BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF008G24

Length=252
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006351113.1|  PREDICTED: RNA-binding protein 39-like isofo...  53.1    5e-06   Solanum tuberosum [potatoes]
ref|XP_010312457.1|  PREDICTED: RNA-binding protein 39                53.1    5e-06   Solanum lycopersicum
ref|XP_011100931.1|  PREDICTED: RNA-binding protein 39                52.0    2e-05   Sesamum indicum [beniseed]
emb|CDP12846.1|  unnamed protein product                              47.0    3e-04   Coffea canephora [robusta coffee]
gb|EYU24065.1|  hypothetical protein MIMGU_mgv1a002916mg              46.6    0.001   Erythranthe guttata [common monkey flower]



>ref|XP_006351113.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Solanum tuberosum]
Length=578

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  121  MDFDEYDYLEKAVEETNGPSSKSKDKDRENSPsekekseksYRR  252
            MDFDEYDYLEK VEETNG S+KSKDKD  NS +EKEKSEK YRR
Sbjct  1    MDFDEYDYLEKTVEETNGTSTKSKDKD-NNSSAEKEKSEKGYRR  43



>ref|XP_010312457.1| PREDICTED: RNA-binding protein 39 [Solanum lycopersicum]
Length=576

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  121  MDFDEYDYLEKAVEETNGPSSKSKDKDRENSPsekekseksYRR  252
            MDFDEYDYLEK VEETNG S+KSKDKD  NS +EKEKSEK YRR
Sbjct  1    MDFDEYDYLEKTVEETNGTSTKSKDKD-NNSSAEKEKSEKGYRR  43



>ref|XP_011100931.1| PREDICTED: RNA-binding protein 39 [Sesamum indicum]
Length=587

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 3/34 (9%)
 Frame = +1

Query  121  MDFDEYDYLEKAVEETNGPSSKS---KDKDRENS  213
            MDFDEYDYLEKAVEETNGPS K    K+KDRE S
Sbjct  1    MDFDEYDYLEKAVEETNGPSKKETPDKEKDREKS  34



>emb|CDP12846.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  121  MDFDEYDYLEKAVEETNGPSSKSKD  195
            MDFDEYDYLEK VEETNGP SK+K+
Sbjct  1    MDFDEYDYLEKTVEETNGPPSKTKE  25



>gb|EYU24065.1| hypothetical protein MIMGU_mgv1a002916mg [Erythranthe guttata]
Length=626

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 3/34 (9%)
 Frame = +1

Query  121  MDFDEYDYLEKAVEETNGPS---SKSKDKDRENS  213
            MDFDEYDYLEKAVEETNGP+   +  K  DRE S
Sbjct  1    MDFDEYDYLEKAVEETNGPAKNETPDKGNDREKS  34



Lambda      K        H        a         alpha
   0.316    0.132    0.381    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554004616485