106   6e-25   
gb|KHG00012.1|  Mitochondrial outer membrane porin 2 -like protein      106   6e-25   
ref|NP_001190641.1|  voltage dependent anion channel 2                  106   6e-25   
ref|NP_001239899.1|  uncharacterized protein LOC100790578               106   6e-25   
gb|KCW78720.1|  hypothetical protein EUGRSUZ_C00165                     106   6e-25   
gb|ABB16970.1|  POM30-like protein                                      105   8e-25   
ref|XP_006649363.1|  PREDICTED: mitochondrial outer membrane prot...    105   8e-25   
ref|XP_010046987.1|  PREDICTED: mitochondrial outer membrane prot...    105   8e-25   
ref|XP_010028100.1|  PREDICTED: mitochondrial outer membrane prot...    105   1e-24   
gb|AAP46186.1|  PgPOR29                                                 105   1e-24   
ref|XP_006350613.1|  PREDICTED: mitochondrial outer membrane prot...    105   1e-24   
ref|XP_002465683.1|  hypothetical protein SORBIDRAFT_01g043700          105   1e-24   
ref|XP_003568015.1|  PREDICTED: mitochondrial outer membrane prot...    105   1e-24   
ref|XP_007156717.1|  hypothetical protein PHAVU_002G011300g             105   1e-24   
ref|XP_004234649.1|  PREDICTED: mitochondrial outer membrane prot...    105   1e-24   
ref|XP_011099371.1|  PREDICTED: mitochondrial outer membrane prot...    104   2e-24   
ref|XP_007018499.1|  Voltage dependent anion channel 2                  104   2e-24   
ref|XP_002976531.1|  hypothetical protein SELMODRAFT_267998             104   2e-24   
ref|XP_011007586.1|  PREDICTED: mitochondrial outer membrane prot...    104   2e-24   
gb|KJB58633.1|  hypothetical protein B456_009G219700                    104   3e-24   
ref|XP_009413143.1|  PREDICTED: mitochondrial outer membrane prot...    104   3e-24   
ref|XP_008805677.1|  PREDICTED: mitochondrial outer membrane prot...    104   3e-24   
gb|AFK33448.1|  unknown                                                 103   3e-24   
ref|XP_003611587.1|  Mitochondrial outer membrane protein porin         103   3e-24   
ref|XP_002973372.1|  hypothetical protein SELMODRAFT_271012             103   3e-24   
ref|NP_001147486.1|  outer mitochondrial membrane protein porin         103   3e-24   
gb|AAQ87022.1|  VDAC2.1                                                 103   3e-24   
tpg|DAA43927.1|  TPA: outer membrane protein porin                      103   4e-24   
ref|XP_004985298.1|  PREDICTED: mitochondrial outer membrane prot...    103   5e-24   
ref|XP_004969745.1|  PREDICTED: mitochondrial outer membrane prot...    103   5e-24   
ref|NP_001241153.1|  uncharacterized protein LOC100818855               103   6e-24   
gb|KHN36298.1|  Mitochondrial outer membrane protein porin 2            103   6e-24   
ref|XP_003558558.1|  PREDICTED: mitochondrial outer membrane prot...    103   6e-24   
gb|KDP41624.1|  hypothetical protein JCGZ_16031                         102   9e-24   
ref|XP_009386273.1|  PREDICTED: mitochondrial outer membrane prot...    102   1e-23   
gb|AFK40966.1|  unknown                                                 100   1e-23   
dbj|BAL41368.1|  porin                                                  100   1e-23   
ref|XP_009411051.1|  PREDICTED: mitochondrial outer membrane prot...    102   2e-23   
ref|XP_006649583.1|  PREDICTED: mitochondrial outer membrane prot...    102   2e-23   
ref|XP_010918626.1|  PREDICTED: mitochondrial outer membrane prot...    102   2e-23   
gb|AAL04449.1|  voltage-dependent anion channel                       97.4    2e-23   
ref|XP_003558860.1|  PREDICTED: mitochondrial outer membrane prot...    101   2e-23   
ref|XP_002458403.1|  hypothetical protein SORBIDRAFT_03g032840          101   2e-23   
ref|NP_001288497.1|  mitochondrial outer membrane protein porin 5       101   3e-23   
ref|XP_006607011.1|  PREDICTED: mitochondrial outer membrane prot...    102   3e-23   
ref|XP_006607010.1|  PREDICTED: mitochondrial outer membrane prot...    102   3e-23   
ref|XP_003557011.2|  PREDICTED: mitochondrial outer membrane prot...    101   3e-23   
ref|XP_006607009.1|  PREDICTED: mitochondrial outer membrane prot...    101   4e-23   
ref|XP_008452645.1|  PREDICTED: mitochondrial outer membrane prot...    100   5e-23   
ref|XP_010679633.1|  PREDICTED: mitochondrial outer membrane prot...    100   5e-23   
ref|XP_010539443.1|  PREDICTED: mitochondrial outer membrane prot...    100   6e-23   
ref|XP_004507844.1|  PREDICTED: mitochondrial outer membrane prot...    100   7e-23   
gb|AAQ87023.1|  VDAC3.1                                                 100   7e-23   
gb|KCW56275.1|  hypothetical protein EUGRSUZ_I02018                     100   8e-23   
ref|XP_008363546.1|  PREDICTED: mitochondrial outer membrane prot...    100   9e-23   
ref|XP_007014286.1|  Voltage dependent anion channel 4                  100   9e-23   
ref|XP_002866208.1|  hypothetical protein ARALYDRAFT_495848             100   1e-22   
ref|XP_006280944.1|  hypothetical protein CARUB_v10026945mg             100   1e-22   
ref|XP_010259833.1|  PREDICTED: mitochondrial outer membrane prot...    100   1e-22   
ref|XP_004498999.1|  PREDICTED: mitochondrial outer membrane prot...    100   1e-22   
ref|XP_011073688.1|  PREDICTED: mitochondrial outer membrane prot...  99.8    1e-22   
gb|KJB23474.1|  hypothetical protein B456_004G100400                  97.8    1e-22   
ref|XP_010259832.1|  PREDICTED: mitochondrial outer membrane prot...    100   1e-22   
ref|NP_001242630.1|  uncharacterized protein LOC100797369             99.8    2e-22   
ref|XP_009400023.1|  PREDICTED: mitochondrial outer membrane prot...  99.4    2e-22   
ref|XP_006600196.1|  PREDICTED: uncharacterized protein LOC100797...  99.4    2e-22   
ref|XP_009338032.1|  PREDICTED: mitochondrial outer membrane prot...  99.4    2e-22   
ref|XP_008223703.1|  PREDICTED: mitochondrial outer membrane prot...  99.4    2e-22   
gb|KJB23472.1|  hypothetical protein B456_004G100400                  97.8    2e-22   
tpg|DAA43264.1|  TPA: outer membrane protein porin                    99.0    2e-22   
ref|XP_011043983.1|  PREDICTED: mitochondrial outer membrane prot...  98.6    3e-22   
ref|NP_200557.1|  voltage dependent anion channel 4                   98.6    4e-22   
ref|XP_004507845.1|  PREDICTED: mitochondrial outer membrane prot...  98.6    4e-22   
gb|KDO82799.1|  hypothetical protein CISIN_1g0238541mg                96.3    4e-22   
ref|XP_010688492.1|  PREDICTED: mitochondrial outer membrane prot...  98.2    4e-22   
ref|XP_006655528.1|  PREDICTED: mitochondrial outer membrane prot...  98.6    4e-22   
ref|NP_001056162.1|  Os05g0536200                                     98.6    4e-22   
ref|XP_007160908.1|  hypothetical protein PHAVU_001G027200g           98.2    5e-22   
gb|KJB23473.1|  hypothetical protein B456_004G100400                  98.2    5e-22   
ref|NP_001049301.1|  Os03g0202200                                     98.2    6e-22   
ref|XP_007222510.1|  hypothetical protein PRUPE_ppa009817mg           97.8    6e-22   
ref|NP_001104949.1|  voltage-dependent anion channel protein2         97.8    6e-22   
gb|EYU20913.1|  hypothetical protein MIMGU_mgv1a011651mg              97.4    1e-21   
ref|XP_007154773.1|  hypothetical protein PHAVU_003G146600g           97.1    1e-21   
ref|XP_003610136.1|  Mitochondrial outer membrane protein porin       97.1    1e-21   
gb|ACJ85119.1|  unknown                                               97.1    1e-21   
ref|XP_010536913.1|  PREDICTED: mitochondrial outer membrane prot...  97.1    1e-21   
ref|NP_001242891.1|  uncharacterized protein LOC100790270             96.7    2e-21   
ref|XP_006593432.1|  PREDICTED: uncharacterized protein LOC100790...  96.7    2e-21   
ref|NP_001147762.1|  outer mitochondrial membrane protein porin       96.3    2e-21   
ref|XP_002325061.1|  VDAC3.1 family protein                           96.3    2e-21   
gb|KHG05706.1|  Mitochondrial outer membrane porin 4 -like protein    96.3    3e-21   
emb|CDY11866.1|  BnaC03g12920D                                        95.9    3e-21   
ref|XP_009132124.1|  PREDICTED: mitochondrial outer membrane prot...  95.9    3e-21   
emb|CDX88625.1|  BnaA03g10240D                                        95.9    3e-21   
ref|XP_004296415.1|  PREDICTED: mitochondrial outer membrane prot...  95.9    4e-21   
ref|XP_010061677.1|  PREDICTED: mitochondrial outer membrane prot...  95.9    4e-21   
ref|XP_004290968.1|  PREDICTED: mitochondrial outer membrane prot...  95.9    4e-21   
ref|XP_002440144.1|  hypothetical protein SORBIDRAFT_09g026790        95.9    4e-21   
ref|XP_006453392.1|  hypothetical protein CICLE_v10009163mg           95.5    5e-21   
ref|XP_008351971.1|  PREDICTED: mitochondrial outer membrane prot...  95.1    6e-21   
ref|XP_004141289.1|  PREDICTED: mitochondrial outer membrane prot...  94.7    8e-21   
ref|XP_009360705.1|  PREDICTED: mitochondrial outer membrane prot...  94.7    8e-21   
ref|XP_004146313.1|  PREDICTED: mitochondrial outer membrane prot...  94.4    1e-20   
ref|XP_008453611.1|  PREDICTED: mitochondrial outer membrane prot...  94.4    1e-20   
gb|EMT32910.1|  Mitochondrial outer membrane protein porin            94.4    1e-20   
ref|XP_011011237.1|  PREDICTED: mitochondrial outer membrane prot...  94.0    2e-20   
ref|XP_006380609.1|  VDAC2.1 family protein                           94.0    2e-20   
ref|XP_010999872.1|  PREDICTED: mitochondrial outer membrane prot...  93.6    2e-20   
gb|EYU29628.1|  hypothetical protein MIMGU_mgv1a011618mg              93.6    2e-20   
gb|KHN07668.1|  Mitochondrial outer membrane protein porin 2          93.6    3e-20   
ref|XP_007227465.1|  hypothetical protein PRUPE_ppa009796mg           93.2    3e-20   
ref|XP_010545418.1|  PREDICTED: mitochondrial outer membrane prot...  93.2    3e-20   
ref|XP_008220333.1|  PREDICTED: mitochondrial outer membrane prot...  92.8    4e-20   
ref|XP_010452150.1|  PREDICTED: mitochondrial outer membrane prot...  92.8    4e-20   
emb|CDP01200.1|  unnamed protein product                              92.8    5e-20   
gb|KJB30164.1|  hypothetical protein B456_005G132100                  92.8    5e-20   
ref|XP_003589068.1|  Mitochondrial outer membrane protein porin       92.4    6e-20   
ref|XP_002510098.1|  voltage-dependent anion-selective channel, p...  92.4    6e-20   
ref|NP_001190045.1|  voltage dependent anion channel 5                89.7    6e-20   
gb|KEH40016.1|  porin/voltage-dependent anion-selective channel p...  92.4    6e-20   
emb|CAA57647.1|  Voltage dependent anion channel (VDAC)               92.0    7e-20   
gb|ACU23163.1|  unknown                                               92.0    7e-20   
ref|XP_002320689.2|  hypothetical protein POPTR_0014s01660g           92.0    7e-20   
ref|XP_010483270.1|  PREDICTED: mitochondrial outer membrane prot...  92.0    8e-20   
ref|XP_011079306.1|  PREDICTED: mitochondrial outer membrane prot...  92.0    9e-20   
emb|CDP02971.1|  unnamed protein product                              92.0    1e-19   
ref|XP_004985785.1|  PREDICTED: mitochondrial outer membrane prot...  92.0    1e-19   
ref|XP_006401200.1|  hypothetical protein EUTSA_v10014362mg           91.3    1e-19   
ref|XP_004983259.1|  PREDICTED: mitochondrial outer membrane prot...  91.3    2e-19   
ref|XP_010061676.1|  PREDICTED: mitochondrial outer membrane prot...  91.3    2e-19   
ref|XP_010443435.1|  PREDICTED: mitochondrial outer membrane prot...  91.3    2e-19   
dbj|BAJ99317.1|  predicted protein                                    91.3    2e-19   
ref|XP_009614284.1|  PREDICTED: mitochondrial outer membrane prot...  90.9    2e-19   
gb|EPS70241.1|  hypothetical protein M569_04517                       90.9    2e-19   
emb|CDY23028.1|  BnaC07g31590D                                        90.1    2e-19   
ref|XP_010691575.1|  PREDICTED: mitochondrial outer membrane prot...  90.5    3e-19   
gb|ACG30926.1|  outer mitochondrial membrane protein porin            90.5    3e-19   
ref|XP_006662285.1|  PREDICTED: mitochondrial outer membrane prot...  90.1    3e-19   
ref|NP_001149101.1|  outer mitochondrial membrane protein porin       90.1    3e-19   
ref|XP_003569678.1|  PREDICTED: mitochondrial outer membrane prot...  90.1    6e-19   
ref|XP_002468550.1|  hypothetical protein SORBIDRAFT_01g047800        88.6    1e-18   
dbj|BAJ91367.1|  predicted protein                                    88.6    2e-18   
ref|XP_009798280.1|  PREDICTED: mitochondrial outer membrane prot...  88.2    2e-18   
sp|Q0JJV1.3|VDAC4_ORYSJ  RecName: Full=Mitochondrial outer membra...  88.2    2e-18   
gb|EPS73591.1|  pom30 protein                                         87.8    3e-18   
gb|EMT12164.1|  Mitochondrial outer membrane protein porin of 34 kDa  87.8    3e-18   
gb|KJB31318.1|  hypothetical protein B456_005G186100                  87.0    5e-18   
ref|XP_010943375.1|  PREDICTED: mitochondrial outer membrane prot...  86.3    9e-18   
ref|XP_006366956.1|  PREDICTED: mitochondrial outer membrane prot...  85.9    1e-17   
ref|XP_006644617.1|  PREDICTED: mitochondrial outer membrane prot...  85.1    3e-17   
ref|XP_010323316.1|  PREDICTED: mitochondrial outer membrane prot...  84.3    4e-17   
ref|XP_008777257.1|  PREDICTED: mitochondrial outer membrane prot...  84.3    4e-17   
ref|NP_190561.1|  voltage dependent anion channel 5                   82.8    1e-16   
tpg|DAA43267.1|  TPA: hypothetical protein ZEAMMB73_938356            82.4    2e-16   
ref|NP_001152335.1|  outer mitochondrial membrane protein porin       82.0    3e-16   
tpg|DAA43266.1|  TPA: hypothetical protein ZEAMMB73_938356            80.9    6e-16   
gb|KHN17590.1|  Mitochondrial outer membrane protein porin 6          81.3    7e-16   
ref|NP_001149108.1|  outer mitochondrial membrane protein porin       80.9    7e-16   
tpg|DAA43265.1|  TPA: hypothetical protein ZEAMMB73_938356            80.5    1e-15   
ref|XP_003550309.2|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...  80.1    2e-15   
ref|XP_010918628.1|  PREDICTED: mitochondrial outer membrane prot...  79.7    2e-15   
ref|XP_004516360.1|  PREDICTED: uncharacterized protein LOC101509833  79.3    3e-15   
ref|XP_004499296.1|  PREDICTED: uncharacterized protein LOC101502021  79.3    4e-15   
ref|XP_010551868.1|  PREDICTED: mitochondrial outer membrane prot...  75.1    2e-14   
gb|KHN36963.1|  Mitochondrial outer membrane protein porin 5          75.9    5e-14   
ref|XP_010551867.1|  PREDICTED: mitochondrial outer membrane prot...  74.7    6e-14   
ref|XP_010101100.1|  Mitochondrial outer membrane protein porin 4     74.7    2e-13   
gb|EEC71387.1|  hypothetical protein OsI_03508                        73.9    3e-13   
ref|XP_008665842.1|  PREDICTED: mitochondrial outer membrane prot...  70.9    1e-12   
gb|EMT20213.1|  Mitochondrial outer membrane porin                    73.9    2e-12   
ref|NP_001044063.2|  Os01g0715500                                     70.1    8e-12   
emb|CDY25906.1|  BnaC09g32780D                                        69.7    2e-11   
gb|ABE77194.1|  putative voltage-dependent ion channel                68.9    2e-11   
ref|XP_002298773.1|  hypothetical protein POPTR_0001s30130g           68.6    3e-11   
gb|EYU44488.1|  hypothetical protein MIMGU_mgv1a016650mg              65.9    4e-11   
gb|KJB79456.1|  hypothetical protein B456_013G050600                  67.8    5e-11   
gb|AFM35764.1|  hypothetical protein                                  64.3    5e-11   
gb|EEE58291.1|  hypothetical protein OsJ_09329                        68.2    2e-10   
ref|XP_002993837.1|  hypothetical protein SELMODRAFT_137671           65.5    3e-10   
ref|XP_011030342.1|  PREDICTED: mitochondrial outer membrane prot...  65.5    4e-10   
gb|EMS62963.1|  Mitochondrial outer membrane protein porin            67.0    4e-10   
ref|XP_007201143.1|  hypothetical protein PRUPE_ppa016048mg           64.7    5e-10   
ref|XP_002991466.1|  hypothetical protein SELMODRAFT_161680           63.2    2e-09   
ref|XP_010550772.1|  PREDICTED: mitochondrial outer membrane prot...  62.0    2e-09   
ref|XP_008657771.1|  PREDICTED: mitochondrial outer membrane prot...  60.5    6e-09   
ref|XP_010664924.1|  PREDICTED: mitochondrial outer membrane prot...  60.5    2e-08   
ref|XP_008670182.1|  PREDICTED: mitochondrial outer membrane prot...  54.3    4e-07   
ref|XP_008236314.1|  PREDICTED: mitochondrial outer membrane prot...  56.6    4e-07   
gb|ACG46968.1|  hypothetical protein                                  53.9    4e-07   
gb|KJB29688.1|  hypothetical protein B456_005G114000                  54.7    8e-07   
gb|EMS46046.1|  Mitochondrial outer membrane protein porin of 34 kDa  55.1    1e-06   
ref|XP_006383551.1|  hypothetical protein POPTR_0005s19050g           54.7    1e-06   
dbj|BAD87377.1|  putative 36kDA porin II                              55.1    2e-06   
ref|XP_004172904.1|  PREDICTED: mitochondrial outer membrane prot...  53.5    3e-06   
gb|KHG11726.1|  Mitochondrial outer membrane porin of 34 kDa          52.0    8e-06   
ref|XP_002956375.1|  hypothetical protein VOLCADRAFT_77106            52.8    1e-05   
gb|ABF94514.1|  Eukaryotic porin family protein, expressed            52.0    1e-05   
gb|EMT17443.1|  Mitochondrial outer membrane porin                    52.8    2e-05   
gb|KHG14314.1|  Histone H3.2                                          50.8    4e-05   
ref|XP_004164031.1|  PREDICTED: mitochondrial outer membrane prot...  50.8    4e-05   
gb|KHG21511.1|  Mitochondrial outer membrane protein porin of 34 kDa  47.8    6e-05   
gb|ACG47457.1|  hypothetical protein                                  47.4    8e-05   
gb|KDP31208.1|  hypothetical protein JCGZ_11584                       49.7    9e-05   
gb|AFK39270.1|  unknown                                               47.4    1e-04   
ref|XP_004163728.1|  PREDICTED: mitochondrial outer membrane prot...  46.6    1e-04   
ref|XP_010426523.1|  PREDICTED: mitochondrial outer membrane prot...  49.3    1e-04   
gb|AFK40114.1|  unknown                                               48.5    3e-04   



>ref|NP_001275154.1| mitochondrial outer membrane protein porin of 34 kDa [Solanum 
tuberosum]
 sp|P42055.2|VDAC1_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 34 
kDa; AltName: Full=POM 34; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56599.1| 34 kDA porin [Solanum tuberosum]
Length=276

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQ+DHKF+ITTYSPTGVVITS+GSKKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKFSITTYSPTGVVITSSGSKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSN+FTTITVDEAAPGLK I SFRVPD
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPD  100



>ref|XP_004233349.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQ+DHKF+ITTYSPTGVVITS+GSKKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKFSITTYSPTGVVITSSGSKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSN+FTTITVDEAAPGLK I SFRVPD
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPD  100



>ref|XP_010087805.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
 gb|EXB30112.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
Length=276

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYTDIGKKARDLLY+DYQ+DHKFTITTYSPTGV ITSTG+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSTGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+FTT+TVDE APGLK I SFR+PD
Sbjct  61   KNKNITTDIKVDTNSNLFTTVTVDEPAPGLKTILSFRLPD  100



>gb|AIL25718.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   181 bits (460),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK+ARDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I SFR+PD
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPD  100



>ref|XP_009779190.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   181 bits (460),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK+ARDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I SFR+PD
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPD  100



>dbj|BAF95070.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   181 bits (460),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK+ARDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I SFR+PD
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPD  100



>gb|AAB38498.1| porin [Mesembryanthemum crystallinum]
Length=276

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGKKARDLLYRDYQTD KF+ITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLYRDYQTDQKFSITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSN+ TTITVDEAAPGLK I SFRVPD
Sbjct  61   KNKNVTTDIKVDTNSNLLTTITVDEAAPGLKTILSFRVPD  100



>ref|XP_009587690.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana tomentosiformis]
 dbj|BAF95072.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKK RDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKTRDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+FTTITVD+AAPGLK I SFRVPD
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVDDAAPGLKTILSFRVPD  100



>ref|XP_009798894.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana sylvestris]
Length=276

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKK RDLLY+DY +DHKFTITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKTRDLLYKDYHSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+FTTITVDEAAPGLK I SFRVPD
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPD  100



>ref|XP_009596455.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   180 bits (456),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK+ARDLLYRDYQTDHKF ITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFAITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I SFR+PD
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPD  100



>ref|XP_006431074.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|ESR44314.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|KDO72482.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
 gb|KDO72483.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
Length=274

 Score =   179 bits (454),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYTDIGKKARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT SN+FTTITVDE APGLK I SF+VPD
Sbjct  61   KNKNITTDLKVDTASNLFTTITVDEPAPGLKTILSFKVPD  100



>ref|XP_006482536.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Citrus sinensis]
Length=274

 Score =   179 bits (454),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYTDIGKKARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT SN+FTTITVDE APGLK I SF+VPD
Sbjct  61   KNKNITTDLKVDTASNLFTTITVDEPAPGLKTILSFKVPD  100



>ref|XP_006361834.1| PREDICTED: uncharacterized LOC102577832 [Solanum tuberosum]
Length=276

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKK RDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+  T+TVDEAAPGLK I S R+PD
Sbjct  61   KNKNITTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPD  100



>gb|ABC01904.1| 34 kDa outer mitochondrial membrane protein porin-like protein 
[Solanum tuberosum]
Length=276

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKK RDLLYRDYQTDHKFTITTYSPTGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+  T+TVDEAAPGLK I S R+PD
Sbjct  61   KNKNITTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPD  100



>ref|XP_010029375.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW56274.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=276

 Score =   176 bits (446),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFTITT+SPTGV +TSTG+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTITTFSPTGVTLTSTGTKKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTTITVDE APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTSSNLFTTITVDEPAPGLKSIFSFKVPD  100



>ref|XP_008443436.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Cucumis melo]
Length=276

 Score =   176 bits (446),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK+ARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+ TTITVDE APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTSSNLVTTITVDEPAPGLKAIFSFKVPD  100



>ref|XP_004147460.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 ref|XP_004168625.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 gb|KGN59595.1| Porin [Cucumis sativus]
Length=276

 Score =   176 bits (446),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK+ARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+ TTITVDE APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTSSNLVTTITVDEPAPGLKAIFSFKVPD  100



>ref|XP_011098570.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK+ARDLLYRDYQ+DHKFTITTYSPTGV +TSTG KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQSDHKFTITTYSPTGVTLTSTGIKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K+KN+TTD KVDT+SN+ TT+TVDE APGLK I SFRVPD
Sbjct  61   KHKNVTTDIKVDTSSNLLTTVTVDEPAPGLKTILSFRVPD  100



>ref|XP_007215668.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
 gb|EMJ16867.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
Length=326

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 2/117 (2%)
 Frame = +3

Query  24   LSPSR-LCFRFSALAAEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITS  200
            L PSR LC  F +L  +M  GPGLYTDIGKKARDLLY+DYQ+DHKFT+TTYSPTGV ITS
Sbjct  35   LIPSRFLCLLFQSLLGKM-VGPGLYTDIGKKARDLLYKDYQSDHKFTVTTYSPTGVAITS  93

Query  201  TGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            +G+KKG+LFL DVNTQLKNKN+TTD KVDT+SN+ TT+TVD+ APGLK I SF+VPD
Sbjct  94   SGTKKGELFLADVNTQLKNKNVTTDIKVDTDSNLSTTVTVDQPAPGLKAIFSFKVPD  150



>ref|XP_007032450.1| Voltage dependent anion channel 1 [Theobroma cacao]
 gb|EOY03376.1| Voltage dependent anion channel 1 [Theobroma cacao]
Length=276

 Score =   174 bits (441),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYTDIGKKARDLLY+DYQTD KFT+TT+SPTGV ITS G+KKGDLF+ DVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQTDQKFTLTTFSPTGVAITSAGTKKGDLFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KN+N+TTD KVDT+SN+FTTITVDE APGLK I SFRVPD
Sbjct  61   KNRNVTTDIKVDTSSNLFTTITVDEPAPGLKTIFSFRVPD  100



>ref|XP_004234781.2| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   174 bits (440),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKK RDLLYRDYQTDHKFTITTYS TGV ITS+G KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSATGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSN+  T+TVDEAAPGLK I S R+PD
Sbjct  61   KNKNLTTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPD  100



>gb|KJB33661.1| hypothetical protein B456_006G024700 [Gossypium raimondii]
Length=276

 Score =   172 bits (436),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQTDHKFT+TT SPTGV ITS G+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDHKFTLTTSSPTGVAITSAGTKKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDT SN++TTITVD+ APGLK I SFRVPD
Sbjct  61   KNKNVTTDIKVDTYSNLYTTITVDQPAPGLKAIFSFRVPD  100



>gb|EPS57816.1| hypothetical protein M569_17001 [Genlisea aurea]
Length=276

 Score =   172 bits (435),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK+ARDLLY+DY +D KFT+TTYSPTGV +TS+G++KGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSSGTRKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSN+FTTITVDE APGLK I SF+VPD
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEPAPGLKTILSFKVPD  100



>ref|XP_010256458.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nelumbo nucifera]
Length=276

 Score =   172 bits (435),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV +TSTG KKG+LFL D+NTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQSDHKFTLTTYTSTGVAVTSTGIKKGELFLADINTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSNVFTTITVDE APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTNSNVFTTITVDEPAPGLKTILSFKVPD  100



>gb|KHG03636.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=276

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQTDHKFT+TT SPTGV ITS G+KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDHKFTLTTSSPTGVAITSAGTKKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDT SN++TTITVD+ APGLK I SFR PD
Sbjct  61   KNKNVTTDIKVDTYSNLYTTITVDQPAPGLKAIFSFRAPD  100



>emb|CDP00287.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGK+ARDLLY+DYQ DHKF++TTYSP GV IT++G KKG+LFLGDVNTQL
Sbjct  1    MVKGPGLYSDIGKRARDLLYKDYQGDHKFSVTTYSPNGVAITASGLKKGELFLGDVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTDFKVDTNS VFTTITVDE APGLK I SF VPD
Sbjct  61   KNKNITTDFKVDTNSKVFTTITVDEPAPGLKTIFSFVVPD  100



>gb|AFK37646.1| unknown [Lotus japonicus]
Length=177

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGK+ARDLL++DY +D KFTITTYSPTGV ITS+G KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIKKGELFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTT+TVDE APGLK I SFRVPD
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPD  100



>sp|P42054.2|VDAC_PEA RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Pisum sativum]
 emb|CAA80988.1| Porin [Pisum sativum]
Length=276

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGKKARDLLY+DY +D KFTI+TYSPTGV ITS+G+KKG+LFLGDVNTQL
Sbjct  1    MVKGPGLYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGELFLGDVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+FTTITV+E APG+K I SF+VP+
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVNEPAPGVKAILSFKVPE  100



>dbj|BAG09387.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
Length=181

 Score =   167 bits (422),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT SN+FTTITV+E APGLK I SFRVPD
Sbjct  61   KNKNITTDIKVDTGSNLFTTITVNEPAPGLKTIFSFRVPD  100



>gb|KDP45473.1| hypothetical protein JCGZ_09722 [Jatropha curcas]
Length=274

 Score =   169 bits (429),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQTD KFTITTYSPTGV ITSTG KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTITTYSPTGVAITSTGLKKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K  N TTD KVDT+SN+FTTITVDE APGLK I SF+VPD
Sbjct  61   KKNNFTTDVKVDTDSNLFTTITVDEPAPGLKAILSFKVPD  100



>emb|CBI32017.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   168 bits (426),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK ARDLLYRDYQ+DHKFT+TTY+ +GV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MGKGPGLYSDIGKIARDLLYRDYQSDHKFTVTTYTSSGVAITSSGTKKGELFIADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF +PD
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKTIFSFIIPD  100



>ref|XP_011010796.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Populus euphratica]
Length=276

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV ITSTG KKG+LFL D+++QL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAITSTGIKKGELFLADISSQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF+VPD
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKTIFSFKVPD  100



>gb|KJB11402.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=276

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K++N+TTD KVDT+SN+FTTITVDE APGLK I  FRVPD
Sbjct  61   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPD  100



>ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Vitis vinifera]
Length=276

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK ARDLLYRDYQ+DHKFT+TTY+ +GV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MGKGPGLYSDIGKIARDLLYRDYQSDHKFTVTTYTSSGVAITSSGTKKGELFIADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF +PD
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKTIFSFIIPD  100



>gb|KJB11403.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   169 bits (427),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K++N+TTD KVDT+SN+FTTITVDE APGLK I  FRVPD
Sbjct  61   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPD  100



>gb|AAQ87020.1| VDAC1.2 [Lotus japonicus]
Length=276

 Score =   168 bits (426),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGK+ARDLL++DY +D KFTITTYSPTGV ITS+G KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIKKGELFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTT+TVDE APGLK I SFRVPD
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPD  100



>ref|XP_003554316.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Glycine max]
Length=276

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT SN+FTTITV+E APGLK I SFRVPD
Sbjct  61   KNKNITTDIKVDTGSNLFTTITVNEPAPGLKTIFSFRVPD  100



>emb|CAJ42303.1| VDAC-like porin [Plantago major]
Length=250

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGK+ARDLLY+DYQTDHKFT+TT SPTGV +TS G+KKGDLFL D+ TQL
Sbjct  22   MGKGPGLYTEIGKRARDLLYKDYQTDHKFTLTTTSPTGVTLTSAGTKKGDLFLADITTQL  81

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTDFKVDT+SN+ TTIT+DE  PG K I SF+VPD
Sbjct  82   KNKNITTDFKVDTSSNLLTTITIDEPCPGTKTILSFKVPD  121



>emb|CAN67632.1| hypothetical protein VITISV_019646 [Vitis vinifera]
Length=175

 Score =   164 bits (416),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQ+DHK TIT+ SPTGV ITS+G+KKGD+F+ DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKLTITSCSPTGVAITSSGTKKGDIFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD K+DT+SN+F T+TVDE APGLK I +F+VPD
Sbjct  61   KNKNITTDVKIDTSSNLFVTVTVDEPAPGLKSIFNFKVPD  100



>ref|XP_002517470.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF45012.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=274

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQTD KFTITTYSPTGV ITSTG KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTITTYSPTGVAITSTGVKKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN+TTD KVDT+SN+FTT TVDE APGLK I S ++PD
Sbjct  61   KQKNVTTDIKVDTDSNLFTTTTVDELAPGLKTILSCKLPD  100



>gb|EYU34113.1| hypothetical protein MIMGU_mgv1a011597mg [Erythranthe guttata]
Length=276

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK+ARDLL RDYQ+D KFT+TT SPTGV +TSTG+KKGDLFL D+NTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLNRDYQSDQKFTLTTCSPTGVTLTSTGTKKGDLFLADINTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K+KN+TTDFKVDT SN+FTT+T+DE APGLK I SF+VPD
Sbjct  61   KHKNVTTDFKVDTGSNLFTTVTIDEPAPGLKTIISFKVPD  100



>ref|XP_008379329.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial outer membrane 
protein porin of 34 kDa-like [Malus domestica]
 ref|XP_009342873.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Pyrus x bretschneideri]
Length=275

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLYTDIGKKARDLLYRDYQ+DHKFTITT+SPTGV ITS+G+KKG+LFL DVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYRDYQSDHKFTITTFSPTGVAITSSGTKKGELFLADVNTQLKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            N+TTD KVDT+SN+ TTITVD+ APGLK I SF+VPD
Sbjct  63   NVTTDVKVDTDSNLSTTITVDQPAPGLKAIFSFKVPD  99



>emb|CDP02196.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKK RDLLY+D+Q+DHKF+ITT SPTGV +TS+G+KKGDLF  DVN QL
Sbjct  1    MAKGPGLYTEIGKKVRDLLYKDFQSDHKFSITTCSPTGVAVTSSGTKKGDLFWADVNAQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTDFKVDTNSN+FT +T+DE  PGLK I SFRVPD
Sbjct  61   KNKNITTDFKVDTNSNLFTAVTIDEPVPGLKTIFSFRVPD  100



>ref|XP_003543710.1| PREDICTED: outer plastidial membrane protein porin-like [Glycine 
max]
Length=276

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD K+DTNSN+ TTITV+E APGLK I SFRVPD
Sbjct  61   KNKNITTDIKLDTNSNLLTTITVNEPAPGLKTIFSFRVPD  100



>gb|KHN13242.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD K+DTNSN+ TTITV+E APGLK I SFRVPD
Sbjct  61   KNKNITTDIKLDTNSNLLTTITVNEPAPGLKTIFSFRVPD  100



>gb|AFK40985.1| unknown [Lotus japonicus]
Length=276

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGK+ARDLL++DY +D KFTITTYSPTGV ITS+G +KG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIEKGELFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTT+TVDE APGLK I SFRVPD
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPD  100



>gb|AAA96275.1| voltage-dependent anion channel protein [Spinacia oleracea]
Length=276

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGK+ARDLLYRDYQ+DHKFT+TTY+  GV ITSTG+KKG+LFL DV+T+L
Sbjct  1    MVKGPGLYSDIGKRARDLLYRDYQSDHKFTLTTYTANGVAITSTGTKKGELFLADVSTKL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
             NKNITTD KVDTNSN+FTTITVDE APGLK I SFRVPD
Sbjct  61   TNKNITTDVKVDTNSNLFTTITVDEPAPGLKAIFSFRVPD  100



>ref|XP_011085778.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK+ARDLLY+DY +D KFT+TTYSPTGV +TS+G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSSGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K+KNITTD KVDTNSN+ TT+TVDE  PGLK I SFRVPD
Sbjct  61   KHKNITTDIKVDTNSNLHTTVTVDEPTPGLKTILSFRVPD  100



>ref|XP_009627246.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana tomentosiformis]
Length=276

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTYS TGV ITS+G KKG+LFL DVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSSTGVAITSSGLKKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSNV+TTITVDE APGLK I SF +PD
Sbjct  61   KNKNVTTDVKVDTNSNVYTTITVDEPAPGLKTIVSFVLPD  100



>ref|XP_009772199.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana sylvestris]
 dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTYS TGV ITS+G KKG+LFL DVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSSTGVAITSSGLKKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSNV+TTITVDE APGLK I SF +PD
Sbjct  61   KNKNVTTDVKVDTNSNVYTTITVDEPAPGLKTIVSFVLPD  100



>gb|KJB60740.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
 gb|KJB60741.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
 gb|KJB60743.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
 gb|KJB60744.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=175

 Score =   164 bits (414),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVD+ SN+FTT+T+DE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPD  100



>ref|XP_004489166.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGKKARDLL++DY +D KF+ITTYSPTGV ITS+G+KKG+LFL DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFSITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDT SN+FTTITV+E APG+K I SF+VPD
Sbjct  61   KNKNVTTDIKVDTESNLFTTITVNEPAPGVKAILSFKVPD  100



>ref|XP_011034213.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Populus euphratica]
Length=276

 Score =   166 bits (421),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV +TSTG KKG+LFL DV+ QL
Sbjct  1    MGKGPGLYADIGKKARDLLYKDYQSDHKFTVTTYTSTGVALTSTGIKKGELFLADVSGQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+ TTIT+DE APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTNSNLLTTITIDEPAPGLKTIFSFKVPD  100



>ref|XP_002312708.1| porin family protein [Populus trichocarpa]
 gb|ABK94257.1| unknown [Populus trichocarpa]
 gb|EEE90075.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   166 bits (420),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV +TSTG KKG+LFL DV+ QL
Sbjct  1    MGKGPGLYVDIGKKARDLLYKDYQSDHKFTVTTYTSTGVALTSTGIKKGELFLADVSGQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+ TTIT+DE APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTNSNLLTTITIDEPAPGLKTIFSFKVPD  100



>gb|AAY82249.1| mitochrondrial voltage-dependent anion-selective channel [Phaseolus 
coccineus]
Length=276

 Score =   166 bits (420),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGKKARDLL++DY +D KFT+TTYSPTGV ITS+G++KG+LFL DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTVTTYSPTGVAITSSGTRKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTTITV+E APGLK I +F+VPD
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFNFKVPD  100



>ref|XP_011085779.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   166 bits (420),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK+ARDLLY+DY +D KFT+TTYSPTGV +TSTG+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSTGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K+KN+TTD KVDT+SN+ TT+TVDE  PGLK I SFRVPD
Sbjct  61   KHKNVTTDIKVDTSSNLHTTVTVDEPTPGLKTILSFRVPD  100



>ref|XP_010242364.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nelumbo nucifera]
Length=276

 Score =   166 bits (420),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLLY+DYQ DHKFT+TT++  GV ITSTG KKG+LFL DVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQNDHKFTLTTFTSAGVAITSTGLKKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSNVFTTITV+E APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTNSNVFTTITVNEPAPGLKTIVSFVVPD  100



>ref|XP_002282471.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Vitis vinifera]
 emb|CAN61274.1| hypothetical protein VITISV_039065 [Vitis vinifera]
 emb|CBI22157.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   166 bits (419),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQ+DHK TIT+ SPTGV ITS+G+KKGD+F+ DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKLTITSCSPTGVAITSSGTKKGDIFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD K+DT+SN+F T+TVDE APGLK I +F+VPD
Sbjct  61   KNKNITTDVKIDTSSNLFVTVTVDEPAPGLKSIFNFKVPD  100



>gb|KJB60742.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=207

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVD+ SN+FTT+T+DE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPD  100



>ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=276

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYTDIGKKARDLLY+DYQ DHKFT+TTY+ TGV ITSTG KKG+++LGD+ +QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQGDHKFTVTTYTSTGVAITSTGIKKGEIYLGDITSQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SNV TTITVDE APGLK I SF++PD
Sbjct  61   KNKNITTDIKVDTSSNVSTTITVDEPAPGLKTIFSFKIPD  100



>ref|XP_006378154.1| porin family protein [Populus trichocarpa]
 gb|ABK92505.1| unknown [Populus trichocarpa]
 gb|ERP55951.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+  GV ITSTG KKG+LFL D+++QL
Sbjct  1    MGKGPGLYFDIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSTGIKKGELFLADISSQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+ TTIT+DE APGLK I SF+VPD
Sbjct  61   KNKNITTDVKVDTNSNLLTTITIDEPAPGLKTIFSFKVPD  100



>ref|XP_010683253.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGK+ARDLLYRDYQ+DHKFT+TT++  GV ITSTG+KKG+LFL DV+T+L
Sbjct  1    MVKGPGLYSDIGKRARDLLYRDYQSDHKFTLTTFTSNGVAITSTGTKKGELFLADVSTKL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
             NKNITTD KVDTNSN+FTTITVDE APGLK I SFRVPD
Sbjct  61   TNKNITTDVKVDTNSNLFTTITVDEPAPGLKAIFSFRVPD  100



>ref|XP_008456460.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis melo]
Length=276

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+  GV I+STG KKGD+FL DV+TQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTAGGVAISSTGVKKGDIFLADVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KN NITTD KVDT+SNV TT+T+DE APGLK I SFRVPD
Sbjct  61   KNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPD  100



>gb|KDO82798.1| hypothetical protein CISIN_1g0238541mg, partial [Citrus sinensis]
Length=174

 Score =   162 bits (410),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY++IGKKARDLLY+DYQ+DHKFT+TTY+  GV ITS+G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPD  100



>gb|KJB60739.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=276

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVD+ SN+FTT+T+DE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPD  100



>ref|NP_001275134.1| mitochondrial outer membrane protein porin of 36 kDa [Solanum 
tuberosum]
 sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 
kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56600.1| 36kDA porin II [Solanum tuberosum]
Length=276

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTYS TGV IT++G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSTTGVAITASGLKKGELFLADVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSNV+TTITVDE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPD  100



>ref|XP_007139603.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
 gb|ESW11597.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
Length=276

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGKKARDLL++DY +D KFT+TTYSPTGV ITS+G++KG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTVTTYSPTGVAITSSGTRKGELFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTTITV+E APGLK I +F+VPD
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFNFKVPD  100



>gb|KDP21225.1| hypothetical protein JCGZ_21696 [Jatropha curcas]
Length=276

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT TTY+  GV ITSTG KKG+LFL DV++QL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQGDHKFTFTTYTAAGVAITSTGIKKGELFLADVSSQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+FTTIT+D+ APGLK I SF++PD
Sbjct  61   KNKNITTDVKVDTNSNLFTTITIDDLAPGLKTIFSFKIPD  100



>ref|XP_010096343.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
 gb|EXB63818.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
Length=276

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLLY+DYQ DHKFTITTY+  GV ITSTG KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQADHKFTITTYTSAGVAITSTGIKKGELFLADVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKAIFSFIVPD  100



>gb|ACU24178.1| unknown [Glycine max]
Length=276

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LFL DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPD  100



>ref|XP_003552508.1| PREDICTED: outer plastidial membrane protein porin-like isoform 
1 [Glycine max]
 gb|KHN13654.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LFL DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPD  100



>ref|NP_001238377.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
 dbj|BAG09368.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
Length=276

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LFL DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPD  100



>ref|XP_009360395.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Pyrus x bretschneideri]
Length=276

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSNV TTITVDE APGLK I SF  PD
Sbjct  61   KNKNITTDVKVDTNSNVITTITVDEPAPGLKAIFSFIAPD  100



>ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Solanum lycopersicum]
Length=276

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLLYRDY +DHKFTITT+S TGV ITS+G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTITTFSTTGVAITSSGLKKGELFLADVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN++TTITVDE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTNSNLYTTITVDEPAPGLKTIFSFVVPD  100



>ref|XP_011005064.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Populus euphratica]
Length=274

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY++IGKKARDLLY+DYQTDHKFT+ T SPTGV ITS+G+KKGDL   DVNTQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQTDHKFTLNTSSPTGVTITSSGTKKGDLLAADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K+KNITTD KVDT+SN+FTTITVDE APGLK I SF+VPD
Sbjct  61   KSKNITTDIKVDTSSNLFTTITVDEPAPGLKTIFSFKVPD  100



>ref|XP_004297335.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   164 bits (414),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLLYRDYQTDHKFT+TT + +GV ITS+G KKGDL LGDV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYQTDHKFTVTTLTASGVAITSSGIKKGDLLLGDVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+  TITVDE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTNSNLLATITVDEPAPGLKAILSFIVPD  100



>ref|XP_002324035.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
 gb|ABK94151.1| unknown [Populus trichocarpa]
 gb|EEF04168.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
Length=274

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M  GPGLY++IGKKARDLLY+DYQTDHKFT+ T SPTGV ITS+G+KKGDL   DVNTQL
Sbjct  1    MVNGPGLYSEIGKKARDLLYKDYQTDHKFTLNTSSPTGVTITSSGTKKGDLLAADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTTITVDE APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTSSNLFTTITVDEPAPGLKTIFSFKVPD  100



>ref|XP_004489372.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLLYRDY +D KFTITTYSPTGV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLYRDYNSDQKFTITTYSPTGVAITSSGTKKGELFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KN+NITTD KVDT+SN+ TTITV+E APG+K + SFR+PD
Sbjct  61   KNRNITTDIKVDTDSNLSTTITVNEPAPGVKTVLSFRIPD  100



>ref|XP_004146750.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
 ref|XP_004162535.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
Length=276

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+  GV I+STG KKG++FL DV+TQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSGGVAISSTGIKKGEIFLADVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KN NITTD KVDT+SNV TT+T+DE APGLK I SFRVPD
Sbjct  61   KNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPD  100



>emb|CAA56601.1| 36kDa porin I [Solanum tuberosum]
Length=276

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTYS TGV IT++G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSTTGVAITASGLKKGELFLADVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVD NSNV+TTITVDE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDANSNVYTTITVDEPAPGLKTIFSFVVPD  100



>ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Citrus sinensis]
Length=276

 Score =   163 bits (413),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY++IGKKARDLLY+DYQ+DHKFT+TTY+  GV ITS+G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPD  100



>ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
 gb|ESR51860.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
Length=276

 Score =   163 bits (413),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY++IGKKARDLLY+DYQ+DHKFT+TTY+  GV ITS+G KKG+LFL DV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+FTTITVDE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPD  100



>gb|KHG20441.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   163 bits (412),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L DVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD K D+ SN+FTT+T+DE APGLK I SF VPD
Sbjct  61   KNKNITTDVKFDSRSNLFTTVTIDEPAPGLKTIFSFVVPD  100



>ref|XP_008230727.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Prunus mume]
Length=275

 Score =   163 bits (412),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLYTDIGKKARDLLY+DYQ+D KFT+TTYSPTGV ITS+G+KKG+LFL DVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYKDYQSDQKFTVTTYSPTGVAITSSGTKKGELFLADVNTQLKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            N+TTD KVDT+SN+ TT+TVD+ APGLK I SF+VPD
Sbjct  63   NVTTDIKVDTDSNLSTTVTVDQPAPGLKAIFSFKVPD  99



>gb|AAQ87019.1| VDAC1.1 [Lotus japonicus]
 gb|AFK40743.1| unknown [Lotus japonicus]
Length=276

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGKKARDLL++DY +D KFTITT+SPTGV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTITTFSPTGVAITSSGTKKGELFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTTI V++ APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTDSNLFTTIAVNDPAPGLKAIFSFKVPD  100



>emb|CDP00288.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGK+ARDLLY+DYQ DHKFT+TTY+  GV ITS+G KKG+LFL DVNTQL
Sbjct  1    MVKGPGLYSDIGKRARDLLYKDYQGDHKFTVTTYTANGVAITSSGIKKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNS VFTTITVDE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTNSKVFTTITVDEPAPGLKTIISFVVPD  100



>ref|XP_010066951.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Eucalyptus grandis]
 gb|KCW65006.1| hypothetical protein EUGRSUZ_G02544 [Eucalyptus grandis]
Length=276

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLLY+DYQ DHKFTITTY+ TG+ +TSTG KKG+ FL DV+TQL
Sbjct  1    MAKGPGLYSDIGKKARDLLYKDYQGDHKFTITTYTSTGIALTSTGIKKGEFFLADVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKTIFSFIVPD  100



>gb|KJB11404.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQTD KFT+TT SPTG  ITS G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGA-ITSAGTKKGDLFLADVNTQL  59

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K++N+TTD KVDT+SN+FTTITVDE APGLK I  FRVPD
Sbjct  60   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPD  99



>gb|AFK39621.1| unknown [Lotus japonicus]
Length=276

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGKKARDLL++DY +D KFTITT+SPTGV ITS+G+KKG+LF+ DVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTITTFSPTGVAITSSGTKKGELFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTTI V++ APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTDSNLFTTIAVNDPAPGLKAIFSFKVPD  100



>ref|XP_008389525.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Malus domestica]
Length=276

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSNV TTITVDE +PGLK I SF  PD
Sbjct  61   KNKNITTDVKVDTNSNVITTITVDEPSPGLKAIFSFIAPD  100



>gb|KHN11584.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LF+ DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPD  100



>gb|ACU20122.1| unknown [Glycine max]
Length=276

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLL++DY +D KFTITTYSPTGV IT++G++K +LF+ DVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFVADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+FTTITV+E APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPD  100



>ref|XP_010524325.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+DYQ D KFTITTYSPTGV ITSTG+KKGD+FL DV TQL
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQNDQKFTITTYSPTGVAITSTGTKKGDVFLADVATQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KV T+S + TTITVDE APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVGTDSTLLTTITVDEPAPGLKSIFSFKVPD  100



>ref|XP_010550070.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+DYQ+D KF+ITTYSPTGV ITSTG KKGDLFL DV TQL
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQSDQKFSITTYSPTGVAITSTGIKKGDLFLADVATQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KV T+S + TTITVDE APGLK I SF+VPD
Sbjct  61   KNKNITTDIKVGTDSTLLTTITVDEPAPGLKSIFSFKVPD  100



>gb|KGN47800.1| hypothetical protein Csa_6G404150 [Cucumis sativus]
Length=342

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKARDLLY+DYQ+DHKFT+TTY+  GV I+STG KKG++FL DV+TQL
Sbjct  67   MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSGGVAISSTGIKKGEIFLADVSTQL  126

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KN NITTD KVDT+SNV TT+T+DE APGLK I SFRVPD
Sbjct  127  KNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPD  166



>ref|XP_004302356.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   161 bits (408),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M  GPGLYT+IGKKARDLLY+DYQ+DHKFTITTYSPTGV ITS+G+KKGD+FL DV TQL
Sbjct  1    MANGPGLYTEIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDVFLADVTTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K +N+TTD KVDT SN+ TTITVD+  PG+K I SF+VPD
Sbjct  61   KKQNVTTDIKVDTESNLLTTITVDQPCPGVKAILSFKVPD  100



>ref|XP_007046222.1| Mitochondrial outer membrane protein porin 1 isoform 2, partial 
[Theobroma cacao]
 gb|EOY02054.1| Mitochondrial outer membrane protein porin 1 isoform 2, partial 
[Theobroma cacao]
Length=224

 Score =   159 bits (403),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY++IGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L DV+TQL
Sbjct  28   MGKGPGLYSEIGKKARDLLYKDYQGDHKFTVTTYTSDGVAITSTGIKKGELLLADVSTQL  87

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+S +FTT+TVDE APGLK I SF VPD
Sbjct  88   KNKNITTDVKVDTSSKLFTTVTVDEPAPGLKTIFSFVVPD  127



>ref|XP_010670319.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   160 bits (406),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGKKARDLLY+DYQTD KF+ITTYS TGV +TS G+K+GDLF GDV+T+L
Sbjct  1    MAKGPGLYTDIGKKARDLLYKDYQTDQKFSITTYSATGVALTSCGTKEGDLFFGDVSTKL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K  NITTD KVDTNSN+ TTITVD AAPGLK I SF+VPD
Sbjct  61   KKNNITTDIKVDTNSNLVTTITVDGAAPGLKTILSFKVPD  100



>gb|EYU34669.1| hypothetical protein MIMGU_mgv1a011608mg [Erythranthe guttata]
Length=276

 Score =   160 bits (406),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGK+ARDLL +DY +D KFT+TTYSPTGV +TS+G+KKG+LFL DVNTQ 
Sbjct  1    MGKGPGLYSDIGKRARDLLNKDYNSDQKFTLTTYSPTGVTLTSSGTKKGELFLADVNTQF  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDT+SN+FTTITVDE  PGLK I SF+ PD
Sbjct  61   KNKNVTTDIKVDTSSNLFTTITVDELTPGLKTILSFKAPD  100



>ref|XP_008339931.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Malus domestica]
Length=276

 Score =   160 bits (406),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KG+L+LGDV+TQL
Sbjct  1    MVKGPGLYFDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGELYLGDVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+ TTIT+DE APGLK I SF  PD
Sbjct  61   KNKNITTDVKVDTNSNLLTTITIDEPAPGLKAIFSFIAPD  100



>gb|EYU22439.1| hypothetical protein MIMGU_mgv1a011543mg [Erythranthe guttata]
Length=278

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  78   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  257
            KGPGLY DIGK+ARDLLY+DYQ DHKFT+TTYS  G+ ITSTG+KKG+L LGDVNTQLKN
Sbjct  5    KGPGLYPDIGKRARDLLYKDYQGDHKFTLTTYSSNGLAITSTGTKKGELILGDVNTQLKN  64

Query  258  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNITTD KVDTNSNV TTITVDE APG+K I SF  PD
Sbjct  65   KNITTDLKVDTNSNVCTTITVDEPAPGVKAIISFAAPD  102



>gb|AAD38145.1|AF139498_1 porin [Prunus armeniaca]
Length=276

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+ TTIT+DE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPD  100



>ref|XP_008221678.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Prunus mume]
Length=276

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+ TTIT+DE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPD  100



>gb|AFK34190.1| unknown [Medicago truncatula]
 gb|KEH24972.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLLY+DY TD KFT+TTYSPTG+ +T++ +KKG+LFL D+NTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLYKDYNTDQKFTLTTYSPTGIALTASSTKKGELFLADINTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K+KN+TTD KVDT+SN+FTTITV E APGLK I SFR+P+
Sbjct  61   KHKNVTTDIKVDTDSNLFTTITVTEPAPGLKTILSFRIPE  100



>ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLLYRDY +DHKFT+TTY+  GV ITS+G KKG+  L DVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYTSNGVAITSSGVKKGEFLLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN TTD KVDTNSNV+TTITVDE APGLK I SF VPD
Sbjct  61   KNKNFTTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPD  100



>gb|AID59897.1| voltage-dependent anion channel protein [Prunus persica]
Length=276

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+ TTIT+DE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPD  100



>ref|XP_008341536.1| PREDICTED: outer plastidial membrane protein porin-like [Malus 
domestica]
Length=275

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLYTDIGKKARDLLY+DYQ+D KFTITT+SPTGV IT++G+ KG+LFLGDVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYKDYQSDKKFTITTFSPTGVAITTSGTNKGELFLGDVNTQLKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            N+TTD KVDT+SN+ TTITVD+ APGLK I  F+VPD
Sbjct  63   NVTTDIKVDTDSNLSTTITVDQPAPGLKAIFCFKVPD  99



>ref|XP_010033217.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW52798.1| hypothetical protein EUGRSUZ_J02133 [Eucalyptus grandis]
Length=276

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKA+DLLY+DYQ+DHKFTITT S TGV ITS  +KKG+LFL DVNTQL
Sbjct  1    MGKGPGLYSDIGKKAKDLLYKDYQSDHKFTITTSSVTGVTITSAATKKGELFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSN+ T ITVDE  PGLK I SF VPD
Sbjct  61   KNKNVTTDVKVDTNSNLVTKITVDEPFPGLKTIFSFTVPD  100



>ref|XP_007046221.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
 gb|EOY02053.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
Length=276

 Score =   158 bits (400),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY++IGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L DV+TQL
Sbjct  1    MGKGPGLYSEIGKKARDLLYKDYQGDHKFTVTTYTSDGVAITSTGIKKGELLLADVSTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+S +FTT+TVDE APGLK I SF VPD
Sbjct  61   KNKNITTDVKVDTSSKLFTTVTVDEPAPGLKTIFSFVVPD  100



>pir||B55017 porin, plastid - garden pea
Length=275

 Score =   158 bits (399),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGKKARDLLY+DY +D KFTI+TYSPTGV ITS+G+KKG L LGDVNTQL
Sbjct  1    MVKGPGLYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGFLELGDVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITT  KVDTNSN+FTTITV+E APG+K I S +VP+
Sbjct  61   KNKNITTQIKVDTNSNLFTTITVNEPAPGVKAILSEKVPE  100



>ref|XP_009599229.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   158 bits (399),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M  GPGLY+DIGKKARDLLYRDY +DHKFT+TTY+  GV ITS+G KKG+  L DVNTQL
Sbjct  1    MVMGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYTSNGVAITSSGVKKGEFLLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN TTD KVDTNSNV+TTITVDE APGLK I SF VPD
Sbjct  61   KNKNFTTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPD  100



>ref|XP_007222361.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
 gb|EMJ23560.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
Length=344

 Score =   159 bits (403),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY DIGKKARDLLY+DYQ+DHKFT+TTY+ TGV I+STG +KGDL+LGDV+TQL
Sbjct  69   MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  128

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDT+SN+ TTIT+DE APGLK I SF VPD
Sbjct  129  KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPD  168



>ref|XP_011086392.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Sesamum indicum]
Length=278

 Score =   157 bits (398),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  78   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  257
            KGPGLY+DIGKKARDLLYRDYQ D KFT+TTY+  GV ITS+G++KGDLFL D+NTQLKN
Sbjct  5    KGPGLYSDIGKKARDLLYRDYQGDQKFTLTTYTSNGVAITSSGTRKGDLFLADINTQLKN  64

Query  258  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNITTD KVDT SNV+TTITVDE APG+K I SF  PD
Sbjct  65   KNITTDVKVDTYSNVYTTITVDEPAPGVKAIVSFVAPD  102



>ref|XP_006842115.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
 gb|ERN03790.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
Length=276

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY++IGKKARDLLY+DY +D KF +TTY+ TGV ITS+G+KKGDLFL DV TQL
Sbjct  1    MGKGPGLYSEIGKKARDLLYKDYHSDQKFILTTYTSTGVAITSSGTKKGDLFLADVTTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSN+ TTITVDEAAPGLK I S   PD
Sbjct  61   KNKNVTTDIKVDTNSNLSTTITVDEAAPGLKTIFSCIFPD  100



>gb|KJB50696.1| hypothetical protein B456_008G182700 [Gossypium raimondii]
Length=276

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYTDIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L D++T+L
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQADHKFTLTTYTSNGVAITSTGTKKGELLLADISTEL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITT+ KVDT+S +F T+TVDE APGLK I SF  PD
Sbjct  61   KNKNITTNVKVDTSSKLFATVTVDEPAPGLKTIFSFIAPD  100



>gb|KJB30016.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=184

 Score =   153 bits (386),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L DV+T+L
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KN NITT+ KVDT S +F T+TVDE APGLK I SF VPD
Sbjct  61   KNNNITTNVKVDTKSTLFATVTVDEPAPGLKTIFSFIVPD  100



>gb|KHG13762.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   155 bits (393),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKK+RDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L DV+T+L
Sbjct  1    MGKGPGLYSDIGKKSRDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KN NITT+ KVDT SN+F T+TVDE APGLK I SF VPD
Sbjct  61   KNNNITTNVKVDTKSNLFATVTVDEPAPGLKTIFSFIVPD  100



>ref|XP_003621109.1| Outer plastidial membrane protein porin [Medicago truncatula]
 gb|AES77327.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=277

 Score =   155 bits (392),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  75   GKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLK  254
             KGPGLYTDIGKKARDLL++DY +D KFT++TYSPTGV ITS+G+KKG+LF+GDVNTQLK
Sbjct  3    AKGPGLYTDIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGTKKGELFVGDVNTQLK  62

Query  255  NKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            NKN T D KVDT SN+FTTITV E APG+K I S +VPD
Sbjct  63   NKNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPD  101



>gb|AFK38338.1| unknown [Medicago truncatula]
Length=277

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  75   GKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLK  254
             KGPGLYTDIGKKARDLL++DY +D KFT++TYSPTGV ITS+G+KKG+LF+GDVNTQLK
Sbjct  3    AKGPGLYTDIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGTKKGELFVGDVNTQLK  62

Query  255  NKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            NKN T D KVDT SN+FTTITV E APG+K I S +VPD
Sbjct  63   NKNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPD  101



>ref|XP_011071026.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Sesamum indicum]
Length=278

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  78   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  257
            KGPGLY+DIGK+ARDLLY+DYQ D KFT+TT +  GV+ITS+G+KKG+LFL DVNTQLKN
Sbjct  5    KGPGLYSDIGKRARDLLYKDYQGDQKFTLTTCTSNGVIITSSGTKKGELFLADVNTQLKN  64

Query  258  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNITTD KVDTNSNV TTITVDE APG+K I SF  PD
Sbjct  65   KNITTDVKVDTNSNVHTTITVDEPAPGVKAIFSFVAPD  102



>gb|AAQ87021.1| VDAC1.3 [Lotus japonicus]
Length=276

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGKKARDLL++DYQ DHKFTITTY+  GV ITSTG KKG+++L DV+T+L
Sbjct  1    MVKGPGLYSDIGKKARDLLFKDYQNDHKFTITTYTSAGVEITSTGVKKGEIYLADVSTKL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF  PD
Sbjct  61   KNKNITTDVKVDTNSNLHTTITVDEPAPGLKTIFSFIFPD  100



>gb|ACJ85253.1| unknown [Medicago truncatula]
Length=277

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  75   GKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLK  254
             KGPGLYT+IGKKARDLL++DY +D KFT++TYSPTGV ITS+G+KKG+LF+GDVNTQLK
Sbjct  3    AKGPGLYTNIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGAKKGELFVGDVNTQLK  62

Query  255  NKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            NKN T D KVDT SN+FTTITV E APG+K I S +VPD
Sbjct  63   NKNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPD  101



>gb|KJB30018.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
 gb|KJB30019.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=276

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L DV+T+L
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KN NITT+ KVDT S +F T+TVDE APGLK I SF VPD
Sbjct  61   KNNNITTNVKVDTKSTLFATVTVDEPAPGLKTIFSFIVPD  100



>gb|KHG10147.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=271

 Score =   153 bits (387),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 84/100 (84%), Gaps = 5/100 (5%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K++N+TTD KVDT+SN      +DE APGLK I  FRVPD
Sbjct  61   KSRNVTTDIKVDTSSNA-----IDEPAPGLKAIFGFRVPD  95



>gb|ACU19720.1| unknown [Glycine max]
Length=241

 Score =   152 bits (384),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITTY+ TGV ITSTG +KG+++L DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF  PD
Sbjct  61   KNKNITTDVKVDTNSNLRTTITVDEPAPGLKTIFSFNFPD  100



>gb|EYU28705.1| hypothetical protein MIMGU_mgv1a011554mg [Erythranthe guttata]
Length=278

 Score =   153 bits (386),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  78   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  257
            KGPGLY DIGK+ARDLLY+DYQ D KFT+TTY+  GV ITS+G++KGDLFL DV+TQ+KN
Sbjct  5    KGPGLYPDIGKRARDLLYKDYQGDQKFTLTTYTSNGVAITSSGTQKGDLFLADVSTQMKN  64

Query  258  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNITTD KVDTNSNV+TT TVDE APG+K I SF  PD
Sbjct  65   KNITTDVKVDTNSNVYTTFTVDEPAPGVKAIFSFVAPD  102



>ref|XP_003532049.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Glycine max]
 gb|KHN13488.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITTY+ TGV ITSTG +KG+++L DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF  PD
Sbjct  61   KNKNITTDVKVDTNSNLRTTITVDEPAPGLKTIFSFNFPD  100



>ref|XP_006408480.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
 gb|ESQ49933.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
Length=341

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 93/133 (70%), Gaps = 16/133 (12%)
 Frame = +3

Query  3    PELSH*NLSPSRLCFRFS----------ALAAEMGKGPGLYTDIGKKARDLLYRDYQTDH  152
            P+LS       RL  RFS             A+M KGPGLYTDIGKKARDLLY+D+ +D 
Sbjct  39   PQLSF------RLYLRFSDSVELSFLSFTTEAKMVKGPGLYTDIGKKARDLLYKDHNSDQ  92

Query  153  KFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDEAA  332
            K +ITTYSP GV ITSTG+KKGDL LGDV  Q K KNITTDFKV T+S V  T TVDEAA
Sbjct  93   KLSITTYSPAGVAITSTGTKKGDLLLGDVAFQSKQKNITTDFKVCTDSTVLITATVDEAA  152

Query  333  PGLKIISSFRVPD  371
            PGLK I SF+VPD
Sbjct  153  PGLKSIFSFKVPD  165



>ref|NP_001241054.1| uncharacterized protein LOC100805016 [Glycine max]
 gb|ACU21099.1| unknown [Glycine max]
 gb|KHN31779.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   150 bits (379),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITTY+ TGV ITSTG +KG+++L DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+ T ITVDE APGLK I SF  PD
Sbjct  61   KNKNITTDVKVDTNSNLRTIITVDEPAPGLKTIFSFNFPD  100



>ref|XP_009131920.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Brassica 
rapa]
Length=276

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYTDIGKKARDLLY+D+ +D K +ITTYSP GV ITSTG+KKG+  LGDV  QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDVVFQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KNITTDFKV T++ V  T TVDEAAPGLK I SF+ PD
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPD  100



>emb|CDY28690.1| BnaCnng05760D [Brassica napus]
Length=276

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYTDIGKKARDLLY+D+ +D K +ITTYSP GV ITSTG+KKG+  LGDV  QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDVVFQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KNITTDFKV T++ V  T TVDEAAPGLK I SF+ PD
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPD  100



>ref|XP_004514771.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cicer arietinum]
Length=276

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGK+ARDLL++DYQ DHKFT+TT + +GV ITS+G +KG++FL DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTVTTQTLSGVEITSSGVRKGEIFLADVSTKV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITTD KVDTNSN+ TTITVDE APGLK I SF  PD
Sbjct  61   KNKNITTDIKVDTNSNLLTTITVDEPAPGLKTIFSFIFPD  100



>emb|CDY66736.1| BnaCnng52100D [Brassica napus]
Length=276

 Score =   148 bits (374),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPG YTDIGKKARDLLY+D+ +D K +ITT+SP GV ITSTG+KKGD  LGDV+ QL
Sbjct  1    MGKGPGRYTDIGKKARDLLYKDHNSDQKLSITTHSPAGVAITSTGTKKGDSLLGDVSLQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KNITTD KV T+S V  T TVDEAAPGLK I SFR PD
Sbjct  61   KQKNITTDLKVSTDSTVLITATVDEAAPGLKSIFSFRAPD  100



>ref|XP_006298185.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31083.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=309

 Score =   149 bits (376),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +3

Query  66   AEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNT  245
            A M KGPGLYT+IGKKARDLLYRD+ +D KF+ITTYSP GV ITS+G+KKGDL LGDV  
Sbjct  32   ATMVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDLLLGDVAF  91

Query  246  QLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            Q + KN+TTDFKV T+S V  T TVDEAAPGLK I SF+ PD
Sbjct  92   QSRQKNVTTDFKVCTDSTVLITATVDEAAPGLKSIFSFKAPD  133



>gb|AAW22621.1| outer mitochondrial membrane protein porin 1 [Brassica napus]
Length=276

 Score =   148 bits (374),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPG YTDIGKKARDLLY+D+ +D K +ITT+SP GV ITSTG+KKGD  LGDV+ QL
Sbjct  1    MGKGPGRYTDIGKKARDLLYKDHNSDQKLSITTHSPAGVAITSTGTKKGDSLLGDVSLQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KNITTD KV T+S V  T TVDEAAPGLK I SFR PD
Sbjct  61   KQKNITTDLKVSTDSTVLITATVDEAAPGLKSIFSFRAPD  100



>ref|XP_010512938.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Camelina 
sativa]
Length=276

 Score =   148 bits (373),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLYRD+ +D KF+ITTYSP GV ITSTG+KKGD+ LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSTGTKKGDVLLGDVAFQS  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            + KN+TTDFKV T+S V  T TVDEAAPGLK I SF+ PD
Sbjct  61   RQKNVTTDFKVCTDSTVLITATVDEAAPGLKSIFSFKAPD  100



>emb|CDX91952.1| BnaC03g32540D [Brassica napus]
Length=276

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGKK RDLLY+D+ +DHK +ITT+SP GV ITSTG+KKGDL LGDV  QL
Sbjct  1    MVKGPGLYTDIGKKVRDLLYKDHNSDHKLSITTHSPAGVAITSTGTKKGDLLLGDVTFQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KNITTD +V T++ V  T TVDEAAPGLK I SFR PD
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPD  100



>emb|CDY68122.1| BnaA05g37480D [Brassica napus]
Length=276

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYTDIGKKA+DLLY+D+ +D KF+ITT SP GV ITS+G+KKGD  LGDV+ QL
Sbjct  1    MGKGPGLYTDIGKKAKDLLYKDHNSDQKFSITTQSPAGVGITSSGTKKGDSLLGDVSLQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KNITTD KV T++ V  T TVDEAAPGLK I SFR PD
Sbjct  61   KQKNITTDLKVSTDNTVLITATVDEAAPGLKSIFSFRAPD  100



>ref|XP_009125035.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYTDIGKKARDLLY+D+ +D K +ITTYSP GV ITSTG+KKG+  LGD   QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDGGFQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KNITTDFKV T++ V  T TVDEAAPGLK I SF+ PD
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPD  100



>ref|XP_007153842.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
 gb|ESW25836.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
Length=276

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGK+ RDLL++DYQ DHKFTITT + TGV ITSTG +KG+L+L D++T+L
Sbjct  1    MVKGPGLYTDIGKRTRDLLFKDYQNDHKFTITTQTSTGVEITSTGVRKGELYLADISTKL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNIT+D KVDTNS++ TTITVDE APGLK I SF  PD
Sbjct  61   KNKNITSDIKVDTNSSLRTTITVDEPAPGLKAIFSFIFPD  100



>ref|XP_009147408.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYTDIGKKA+DLLY+D+ +D KF+ITT SP GV ITS+G+KKGD  LGDV+ QL
Sbjct  1    MGKGPGLYTDIGKKAKDLLYKDHNSDQKFSITTQSPAGVGITSSGTKKGDSLLGDVSLQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KNITTD KV T++ V  T TVDEAAPGLK I SFR PD
Sbjct  61   KQKNITTDLKVSTDNTVLITATVDEAAPGLKSIFSFRAPD  100



>ref|XP_002884286.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60545.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+D+ +D KF+ITT+SP GV ITSTG+KKGDL LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            + KNITTD KV T+S V  T TVDEAAPGLK I SF+VPD
Sbjct  61   RQKNITTDLKVCTDSTVLITATVDEAAPGLKSIFSFKVPD  100



>gb|AAS48868.1| voltage-dependent anion-selective channel [Brassica rapa subsp. 
pekinensis]
 emb|CDY69321.1| BnaA10g29750D [Brassica napus]
Length=276

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQ D K +ITTYS TGV IT++G+ KGDLFLGDV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSSTGVAITTSGTNKGDLFLGDVVTQI  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN T D KV ++S++ TT T DEA PGLK I S +VPD
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKAIVSAKVPD  100



>gb|ABK24200.1| unknown [Picea sitchensis]
Length=276

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKK RDLL +DY  D KF+ T+Y+ TG+  TSTG KKG+ FLGD+NTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLNKDYNFDQKFSFTSYTSTGLAFTSTGIKKGEFFLGDLNTQL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KN N+TTD KVDT+SN+F T+T+DE APGLK I SF VPD
Sbjct  61   KNNNVTTDIKVDTSSNLFATVTIDEPAPGLKTILSFTVPD  100



>ref|XP_010463547.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLYRD+ +D KF+ITTYSP GV ITS+G+KKGD+ LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDVLLGDVAFQS  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN+TTD KV T+S V  T TVDEAAPGLK I SF+ PD
Sbjct  61   KQKNVTTDLKVCTDSTVLITATVDEAAPGLKSIFSFKAPD  100



>ref|XP_010485517.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLYRD+ +D KF+ITTYSP GV ITS+G+KKGD+ LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDVLLGDVAFQS  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN+TTD KV T+S V  T TVDEAAPGLK I SF+ PD
Sbjct  61   KQKNVTTDLKVCTDSTVLITATVDEAAPGLKSIFSFKAPD  100



>gb|KFK25745.1| hypothetical protein AALP_AA8G154100 [Arabis alpina]
Length=276

 Score =   145 bits (365),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+DYQ DHK T+TT S TGVVIT+TG  KG+LF+GDV TQ+
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQGDHKLTVTTSSETGVVITTTGINKGNLFVGDVATQV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN T D KV T+S++ TT+T DEAAPGLK I S ++PD
Sbjct  61   KNKNFTADLKVATDSSLLTTLTYDEAAPGLKTILSAKLPD  100



>ref|NP_001288856.1| mitochondrial outer membrane protein porin 3-like [Brassica rapa]
 gb|AAS21632.1| voltage-dependent anion-selective channel protein [Brassica rapa]
Length=276

 Score =   144 bits (364),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQ D K +IT YS TGV IT++G+ KGDLFLGDV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITAYSSTGVAITTSGTNKGDLFLGDVVTQI  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN T D KV ++S++ TT T DEA PGLK I S +VPD
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKAIVSAKVPD  100



>gb|AAM62480.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
Length=274

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLYRDYQ D KF++TTYS TGV IT+TG+ KG LFLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN T D KV T+S++ TT+T DE APGLK+I   ++PD
Sbjct  61   KNKNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPD  100



>ref|XP_010492333.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN T D KV T+S++ TT TVDE  PG+K I S R+PD
Sbjct  61   KNKNFTADIKVSTDSSLVTTFTVDEPTPGVKAILSARLPD  100



>gb|KHG01383.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
 gb|KHG16984.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=270

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 81/100 (81%), Gaps = 6/100 (6%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYTDIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG+KKG+L L D++T+L
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQADHKFTLTTYTSNGVAITSTGTKKGELLLADISTEL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKNITT+ K      +F T+TVDE APGLK I SF  PD
Sbjct  61   KNKNITTNVK------LFATVTVDEPAPGLKTIFSFIAPD  94



>ref|XP_009134621.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGKK RDLLY+D+ +DHK +ITT+SP GV ITSTG+KKGDL LGDV   L
Sbjct  1    MVKGPGLYTDIGKKVRDLLYKDHNSDHKLSITTHSPAGVAITSTGTKKGDLLLGDVGFLL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KNITTD +V T++ V  T TVDEAAPGLK I SFR PD
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPD  100



>gb|KFK37589.1| hypothetical protein AALP_AA3G002700 [Arabis alpina]
Length=276

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTD+GKKARDL+Y+D+ +D KF+I+TYSPTGV ITSTG KKG+L +GDV  Q 
Sbjct  1    MVKGPGLYTDVGKKARDLIYKDHNSDQKFSISTYSPTGVAITSTGIKKGELLVGDVAFQS  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN+TTD KV T+S V  T TVDEAAPGLK I SF+VPD
Sbjct  61   KQKNVTTDLKVCTDSTVLVTATVDEAAPGLKSIFSFKVPD  100



>emb|CDY59668.1| BnaCnng35410D [Brassica napus]
Length=276

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLYT+IGKKARDLLY+DYQ D K +ITTYS TGV IT++G+ KGDLF+GDV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSSTGVSITTSGTNKGDLFVGDVATQV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN T D KV ++S++ TT T DEA PGLK I S +VPD
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKTIVSAKVPD  100



>ref|NP_186777.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
 sp|Q9SRH5.3|VDAC1_ARATH RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=AtVDAC1; Short=VDAC-1 [Arabidopsis thaliana]
 gb|AAF03498.1|AC010676_8 putative porin [Arabidopsis thaliana]
 gb|AAK59817.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AAM47472.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AEE73632.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
Length=276

 Score =   143 bits (360),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+D+ +D KF+ITT+SP GV ITSTG+KKGDL LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            + KNITTD KV T+S    T TVDEAAPGL+ I SF+VPD
Sbjct  61   RRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPD  100



>gb|AAM65525.1| putative porin [Arabidopsis thaliana]
Length=276

 Score =   143 bits (360),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+D+ +D KF+ITT+SP GV ITSTG+KKGDL LGDV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            + KNITTD KV T+S    T TVDEAAPGL+ I SF+VPD
Sbjct  61   RRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPD  100



>gb|KEH19833.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   142 bits (359),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITT +  GV ITS G +KG+ FL DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTQTLAGVEITSAGVRKGEAFLADVSTKV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSN+ TTITVDE  PGLK I SF  P+
Sbjct  61   KNKNVTTDIKVDTNSNLRTTITVDETVPGLKTIFSFIYPE  100



>gb|ACJ85279.1| unknown [Medicago truncatula]
 gb|AFK33360.1| unknown [Medicago truncatula]
 gb|KEH19832.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=276

 Score =   142 bits (359),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLY+DIGK+ARDLL++DYQ DHKFTITT +  GV ITS G +KG+ FL DV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTQTLAGVEITSAGVRKGEAFLADVSTKV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+TTD KVDTNSN+ TTITVDE  PGLK I SF  P+
Sbjct  61   KNKNVTTDIKVDTNSNLRTTITVDETVPGLKTIFSFIYPE  100



>gb|EAZ08792.1| hypothetical protein OsI_31052 [Oryza sativa Indica Group]
Length=274

 Score =   142 bits (359),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY +IGKKARDLLYRDYQTDHKFT+TTY+  GV IT+T +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            NIT D K +++SNV TT+TVDE  PGLK I SF VPD
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPD  99



>emb|CDY63765.1| BnaCnng42590D [Brassica napus]
Length=276

 Score =   142 bits (359),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+DYQ D K ++TTYS TGV IT+TG+ KGDLF+GDV+TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVSTQV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN T D KV T+S++ TT T DEA PGLK I S +VPD
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPD  100



>ref|NP_001062983.1| Os09g0361400 [Oryza sativa Japonica Group]
 sp|Q6K548.3|VDAC1_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=OsVDAC1 [Oryza sativa Japonica Group]
 emb|CAB82853.1| voltage-dependent anion channel [Oryza sativa]
 dbj|BAD23330.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAF24897.1| Os09g0361400 [Oryza sativa Japonica Group]
 dbj|BAG87823.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87525.1| unnamed protein product [Oryza sativa Japonica Group]
Length=274

 Score =   142 bits (359),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY +IGKKARDLLYRDYQTDHKFT+TTY+  GV IT+T +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            NIT D K +++SNV TT+TVDE  PGLK I SF VPD
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPD  99



>ref|XP_006660565.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Oryza brachyantha]
Length=274

 Score =   142 bits (358),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY +IGKKARDLLYRDYQTDHKFT+TTY+  GV IT+T +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            NIT D K +++SNV TT+TVDE  PGLK I SF VPD
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPD  99



>gb|EAZ44453.1| hypothetical protein OsJ_29066 [Oryza sativa Japonica Group]
Length=274

 Score =   142 bits (358),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY +IGKKARDLLYRDYQTDHKFT+TTY+  GV IT+T +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            NIT D K +++SNV TT+TVDE  PGLK I SF VPD
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPD  99



>ref|NP_197013.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 ref|NP_001190314.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 sp|Q9SMX3.3|VDAC3_ARATH RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Protein HYPERSENSITIVE RESPONSE 2; Short=Athsr2; 
AltName: Full=Voltage-dependent anion-selective channel protein 
3; Short=AtVDAC3; Short=VDAC-3 [Arabidopsis thaliana]
 emb|CAA10363.1| voltage-dependent anion-selective channel protein [Arabidopsis 
thaliana]
 emb|CAC01828.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
 gb|AAL36247.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AAM67451.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AED92115.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 gb|AED92116.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
Length=274

 Score =   142 bits (358),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLYRDYQ D KF++TTYS TGV IT+TG+ KG LFLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KN N T D KV T+S++ TT+T DE APGLK+I   ++PD
Sbjct  61   KNNNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPD  100



>ref|NP_001288964.1| mitochondrial outer membrane protein porin 3 [Brassica rapa]
 gb|ABB97031.1| unknown [Brassica rapa]
Length=276

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+DYQ D K ++TTYS TGV IT+TG+ KGDLF+GDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVTTQV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN T D KV T+S++ TT T DEA PGLK I S +VPD
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPD  100



>emb|CDX85566.1| BnaA02g02470D [Brassica napus]
Length=276

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+DYQ D K ++TTYS TGV IT+TG+ KGDLF+GDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVTTQV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN T D KV T+S++ TT T DEA PGLK I S +VPD
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPD  100



>ref|XP_002873707.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49966.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
Length=276

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN T D KV T+S++ TT+T DE APGLK+I   ++PD
Sbjct  61   KNKNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPD  100



>ref|XP_004956656.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Setaria italica]
Length=276

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 81/98 (83%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLYT+IGKK RDLLYRDYQTDHKFT+TTY+  GV +T+T +KK DL +G++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYRDYQTDHKFTLTTYTSNGVAVTATSTKKADLIIGEIQSQIKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDEAA-PGLKIISSFRVPD  371
            NIT D K +++SNV TT+T+DE A PGLK I SF VPD
Sbjct  63   NITVDVKANSDSNVITTVTIDEVATPGLKAILSFAVPD  100



>emb|CDX74294.1| BnaA03g27530D [Brassica napus]
Length=276

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYTDIGKK RDLL++D+ +DHK +ITT SP GV ITSTG+KKGDL LGDV   L
Sbjct  1    MVKGPGLYTDIGKKVRDLLFKDHNSDHKLSITTQSPAGVAITSTGTKKGDLLLGDVGFLL  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KNITTD +V T++ V  T TVDEAAPGLK I SFR PD
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPD  100



>ref|XP_003578022.1| PREDICTED: mitochondrial outer membrane porin [Brachypodium distachyon]
Length=276

 Score =   140 bits (352),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLYT+IGKK RDLLYRDYQTDHKFT+TTY+  GV IT+T SKK DL  G++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYRDYQTDHKFTLTTYTANGVAITATSSKKADLIFGEIQSQIKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
             +T D K ++ SNV TT+TVDE AAPGLK I SF +PD
Sbjct  63   GVTVDVKANSASNVITTVTVDELAAPGLKTIFSFAIPD  100



>ref|XP_010420161.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Camelina 
sativa]
Length=276

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN T D KV T+S++ TT TVDE  PG+K I S ++PD
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTVDEPTPGVKAILSAKLPD  100



>gb|ACF85328.1| unknown [Zea mays]
 gb|ACG42313.1| isochorismate synthase 1 [Zea mays]
 tpg|DAA39954.1| TPA: voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLYT+IGKK RDLLY+DYQTDHKFT+TTY+  GV +T++ +KK DL LG++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLILGEIQSQIKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            N+T D K ++ SN+ TTITVDE A PGLK I SF VPD
Sbjct  63   NMTIDVKANSESNIITTITVDEIATPGLKTILSFAVPD  100



>ref|NP_001105619.1| voltage-dependent anion channel protein1a [Zea mays]
 gb|AAD56651.1|AF178950_1 voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLYT+IGKK RDLLY+DYQTDHKFT+TTY+  GV +T++ +KK DL LG++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLILGEIQSQIKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            N+T D K ++ SN+ TTITVDE A PGLK I SF VPD
Sbjct  63   NMTIDVKANSESNIITTITVDEIATPGLKTILSFAVPD  100



>gb|EPS68383.1| hypothetical protein M569_06388 [Genlisea aurea]
Length=278

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  78   KGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKN  257
            K PGLY+DIGKKARDLLYRDY  DHKFT+T+Y+  GV ITS+  KKGD  L D++ QLKN
Sbjct  5    KSPGLYSDIGKKARDLLYRDYGGDHKFTLTSYTSNGVSITSSAVKKGDSVLADISAQLKN  64

Query  258  KNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNITTD KVDTNS V TTIT+DE APG+K I S   PD
Sbjct  65   KNITTDVKVDTNSKVLTTITIDEPAPGVKAIFSITAPD  102



>ref|XP_006286537.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
 gb|EOA19435.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
Length=276

 Score =   138 bits (347),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN T D KV T+S++ TT T+DE  PG+K I S ++PD
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTLDEPTPGVKAIFSAKLPD  100



>ref|XP_010453637.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   138 bits (347),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+DYQ D KF++TTYS TGV IT+TG+ KG +FLGDV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN T D KV T+S++ TT TVDE  PG+K I + ++PD
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTVDEPTPGVKAILTAKLPD  100



>gb|KHN45480.1| Mitochondrial outer membrane protein porin of 34 kDa [Glycine 
soja]
Length=267

 Score =   137 bits (345),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  120  DLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSN  299
            DLL++DY +D KFTITTYSPTGV ITS+G+KKGDLF+ DVNTQLKNKNITTD KVDT SN
Sbjct  8    DLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQLKNKNITTDIKVDTGSN  67

Query  300  VFTTITVDEAAPGLKIISSFRVPD  371
            +FTTITV+E APGLK I SFRVPD
Sbjct  68   LFTTITVNEPAPGLKTIFSFRVPD  91



>ref|XP_006400027.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
 gb|ESQ41480.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
Length=276

 Score =   137 bits (346),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGLYT+IGKKARDLLY+DYQ D K +ITTYS +GV IT++G+ KGDLFL DV TQ+
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSASGVAITTSGTNKGDLFLADVATQV  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNK  T D KV T+S++ TT T DEA PGLK I S ++PD
Sbjct  61   KNKKFTADIKVATDSSLLTTFTYDEATPGLKAILSAKLPD  100



>tpg|DAA61162.1| TPA: voltage-dependent anion-selective channel protein [Zea mays]
Length=276

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLYT+IGKK RDLLY+DYQTDHKFT+TTYS  GV +T+T +KK DL   ++++Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYSSNGVAVTATSTKKADLIFSEIHSQIKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            N+T D K ++ SN+ TT+TV+E A PGLK I SF VPD
Sbjct  63   NMTVDVKANSESNIITTVTVNEIATPGLKTILSFAVPD  100



>ref|NP_001104948.1| voltage-dependent anion channel protein1b [Zea mays]
 gb|AAD56652.1|AF178951_1 voltage-dependent anion channel protein 1b [Zea mays]
Length=276

 Score =   135 bits (340),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLYT+IGKK RDLLY+DYQTDHKFT+TTYS  GV +T+T +KK DL   ++++Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYSSNGVAVTATSTKKADLIFSEIHSQIKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            N+T D K ++ SN+ TT+TV+E A PGLK I SF VPD
Sbjct  63   NMTVDVKANSESNIITTVTVNEIATPGLKTILSFAVPD  100



>ref|XP_009410756.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   135 bits (340),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 81/98 (83%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY++IGKKARDLLYRDYQTDHKFT+TT +  GV IT+TG++K DL  G++ +Q+KNK
Sbjct  2    GPGLYSEIGKKARDLLYRDYQTDHKFTVTTCTSNGVAITATGTRKNDLIFGEIQSQIKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            N+T D K +++SNV TT+TVDE A PGLK I SF +PD
Sbjct  62   NVTFDVKTNSDSNVTTTVTVDELATPGLKTIFSFVIPD  99



>sp|P46274.1|VDAC1_WHEAT RecName: Full=Mitochondrial outer membrane porin; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC 
[Triticum aestivum]
 emb|CAA54788.1| voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   135 bits (339),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 81/101 (80%), Gaps = 2/101 (2%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MG GPGLY+ IGKKA+DLLYRDYQTDHKFT+TTY+  G  IT+T +KK DL +G++ +Q+
Sbjct  1    MG-GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGPAITATSTKKADLTVGEIQSQI  59

Query  252  KNKNITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            KNKNIT D K ++ SNV TTIT D+ AAPGLK I SF VPD
Sbjct  60   KNKNITVDVKANSASNVITTITADDLAAPGLKTILSFAVPD  100



>gb|AAC64164.1| voltage-dependent anion-selective channel protein [Zea mays]
Length=107

 Score =   130 bits (326),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLYT+IGKK RDLLY+DYQTDHKFT+TTYS  GV +T+T +KK DL   ++++Q+KN 
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYSSNGVAVTATSTKKADLIFSEIHSQIKNT  62

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            N+T D K ++ SN+ TT+T  E A PGLK I SF VPD
Sbjct  63   NMTVDVKANSESNIITTVTAHEIATPGLKTILSFAVPD  100



>ref|XP_002460110.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
 gb|EER96631.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
Length=276

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY +IGKK +DLLY+DYQTDHKFT+TTY+  GV +T++ +KK DL  G++ +Q+KNK
Sbjct  3    GPGLYAEIGKKTKDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLIFGEIQSQIKNK  62

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            NIT D K ++ SN+ TT+TVDE A PGLK I SF VPD
Sbjct  63   NITVDVKANSESNIITTVTVDEIATPGLKTILSFAVPD  100



>gb|EMS51310.1| Mitochondrial outer membrane porin [Triticum urartu]
Length=596

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 81/101 (80%), Gaps = 2/101 (2%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MG GPGLY+ IGKKA+DLLYRDYQTDHKFT+TTY+  G  IT+T +KK DL LG++ +Q+
Sbjct  1    MG-GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGAAITATSTKKADLILGEIQSQI  59

Query  252  KNKNITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            KNKNIT D K ++ SNV TTIT D+ AAPGLK I SF VPD
Sbjct  60   KNKNITVDVKANSASNVITTITADDLAAPGLKTILSFAVPD  100



>ref|XP_001779057.1| predicted protein [Physcomitrella patens]
 gb|EDQ56094.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPG YTDIGKK +DLL +DY  D KF ITT + +G+  TSTG K+G+ F GD+NTQ 
Sbjct  1    MGKGPGFYTDIGKKTKDLLNKDYTYDQKFVITTSTKSGLAFTSTGLKRGEAFTGDLNTQF  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+T D KVDT SN+FTTIT+DE APG K + SF +PD
Sbjct  61   KNKNVTADVKVDTKSNIFTTITIDEFAPGAKSVFSFTIPD  100



>gb|ABK23226.1| unknown [Picea sitchensis]
Length=276

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGL+++IGKKA+DLL RDY  D KFT+TT+S TG+  TSTG KKG+LF GD+NTQ 
Sbjct  1    MGKGPGLFSEIGKKAKDLLTRDYNYDQKFTVTTFSETGLAFTSTGVKKGELFSGDLNTQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K +N T D K+DTNSN+ TTIT+D+  P  K I SF++PD
Sbjct  61   KYQNATVDVKIDTNSNILTTITLDQPIPNAKTIFSFKIPD  100



>gb|EMT02908.1| Mitochondrial outer membrane porin [Aegilops tauschii]
Length=667

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 81/101 (80%), Gaps = 2/101 (2%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MG GPGLY+ IGKKA+DLLYRDYQTDHKFT+TTY+  G  IT+T +KK DL LG++ +Q+
Sbjct  1    MG-GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGAAITATSTKKADLILGEIQSQI  59

Query  252  KNKNITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            KNKNIT D K ++ SNV TTIT D+ AAPGLK I SF VPD
Sbjct  60   KNKNITVDVKANSASNVITTITADDLAAPGLKTILSFAVPD  100



>ref|XP_008786741.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=276

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY++IGKKARDLLY+DY TD KFT+ TY+  GV IT++G+KK +L  G++ +QLKNK
Sbjct  2    GPGLYSEIGKKARDLLYKDYHTDQKFTVATYTANGVAITASGTKKNELIFGEIQSQLKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            NIT D K +++SN+ TT+TVDE A PGLK I SF VPD
Sbjct  62   NITVDVKANSDSNLSTTVTVDELATPGLKTIFSFVVPD  99



>gb|KHG07129.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=344

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 5/90 (6%)
 Frame = +3

Query  102  IGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFK  281
            IGKKARDLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQLK++N+TTD K
Sbjct  84   IGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQLKSRNVTTDIK  143

Query  282  VDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            VDT+SN      +DE APGLK I  FRVPD
Sbjct  144  VDTSSNA-----IDEPAPGLKAIFGFRVPD  168



>ref|XP_010932447.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY++IGKKARDLLY+DY TD KFT+TTY+  GV IT++G+KK +   G++ +QLKNK
Sbjct  2    GPGLYSEIGKKARDLLYKDYLTDQKFTVTTYTSNGVAITASGTKKNEFIFGEIQSQLKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            NIT D K +++SN+ TT+TVDE A PGLK I SF VPD
Sbjct  62   NITVDVKANSDSNLLTTVTVDELATPGLKTIFSFVVPD  99



>ref|XP_010925058.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY++IGKKARDLLY+DY TD KFT+TTY+ TGV IT++G+KK +   G++ +QLK K
Sbjct  2    GPGLYSEIGKKARDLLYKDYLTDQKFTVTTYTSTGVAITASGTKKTEFIFGEIQSQLKKK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            NIT D K ++ SN+ TT+TVDE A PGLK I SF VPD
Sbjct  62   NITVDVKANSESNLLTTVTVDELATPGLKTIFSFVVPD  99



>ref|XP_008808420.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   129 bits (325),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY++IGKKARDLLYRDY TD KFT+TTY+ +GV IT++G+KK +   G++ +QLK K
Sbjct  2    GPGLYSEIGKKARDLLYRDYLTDQKFTVTTYTSSGVAITASGTKKNEFIFGEIQSQLKKK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            NIT D K ++ SN+ TT+TVDE A PGL+ I SF VP+
Sbjct  62   NITVDVKANSESNLLTTVTVDELATPGLRTIFSFVVPE  99



>ref|XP_008775594.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   129 bits (324),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY++IG+KARDLLY+DY TD KFT+TTY+  GV IT++G+KK +   G++ +QLKNK
Sbjct  2    GPGLYSEIGRKARDLLYKDYLTDQKFTVTTYTSNGVAITASGTKKNEFIFGEIQSQLKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            NI+ D K +++SN+ TT+TVDE A PGLK I SF VPD
Sbjct  62   NISVDVKANSDSNLLTTVTVDELATPGLKTIFSFVVPD  99



>ref|XP_001781995.1| predicted protein [Physcomitrella patens]
 gb|EDQ53219.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPG+Y+DIGKK +DLL +DY  D KF ITT + +G+  TSTG K+G+ F GDVNT  
Sbjct  1    MGKGPGMYSDIGKKTKDLLNKDYTYDQKFVITTNTQSGLAFTSTGVKRGEGFSGDVNTSF  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            KNKN+T D KVDT SN+F T+TVDE APG K + +F +PD
Sbjct  61   KNKNVTADVKVDTKSNIFATVTVDEFAPGAKSVFTFTIPD  100



>ref|XP_010925360.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY++IGK+ARDLLY+DYQTD KFT+TTY+  GV IT++G+KK +L  G++ +QLKNK
Sbjct  2    GPGLYSEIGKQARDLLYKDYQTDQKFTVTTYTANGVAITASGTKKNELIFGEIQSQLKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            NIT D K  ++SN+ T + VDE A PGLK I SF +PD
Sbjct  62   NITVDVKAGSDSNLSTKVAVDELATPGLKTIFSFVLPD  99



>ref|XP_009408682.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY++IGKKARDLLY+DYQTDHKFT+TT +  GV IT++G++K D+  G++ +Q+KN 
Sbjct  2    GPGLYSEIGKKARDLLYKDYQTDHKFTVTTCTANGVAITASGTRKNDIIFGEIQSQIKNN  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            NIT D K +++SNV TT+T++E A PGLK I SF +PD
Sbjct  62   NITFDVKTNSDSNVTTTVTINELATPGLKTIFSFVIPD  99



>ref|XP_006826371.1| hypothetical protein AMTR_s00004p00132290 [Amborella trichopoda]
 gb|ERM93608.1| hypothetical protein AMTR_s00004p00132290 [Amborella trichopoda]
Length=103

 Score =   122 bits (306),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY++IGKKARDLLYRDYQTD KF +TT +PTGV +T+TG+K GDLF+ D++TQL+ K
Sbjct  2    GPGLYSEIGKKARDLLYRDYQTDQKFVLTTCTPTGVTVTTTGAKIGDLFVADLSTQLRKK  61

Query  261  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            NITTD KVD NSN+F T+TVDE APG K I S+ +PD
Sbjct  62   NITTDIKVDINSNLFATMTVDEPAPGAKAILSYAIPD  98



>gb|ADE77918.1| unknown [Picea sitchensis]
Length=276

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGL+++IGKKARDLL +DY  D KF +TTYS  G+ ITSTG  KG LF GD++T  
Sbjct  1    MGKGPGLFSNIGKKARDLLTKDYSHDQKFAVTTYSEDGLGITSTGMNKGGLFCGDIDTHY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K +N T + KVDTNSN+ TTIT+DE  PG K + SF++PD
Sbjct  61   KYQNSTINVKVDTNSNISTTITIDEVLPGAKTVLSFKLPD  100



>ref|XP_009393634.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY +IG+KAR+LLYRDYQTDHK T+TT +  GV IT++G++K DL  G++ + +KNK
Sbjct  2    GPGLYFEIGRKARELLYRDYQTDHKVTVTTCTSNGVEITASGTRKNDLIFGEIQSHIKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            N+T D K +++SNV TTIT+DE A+PGLK I SF VPD
Sbjct  62   NVTFDVKTNSDSNVTTTITIDELASPGLKTIFSFVVPD  99



>ref|XP_008338437.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Malus 
domestica]
Length=276

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+TDIGKKA+DLL +DY +D KFTI+TYS  GV +TST  KKG L +GD+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTISTYSDAGVALTSTAVKKGGLSIGDILTQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D KVDT SN+ TT T++E  P  K I+SF+ PD
Sbjct  61   KYKNTVVDVKVDTESNILTTFTINEIVPSTKTIASFKAPD  100



>gb|KHG07130.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=258

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 69/85 (81%), Gaps = 5/85 (6%)
 Frame = +3

Query  117  RDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNS  296
            +DLLY+DYQTD KFT+TT SPTGV ITS G+KKGDLFL DVNTQLK++N+TTD KVDT+S
Sbjct  3    KDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQLKSRNVTTDIKVDTSS  62

Query  297  NVFTTITVDEAAPGLKIISSFRVPD  371
            N      +DE APGLK I  FRVPD
Sbjct  63   NA-----IDEPAPGLKAIFGFRVPD  82



>ref|XP_009408829.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY+DIGKKARDLLY+DYQTD K T+TTY+  G+ I+++G+KK +L  G++ +QLKNK
Sbjct  2    GPGLYSDIGKKARDLLYKDYQTDQKVTLTTYTLNGIAISASGTKKNELIFGELQSQLKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            NI+ D K  ++S + TT+TVDE A PGL+ I +F +PD
Sbjct  62   NISFDVKATSDSKLLTTVTVDELATPGLRSIFNFIIPD  99



>ref|XP_009150694.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Brassica 
rapa]
 ref|XP_009150695.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Brassica 
rapa]
Length=276

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL++DIGKKA+DLL RDY +DHKF+I+TYS +GV +TST  KKG +   DV TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLMRDYTSDHKFSISTYSASGVALTSTALKKGGVHAADVTTQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+DT+S V TT+T  E  P  K I SF+VPD
Sbjct  61   KYKNAVFDVKIDTDSTVLTTVTFTEILPSTKAIVSFKVPD  100



>ref|NP_201551.1| voltage dependent anion channel 2 [Arabidopsis thaliana]
 sp|Q9FJX3.1|VDAC2_ARATH RecName: Full=Mitochondrial outer membrane protein porin 2; AltName: 
Full=Voltage-dependent anion-selective channel protein 
2; Short=AtVDAC2; Short=VDAC-2 [Arabidopsis thaliana]
 dbj|BAB08458.1| porin-like protein [Arabidopsis thaliana]
 gb|AAM61654.1| porin-like protein [Arabidopsis thaliana]
 gb|ABF83692.1| At5g67500 [Arabidopsis thaliana]
 gb|AED98352.1| voltage dependent anion channel 2 [Arabidopsis thaliana]
Length=276

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+TDIGKKA+DLL RDY +D KF+I+TYS +GV +TST  KKG +   DV TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTRDYNSDQKFSISTYSASGVALTSTALKKGGVHAADVATQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+DT+S+V TT+T+ E  P  K I+SF+VPD
Sbjct  61   KYKNALFDVKIDTDSSVLTTVTLTEILPSTKAIASFKVPD  100



>ref|XP_006280940.1| hypothetical protein CARUB_v10026938mg [Capsella rubella]
 gb|EOA13838.1| hypothetical protein CARUB_v10026938mg [Capsella rubella]
Length=276

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL RDY TD KF+I+TYS +GV +TST  KKG +   DV TQ 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYNTDQKFSISTYSASGVALTSTALKKGGVHAADVATQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+DT+S+V TT+T+ E  P  K I+SF+VPD
Sbjct  61   KYKNALFDVKIDTDSSVLTTVTLTEILPSTKAIASFKVPD  100



>dbj|BAJ99489.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88464.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            N+T D K ++ S++ TT TVDE A PGLK I S  VPD
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPD  99



>gb|EMS47295.1| Outer plastidial membrane protein porin [Triticum urartu]
Length=275

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            N+T D K ++ S++ TT TVDE A PGLK I S  VPD
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPD  99



>ref|XP_010550330.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Tarenaya 
hassleriana]
Length=276

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKARDLL +DY +D KF+++TYS +GV +TST  KKG L   DV TQ 
Sbjct  1    MAKGPGLFADIGKKARDLLTKDYNSDQKFSVSTYSASGVALTSTALKKGGLHAADVATQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+DT SN+ TTIT  E  P  K I+SF+VPD
Sbjct  61   KYKNTLFDVKIDTESNISTTITFTEVLPSTKAIASFKVPD  100



>emb|CDY08723.1| BnaA06g25010D [Brassica napus]
Length=276

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL++DIGKKA+DLL RDY +DHKF+I+TYS +GV +TST  KKG +   DV TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTRDYTSDHKFSISTYSASGVALTSTALKKGGVHAADVTTQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+DT+S V TT+T  E  P  K I SF+VPD
Sbjct  61   KYKNAVFDVKIDTDSTVLTTVTFTEILPSTKAIVSFKVPD  100



>emb|CDM83072.1| unnamed protein product [Triticum aestivum]
Length=275

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            N+T D K ++ S++ TT TVDE A PGLK I S  VPD
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPD  99



>emb|CAA57646.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            N+T D K ++ S++ TT TVDE A PGLK I S  VPD
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPD  99



>ref|XP_006393957.1| hypothetical protein EUTSA_v10004631mg [Eutrema salsugineum]
 gb|ESQ31243.1| hypothetical protein EUTSA_v10004631mg [Eutrema salsugineum]
Length=314

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +3

Query  60   LAAEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDV  239
            L + M KGPGL+TDIGKKA+DLL RDY +D KF+I+TYS +GV +TST  KKG +   DV
Sbjct  35   LRSTMSKGPGLFTDIGKKAKDLLTRDYTSDQKFSISTYSASGVALTSTALKKGGVHAADV  94

Query  240  NTQLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
             TQ K KN   D K+DT+S+V TT+T  E  P  K I+SF+VPD
Sbjct  95   ATQYKYKNALFDVKIDTDSSVLTTVTFTEILPSTKAIASFKVPD  138



>ref|XP_008354718.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Malus domestica]
 ref|XP_009362557.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Pyrus x bretschneideri]
Length=276

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+TDIGKKA+DLL +DY +D KFT++TYS  GV +TST  KKG L  GD+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDILTQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D KVDT SN+ TT T++E  P  K I+SF+ PD
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKAPD  100



>ref|XP_009354614.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Pyrus x bretschneideri]
 ref|XP_009379335.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Pyrus 
x bretschneideri]
Length=276

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+TDIGKKA+DLL +DY +D KFT++TYS  GV +TST  KKG L  GD+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDILTQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D KVDT SN+ TT T++E  P  K I+SF+ PD
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKAPD  100



>ref|XP_007205702.1| hypothetical protein PRUPE_ppa009821mg [Prunus persica]
 gb|EMJ06901.1| hypothetical protein PRUPE_ppa009821mg [Prunus persica]
Length=276

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL++DIGKKA+DLL +DY +D KFT++TYS  GV +TST  KKG L  GD+ TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTKDYNSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDIVTQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D KVDT SN+ TT T++E  P  K I+SF++PD
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKIPD  100



>ref|XP_010484488.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Camelina sativa]
Length=276

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL RDY TD KF+I+TYS +GV +TST  KKG +   DV TQ 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYNTDQKFSISTYSASGVALTSTALKKGGVHAADVATQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+DT+S+V TT+T  E  P  K I+SF+VPD
Sbjct  61   KYKNALFDIKIDTDSSVLTTVTFTEILPSTKAIASFKVPD  100



>ref|XP_010463972.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Camelina sativa]
Length=276

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL RDY TD KF+I+TYS +GV +TST  KKG +   DV TQ 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYNTDQKFSISTYSASGVALTSTALKKGGVHAADVATQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+DT+S+V TT+T  E  P  K I+SF+VPD
Sbjct  61   KYKNALFDVKIDTDSSVLTTVTFTEILPSTKAIASFKVPD  100



>ref|NP_001043433.1| Os01g0588200 [Oryza sativa Japonica Group]
 sp|Q7F4F8.1|VDAC3_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Voltage-dependent anion-selective channel protein 
3; Short=OsVDAC3 [Oryza sativa Japonica Group]
 emb|CAC80851.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAB89921.1| putative porin [Oryza sativa Japonica Group]
 dbj|BAF05347.1| Os01g0588200 [Oryza sativa Japonica Group]
 gb|EAY74735.1| hypothetical protein OsI_02626 [Oryza sativa Indica Group]
 gb|EAZ12509.1| hypothetical protein OsJ_02405 [Oryza sativa Japonica Group]
 dbj|BAG92122.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=275

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
             PGLYTDIGKK RDLLYRDY T HKFT+TT +P GV IT+ G++K +   G++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYGTHHKFTLTTCTPEGVTITAAGTRKNESVFGELQTQLKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
             +T D K ++ S++ TT+TVDE   PGLK I S  VPD
Sbjct  62   KLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPD  99



>ref|XP_010444638.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Camelina 
sativa]
Length=276

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL RDY TD KF+I+TYS +GV +TST  KKG +   DV TQ 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYNTDQKFSISTYSASGVALTSTALKKGGVHAADVATQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+DT+S+V TT+T  E  P  K I+SF+VPD
Sbjct  61   KYKNALFDVKIDTDSSVLTTVTFTEILPSTKAIASFKVPD  100



>ref|XP_008238010.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Prunus mume]
Length=276

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL++DIGKKA+DLL +DY +D KFT++TYS  GV +TST  KKG L  GD+ TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTKDYNSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDIVTQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D KVDT SN+ TT T++E  P  K I+SF+VP+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKVPE  100



>ref|XP_002866701.1| hypothetical protein ARALYDRAFT_496845 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42960.1| hypothetical protein ARALYDRAFT_496845 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   119 bits (297),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M  GPGL+TDIGKKA+DLL RDY +D KF+I+TYS +GV +TST  KKG +   DV TQ 
Sbjct  1    MSNGPGLFTDIGKKAKDLLTRDYNSDQKFSISTYSASGVALTSTALKKGGVHAADVATQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+DT+S+V TT+T+ E  P  K I+SF+VPD
Sbjct  61   KYKNALFDVKIDTDSSVLTTVTLTEILPSTKAIASFKVPD  100



>ref|XP_004231921.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Solanum lycopersicum]
 ref|XP_010316016.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Solanum lycopersicum]
Length=330

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = +3

Query  9    LSH*NLSPSRLCFRFSA--LAAEMGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPT  182
            L + N S S  CF  ++  L  +M KGPGL++DIGKKARD+L +DY +D K +I+TYS T
Sbjct  32   LRYANFSLSLCCFYETSIPLPEKMSKGPGLFSDIGKKARDVLTKDYISDQKLSISTYSDT  91

Query  183  GVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFR  362
            GV +TST  KKG L  GDV  Q K KN   D KVDT SN+ TT+T+++ AP  K I+S +
Sbjct  92   GVALTSTAVKKGGLSTGDVGAQYKYKNTLIDVKVDTASNISTTLTLNDIAPSTKTIASLK  151

Query  363  VPD  371
             PD
Sbjct  152  FPD  154



>emb|CBI33688.3| unnamed protein product [Vitis vinifera]
Length=164

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL RDY +D KFT++TYS TGV ITST  KKG L  GDV  Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYISDQKFTVSTYSDTGVAITSTAVKKGGLSTGDVAVQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K DT SN+ TT+T  E  P  K I+SF+ PD
Sbjct  61   KYKNSVIDVKADTGSNINTTLTFTEIIPSTKTIASFKFPD  100



>ref|XP_010231957.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Brachypodium 
distachyon]
Length=275

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
             PGLYTDIGKK RDLLYRDY T  KFT+TT +P GV IT+ G++K +   G++ TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQIKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
            N+T D K ++ S++ TT+TVDE   PGLK I S  VPD
Sbjct  62   NLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPD  99



>emb|CDY18662.1| BnaA09g07330D [Brassica napus]
Length=276

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL RDY TD KF+I+TYS +GV +TST  KKG +   DV +Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYNTDQKFSISTYSASGVALTSTALKKGGVHAADVTSQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+DT+S + TT+T  E  P  K I+SF+VPD
Sbjct  61   KYKNAVFDVKIDTDSTILTTVTFTEILPSTKAIASFKVPD  100



>ref|XP_009112213.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Brassica 
rapa]
Length=276

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL RDY TD KF+I+TYS +GV +TST  KKG +   DV +Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYNTDQKFSISTYSASGVALTSTALKKGGVHAADVTSQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+DT+S + TT+T  E  P  K I+SF+VPD
Sbjct  61   KYKNAVFDVKIDTDSTILTTVTFTEILPSTKAIASFKVPD  100



>gb|AAW22622.1| porin-like protein [Brassica napus]
Length=276

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL RDY TD KF+I+TYS +GV +TST  KKG +   DV +Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYNTDQKFSISTYSASGVALTSTALKKGGVHAADVTSQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+DT+S + TT+T  E  P  K I+SF+VPD
Sbjct  61   KYKNAVFDVKIDTDSTILTTVTFTEILPSTKAIASFKVPD  100



>emb|CDY36497.1| BnaC03g48560D [Brassica napus]
Length=276

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL++DIGKKA+DLL RDY +DHKF+I+TYS +GV +TST  KKG +   DV TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTRDYTSDHKFSISTYSASGVALTSTALKKGGVHAADVTTQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+ T+S + TT+T  E  P  K I SF+VPD
Sbjct  61   KYKNAVFDVKIHTDSTILTTVTFTEILPSTKAIVSFKVPD  100



>emb|CDY02103.1| BnaA03g40640D [Brassica napus]
Length=276

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKARDLL RDY TD KF+I+T + +G V+TST  KKG +   DV+TQ 
Sbjct  1    MNKGPGLFADIGKKARDLLTRDYNTDQKFSISTNTLSGFVLTSTVLKKGVVHAADVSTQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K++N   D K+DT+SNV TTIT+ E  P  K I+SF+VPD
Sbjct  61   KSRNALFDVKIDTDSNVMTTITITEILPSTKAIASFKVPD  100



>gb|KJB30017.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=255

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 67/100 (67%), Gaps = 21/100 (21%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            MGKGPGLY+DIGKKARDLLY+DYQ DHKFT+TTY+  GV ITSTG KKG+L L D     
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLAD-----  55

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
                            +F T+TVDE APGLK I SF VPD
Sbjct  56   ----------------LFATVTVDEPAPGLKTIFSFIVPD  79



>ref|XP_010547555.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Tarenaya hassleriana]
Length=276

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKK+RDLL +DY +D KF+++TYS +GV +TST   KG +   DV TQ 
Sbjct  1    MSKGPGLFADIGKKSRDLLTKDYNSDQKFSVSTYSASGVALTSTALNKGGIHAADVATQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVP  368
            K KN   D K+DT SN+FTTIT +E  P  K I+SF+VP
Sbjct  61   KYKNTLFDVKIDTESNIFTTITFNEVLPSTKSIASFKVP  99



>ref|XP_009136524.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Brassica 
rapa]
Length=276

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKARDLL RDY TD KF+I+T + +GV +TST  KKG +   DV+TQ 
Sbjct  1    MSKGPGLFADIGKKARDLLTRDYNTDQKFSISTNTLSGVALTSTVLKKGVVHAADVSTQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K +N   D K+DT+SNV TTIT+ E  P  K I+SF+VPD
Sbjct  61   KYRNALFDVKIDTDSNVMTTITITEILPSTKAIASFKVPD  100



>ref|XP_004969385.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Setaria italica]
Length=275

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
             PGLYTDIGKK RDLLY+DY T  KF++TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSVTTCSPHGVAITAAGTRKNESLFGELHTQIKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
             +T D K ++ S++ TTITVDE   PGLK I S  VPD
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSILSLVVPD  99



>ref|XP_002458065.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
 gb|EES03185.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
Length=275

 Score =   116 bits (290),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
             PGLYTDIGKK RDLLY+DY T  KF++TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGVAITAAGTRKNESIFGELHTQIKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
             +T D K ++ S++ TTITVDE   PGLK I S  VPD
Sbjct  62   KLTVDIKANSESDLLTTITVDELGTPGLKSILSLVVPD  99



>emb|CDX81312.1| BnaC09g07230D [Brassica napus]
Length=276

 Score =   116 bits (290),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL RDY TD KF+I+TYS +GV +TST  KKG +   DV +Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYNTDQKFSISTYSASGVSLTSTALKKGGVHAADVTSQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D ++DT+S + TT+T  E  P  K I+SF+VPD
Sbjct  61   KYKNAVFDVRIDTDSTILTTVTFTEILPSTKAIASFKVPD  100



>gb|KJB34748.1| hypothetical protein B456_006G081500 [Gossypium raimondii]
Length=219

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +3

Query  117  RDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNKNITTDFKVDTNS  296
            +DLLY+DYQTD KFT+TT S TGV ITS  +KKGDLFL +VNTQLK +N+T D KVDT+S
Sbjct  3    KDLLYKDYQTDQKFTLTTISLTGVAITSARTKKGDLFLVNVNTQLKFRNVTIDIKVDTSS  62

Query  297  NVFTTITVDEAAPGLKIISSFRVPD  371
            N+FTTITVDE AP L  I  F VPD
Sbjct  63   NLFTTITVDEPAPVLNAIFGFGVPD  87



>ref|XP_008457836.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Cucumis 
melo]
Length=276

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL++DIGKKA+DLL RDY +D KF+++TYS  GVV+TST  KKG L  GD+    
Sbjct  1    MSKGPGLFSDIGKKAKDLLTRDYISDQKFSVSTYSHAGVVLTSTAVKKGGLSTGDIAALY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN+T D KVDT SN+ T +T++E  P  K I+S ++PD
Sbjct  61   KYKNVTFDVKVDTESNISTIVTLNEIVPSTKTIASVKIPD  100



>ref|XP_002279650.2| PREDICTED: mitochondrial outer membrane protein porin 2 [Vitis 
vinifera]
 emb|CAN75907.1| hypothetical protein VITISV_001975 [Vitis vinifera]
 emb|CBI33694.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL RDY +D KFT++TYS TGV ITST  KKG L  GDV  Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYISDQKFTVSTYSDTGVAITSTAVKKGGLSTGDVAVQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K DT SN+ TT+T  E  P  K I+SF+ PD
Sbjct  61   KYKNSVIDVKADTGSNINTTLTFTEIIPSTKTIASFKFPD  100



>ref|XP_010652706.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Vitis vinifera]
Length=276

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL RDY +D KFT++TYS TGV ITST  KKG L  GDV  Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYISDQKFTVSTYSDTGVAITSTAVKKGGLSTGDVAVQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K DT SN+ TT+T  E  P  K I+SF+ PD
Sbjct  61   KYKNSVIDVKADTGSNINTTLTFTEIIPSTKTIASFKFPD  100



>ref|XP_009403419.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=273

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
            GPGLY+D+ K+ARDLLY+DYQTD KFTITT +  GV IT++G+KK +L  G++ +Q KN 
Sbjct  2    GPGLYSDVAKRARDLLYKDYQTDQKFTITTSTLNGVSITTSGTKKNELIFGELQSQWKNN  61

Query  261  NITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            NI+ D K  ++S   TT+TVDE  PGL+ I S  +PD
Sbjct  62   NISVDVKATSDSKFATTVTVDELTPGLRSIFSVIIPD  98



>ref|XP_007047520.1| Voltage dependent anion channel 2 [Theobroma cacao]
 gb|EOX91677.1| Voltage dependent anion channel 2 [Theobroma cacao]
Length=276

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL++DIGKKA+DLL +DY +DHKFT++TY+  GV +TST  KKG L +GDV    
Sbjct  1    MSKGPGLFSDIGKKAKDLLNKDYSSDHKFTVSTYTGAGVALTSTALKKGGLSIGDVAALY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D KVDT+SN+  T+T  E  P  K I+SF+VPD
Sbjct  61   KYKNTLFDVKVDTDSNISATLTFTEILPSTKTIASFKVPD  100



>emb|CAA63968.1| pom30 [Solanum tuberosum]
Length=276

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKARDLL +DY +D K +I+TYS TGV +TST  KKG L  GDV  Q 
Sbjct  1    MSKGPGLFADIGKKARDLLTKDYISDQKLSISTYSDTGVALTSTAVKKGGLSTGDVGAQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D KVDT SN+ TT+T+++ AP  K I+S + PD
Sbjct  61   KYKNTLIDVKVDTASNISTTLTLNDIAPSTKTIASLKFPD  100



>ref|XP_004288248.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL +DY +D KF+++TYS  GV +TST  K+G L  GD+  Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTKDYNSDQKFSVSTYSEAGVALTSTAVKRGGLSAGDIGAQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D KVDT+SN+ TT T+ +  P  K I+SF+VPD
Sbjct  61   KYKNALVDVKVDTDSNISTTFTITDIIPSTKTIASFKVPD  100



>ref|XP_006426127.1| hypothetical protein CICLE_v10026251mg [Citrus clementina]
 ref|XP_006466432.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Citrus sinensis]
 gb|ESR39367.1| hypothetical protein CICLE_v10026251mg [Citrus clementina]
 gb|KDO78877.1| hypothetical protein CISIN_1g023824mg [Citrus sinensis]
Length=276

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL +DY  D K +I+TYS  GV +TST  KKG L  GDV  Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN+  D KVDT SN+ TT T+ E  P  K I+S +VPD
Sbjct  61   KYKNVLFDVKVDTESNILTTFTLTEILPSTKAIASLKVPD  100



>ref|XP_004148030.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Cucumis sativus]
 ref|XP_004161729.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Cucumis sativus]
 gb|KGN62001.1| Porin/voltage-dependent anion-selective channel protein [Cucumis 
sativus]
Length=276

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL++DIGKKA+DLL RDY +D KF+++TYS  GVV+TST  KKG L  GD+    
Sbjct  1    MSKGPGLFSDIGKKAKDLLTRDYISDQKFSVSTYSHAGVVLTSTAVKKGGLSTGDIAALY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K +N+T D KVDT SN+ T +T++E  P  K I+S ++PD
Sbjct  61   KYRNVTFDVKVDTESNISTIVTLNEIVPSTKTIASVKIPD  100



>gb|AFW83107.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
             PGLYTDIGKK RDLLY+DY T  KF++TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
             +T D K ++ S++ TTITVDE   PGLK I +  VPD
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPD  99



>gb|KFK28435.1| hypothetical protein AALP_AA8G514300 [Arabis alpina]
Length=276

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPGL+ DIGKKA+DLL RDY +D KF+I+TYS +GV  TST  KKG +   DV TQ 
Sbjct  1    MSKGPGLFIDIGKKAKDLLTRDYNSDQKFSISTYSSSGVAFTSTALKKGGVHAADVATQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K KN   D K+ T+S+V TT+T  E  P  K I+SF+VPD
Sbjct  61   KYKNALFDVKIATDSSVLTTVTFTEILPSTKAIASFKVPD  100



>ref|XP_006845625.1| hypothetical protein AMTR_s00019p00217910 [Amborella trichopoda]
 gb|ERN07300.1| hypothetical protein AMTR_s00019p00217910 [Amborella trichopoda]
Length=275

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  72   MGKGPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQL  251
            M KGPG ++DIGKKARDLL RDY  D KFT+T  S  G+ +T+TG K+G  F GD++TQ 
Sbjct  1    MAKGPGPFSDIGKKARDLLTRDYNYDEKFTLTMLSDNGLALTTTGLKRGQFFTGDLSTQY  60

Query  252  KNKNITTDFKVDTNSNVFTTITVDEAAPGLKIISSFRVPD  371
            K+ N T D KVDTN N+ +TITV+E  P  K   SF++PD
Sbjct  61   KSGNTTVDVKVDTNCNITSTITVNEIFPSSKTALSFKIPD  100



>ref|NP_001278544.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF81491.1| unknown [Zea mays]
Length=275

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  81   GPGLYTDIGKKARDLLYRDYQTDHKFTITTYSPTGVVITSTGSKKGDLFLGDVNTQLKNK  260
             PGLYTDIGKK RDLLY+DY T  KF++TT SP GV IT+ G++K +   G+++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTSSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  261  NITTDFKVDTNSNVFTTITVDE-AAPGLKIISSFRVPD  371
             +T D K ++ S++ TTITVDE   PGLK I +  VPD
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPD  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555214126005