BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF008F01

Length=409
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006346286.1|  PREDICTED: magnesium transporter MRS2-3-like       168   1e-46   Solanum tuberosum [potatoes]
ref|XP_004230684.1|  PREDICTED: magnesium transporter MRS2-3            167   3e-46   Solanum lycopersicum
ref|XP_009603567.1|  PREDICTED: magnesium transporter MRS2-3 isof...    159   6e-44   Nicotiana tomentosiformis
ref|XP_008344292.1|  PREDICTED: magnesium transporter MRS2-3-like       159   6e-44   
ref|XP_011077822.1|  PREDICTED: magnesium transporter MRS2-3            160   8e-44   Sesamum indicum [beniseed]
ref|XP_006486900.1|  PREDICTED: magnesium transporter MRS2-3-like       155   1e-43   Citrus sinensis [apfelsine]
ref|XP_009603566.1|  PREDICTED: magnesium transporter MRS2-3 isof...    159   2e-43   Nicotiana tomentosiformis
ref|XP_006422781.1|  hypothetical protein CICLE_v10028291mg             159   2e-43   Citrus clementina [clementine]
gb|EYU38670.1|  hypothetical protein MIMGU_mgv1a021974mg                158   3e-43   Erythranthe guttata [common monkey flower]
ref|XP_009790318.1|  PREDICTED: magnesium transporter MRS2-3 isof...    159   3e-43   Nicotiana sylvestris
ref|XP_006486899.1|  PREDICTED: magnesium transporter MRS2-3-like       159   4e-43   Citrus sinensis [apfelsine]
ref|XP_008351798.1|  PREDICTED: magnesium transporter MRS2-3 isof...    157   4e-43   Malus domestica [apple tree]
ref|XP_009343185.1|  PREDICTED: magnesium transporter MRS2-3-like       158   5e-43   Pyrus x bretschneideri [bai li]
ref|XP_008351785.1|  PREDICTED: magnesium transporter MRS2-3 isof...    157   2e-42   Malus domestica [apple tree]
ref|XP_008351791.1|  PREDICTED: magnesium transporter MRS2-3 isof...    156   2e-42   Malus domestica [apple tree]
emb|CAN74924.1|  hypothetical protein VITISV_038591                     151   4e-42   Vitis vinifera
ref|XP_010691547.1|  PREDICTED: magnesium transporter MRS2-3            155   5e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009343909.1|  PREDICTED: magnesium transporter MRS2-3-like...    154   7e-42   Pyrus x bretschneideri [bai li]
gb|KDP44523.1|  hypothetical protein JCGZ_16356                         155   1e-41   Jatropha curcas
ref|XP_009343908.1|  PREDICTED: magnesium transporter MRS2-3-like...    154   3e-41   Pyrus x bretschneideri [bai li]
gb|ABR17972.1|  unknown                                                 153   5e-41   Picea sitchensis
ref|XP_002300279.2|  hypothetical protein POPTR_0001s29920g             149   1e-40   
ref|XP_002268333.1|  PREDICTED: magnesium transporter MRS2-3            152   1e-40   Vitis vinifera
ref|XP_009375650.1|  PREDICTED: magnesium transporter MRS2-3-like       151   2e-40   
ref|XP_010273130.1|  PREDICTED: magnesium transporter MRS2-3            150   7e-40   Nelumbo nucifera [Indian lotus]
ref|XP_007042676.1|  Magnesium transporter 4 isoform 2                  150   7e-40   
ref|XP_007200985.1|  hypothetical protein PRUPE_ppa004809mg             149   9e-40   Prunus persica
ref|XP_007042675.1|  Magnesium transporter 4 isoform 1                  149   1e-39   
ref|XP_008236295.1|  PREDICTED: magnesium transporter MRS2-3-like       149   1e-39   Prunus mume [ume]
ref|XP_006422784.1|  hypothetical protein CICLE_v10028752mg             144   3e-39   
ref|XP_008455051.1|  PREDICTED: magnesium transporter MRS2-3 isof...    148   3e-39   Cucumis melo [Oriental melon]
ref|XP_008455050.1|  PREDICTED: magnesium transporter MRS2-3 isof...    148   3e-39   Cucumis melo [Oriental melon]
gb|KJB12309.1|  hypothetical protein B456_002G010900                    145   3e-39   Gossypium raimondii
ref|XP_006422782.1|  hypothetical protein CICLE_v10028752mg             142   3e-39   
ref|XP_010028349.1|  PREDICTED: LOW QUALITY PROTEIN: magnesium tr...    148   4e-39   
ref|XP_004136933.1|  PREDICTED: magnesium transporter MRS2-3-like       147   5e-39   Cucumis sativus [cucumbers]
ref|XP_006422786.1|  hypothetical protein CICLE_v10028752mg             143   5e-39   
ref|XP_006422787.1|  hypothetical protein CICLE_v10028752mg             145   7e-39   
ref|XP_004292113.1|  PREDICTED: magnesium transporter MRS2-3            147   8e-39   Fragaria vesca subsp. vesca
ref|XP_010088315.1|  Magnesium transporter MRS2-3                       147   9e-39   Morus notabilis
ref|XP_002313918.2|  magnesium transporter CorA-like family protein     147   9e-39   
gb|KJB12311.1|  hypothetical protein B456_002G010900                    145   1e-38   Gossypium raimondii
ref|XP_006422785.1|  hypothetical protein CICLE_v10028752mg             144   1e-38   
ref|XP_006422783.1|  hypothetical protein CICLE_v10028752mg             144   1e-38   
ref|XP_011094263.1|  PREDICTED: magnesium transporter MRS2-3-like       146   1e-38   
ref|XP_006433222.1|  hypothetical protein CICLE_v10003981mg             141   2e-38   
ref|XP_004511321.1|  PREDICTED: magnesium transporter MRS2-3-like       144   4e-38   Cicer arietinum [garbanzo]
ref|XP_011002248.1|  PREDICTED: magnesium transporter MRS2-3-like       144   5e-38   Populus euphratica
ref|XP_011030313.1|  PREDICTED: magnesium transporter MRS2-3-like...    144   5e-38   Populus euphratica
ref|XP_011030312.1|  PREDICTED: magnesium transporter MRS2-3-like...    144   6e-38   Populus euphratica
ref|XP_011071765.1|  PREDICTED: magnesium transporter MRS2-3-like       144   8e-38   Sesamum indicum [beniseed]
ref|XP_007157203.1|  hypothetical protein PHAVU_002G051200g             143   9e-38   Phaseolus vulgaris [French bean]
gb|KJB12308.1|  hypothetical protein B456_002G010900                    143   1e-37   Gossypium raimondii
gb|KJB12310.1|  hypothetical protein B456_002G010900                    143   1e-37   Gossypium raimondii
gb|KHG12836.1|  Magnesium transporter MRS2-3 -like protein              143   1e-37   Gossypium arboreum [tree cotton]
ref|XP_002522142.1|  RNA splicing protein mrs2, mitochondrial, pu...    143   1e-37   
gb|KHN35209.1|  Magnesium transporter MRS2-3                            142   1e-37   Glycine soja [wild soybean]
ref|XP_006857124.1|  hypothetical protein AMTR_s00065p00139210          143   2e-37   Amborella trichopoda
ref|XP_006486898.1|  PREDICTED: magnesium transporter MRS2-3-like       143   2e-37   Citrus sinensis [apfelsine]
emb|CDY58861.1|  BnaCnng33870D                                          144   3e-37   Brassica napus [oilseed rape]
ref|XP_003610633.1|  Magnesium transporter                              142   3e-37   Medicago truncatula
emb|CDY66275.1|  BnaAnng21960D                                          142   3e-37   Brassica napus [oilseed rape]
ref|XP_006590388.1|  PREDICTED: magnesium transporter MRS2-3-like       141   3e-37   Glycine max [soybeans]
ref|XP_002522143.1|  RNA splicing protein mrs2, mitochondrial, pu...    142   3e-37   
ref|XP_009145765.1|  PREDICTED: magnesium transporter MRS2-3-like       142   4e-37   Brassica rapa
ref|XP_003516767.1|  PREDICTED: magnesium transporter MRS2-3-like       140   6e-37   Glycine max [soybeans]
gb|EPS69517.1|  hypothetical protein M569_05248                         140   9e-37   Genlisea aurea
gb|KFK39291.1|  hypothetical protein AALP_AA3G225600                    140   1e-36   Arabis alpina [alpine rockcress]
gb|KFK39290.1|  hypothetical protein AALP_AA3G225600                    140   1e-36   Arabis alpina [alpine rockcress]
gb|KJB79462.1|  hypothetical protein B456_013G051100                    137   1e-35   Gossypium raimondii
emb|CDY42196.1|  BnaA01g25990D                                          137   3e-35   Brassica napus [oilseed rape]
ref|XP_009111645.1|  PREDICTED: magnesium transporter MRS2-3-like...    136   3e-35   Brassica rapa
ref|XP_009111637.1|  PREDICTED: magnesium transporter MRS2-3-like...    136   3e-35   Brassica rapa
gb|AFK48474.1|  unknown                                                 134   1e-34   Lotus japonicus
gb|EPS72108.1|  hypothetical protein M569_02647                         137   3e-34   Genlisea aurea
emb|CDP20393.1|  unnamed protein product                                134   3e-34   Coffea canephora [robusta coffee]
gb|KFK31826.1|  hypothetical protein AALP_AA6G163500                    134   3e-34   Arabis alpina [alpine rockcress]
ref|XP_008236348.1|  PREDICTED: magnesium transporter MRS2-3-like       134   5e-34   Prunus mume [ume]
emb|CDX95430.1|  BnaC01g33220D                                          133   7e-34   
ref|XP_006406476.1|  hypothetical protein EUTSA_v10020646mg             133   7e-34   Eutrema salsugineum [saltwater cress]
ref|XP_009399090.1|  PREDICTED: magnesium transporter MRS2-3            133   9e-34   
ref|XP_007199181.1|  hypothetical protein PRUPE_ppa020091mg             132   1e-33   
ref|XP_004296095.1|  PREDICTED: magnesium transporter MRS2-3-like       130   4e-33   Fragaria vesca subsp. vesca
ref|XP_010941938.1|  PREDICTED: magnesium transporter MRS2-3-like       129   1e-32   
ref|XP_010558892.1|  PREDICTED: magnesium transporter MRS2-3            128   3e-32   
gb|EPS69518.1|  hypothetical protein M569_05249                         127   8e-32   Genlisea aurea
gb|ABR17877.1|  unknown                                                 126   2e-31   Picea sitchensis
ref|XP_002980531.1|  hypothetical protein SELMODRAFT_53759              125   3e-31   
ref|XP_002976803.1|  hypothetical protein SELMODRAFT_53758              125   3e-31   
ref|XP_010030273.1|  PREDICTED: magnesium transporter MRS2-3-like       119   3e-31   
ref|XP_010487909.1|  PREDICTED: magnesium transporter MRS2-3-like       125   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010507876.1|  PREDICTED: magnesium transporter MRS2-3            125   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010466120.1|  PREDICTED: magnesium transporter MRS2-3-like       125   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_002883195.1|  hypothetical protein ARALYDRAFT_479481             124   7e-31   Arabidopsis lyrata subsp. lyrata
gb|KFK40012.1|  hypothetical protein AALP_AA3G318600                    124   7e-31   Arabis alpina [alpine rockcress]
ref|XP_009402632.1|  PREDICTED: magnesium transporter MRS2-F-like       124   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010242791.1|  PREDICTED: magnesium transporter MRS2-F-like       123   1e-30   Nelumbo nucifera [Indian lotus]
gb|KCW54071.1|  hypothetical protein EUGRSUZ_I00051                     120   2e-30   Eucalyptus grandis [rose gum]
ref|XP_010242771.1|  PREDICTED: magnesium transporter MRS2-F-like...    122   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_006492023.1|  PREDICTED: magnesium transporter MRS2-F-like       122   4e-30   
ref|XP_006427735.1|  hypothetical protein CICLE_v10027569mg             122   4e-30   
gb|KDO45570.1|  hypothetical protein CISIN_1g015133mg                   122   4e-30   Citrus sinensis [apfelsine]
ref|XP_010652955.1|  PREDICTED: magnesium transporter MRS2-F-like       122   6e-30   Vitis vinifera
ref|XP_010027528.1|  PREDICTED: magnesium transporter MRS2-F-like       121   9e-30   Eucalyptus grandis [rose gum]
ref|XP_008465203.1|  PREDICTED: magnesium transporter MRS2-2-like       117   1e-29   
ref|XP_006297595.1|  hypothetical protein CARUB_v10013617mg             121   1e-29   Capsella rubella
ref|NP_188598.2|  magnesium transporter MRS2-3                          121   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006595173.1|  PREDICTED: magnesium transporter MRS2-F-like       120   1e-29   Glycine max [soybeans]
gb|KDO41916.1|  hypothetical protein CISIN_1g032866mg                   114   2e-29   Citrus sinensis [apfelsine]
gb|EYU33006.1|  hypothetical protein MIMGU_mgv1a008815mg                119   3e-29   Erythranthe guttata [common monkey flower]
ref|XP_008785925.1|  PREDICTED: magnesium transporter MRS2-F-like       120   3e-29   
gb|AHB08883.1|  magnesium transporter MRS2-I isoform 1                  119   4e-29   Suaeda glauca
ref|XP_006492020.1|  PREDICTED: magnesium transporter MRS2-F-like...    115   4e-29   Citrus sinensis [apfelsine]
ref|XP_006492021.1|  PREDICTED: magnesium transporter MRS2-F-like...    115   4e-29   Citrus sinensis [apfelsine]
ref|XP_006492018.1|  PREDICTED: magnesium transporter MRS2-F-like...    115   6e-29   Citrus sinensis [apfelsine]
ref|XP_008775464.1|  PREDICTED: magnesium transporter MRS2-I-like       114   7e-29   
ref|XP_010065748.1|  PREDICTED: magnesium transporter MRS2-3-like       119   7e-29   Eucalyptus grandis [rose gum]
ref|XP_006847050.1|  hypothetical protein AMTR_s00017p00189670          118   1e-28   
gb|EYU32515.1|  hypothetical protein MIMGU_mgv1a024210mg                118   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_006492017.1|  PREDICTED: magnesium transporter MRS2-F-like...    117   1e-28   Citrus sinensis [apfelsine]
ref|XP_004150432.1|  PREDICTED: magnesium transporter MRS2-2-like       117   1e-28   Cucumis sativus [cucumbers]
ref|XP_011091115.1|  PREDICTED: magnesium transporter MRS2-I-like...    117   2e-28   Sesamum indicum [beniseed]
ref|XP_011091116.1|  PREDICTED: magnesium transporter MRS2-I-like...    117   2e-28   Sesamum indicum [beniseed]
ref|XP_010912043.1|  PREDICTED: magnesium transporter MRS2-F-like       117   2e-28   Elaeis guineensis
ref|XP_002310545.2|  hypothetical protein POPTR_0007s04900g             117   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_007143876.1|  hypothetical protein PHAVU_007G109400g             116   2e-28   Phaseolus vulgaris [French bean]
ref|XP_009599329.1|  PREDICTED: magnesium transporter MRS2-I-like       117   3e-28   Nicotiana tomentosiformis
ref|XP_002520990.1|  RNA splicing protein mrs2, mitochondrial, pu...    117   3e-28   Ricinus communis
ref|XP_010912044.1|  PREDICTED: LOW QUALITY PROTEIN: magnesium tr...    117   3e-28   Elaeis guineensis
ref|XP_006838858.1|  hypothetical protein AMTR_s00002p00265910          116   4e-28   
ref|XP_011022848.1|  PREDICTED: magnesium transporter MRS2-F-like       116   4e-28   Populus euphratica
ref|XP_009385103.1|  PREDICTED: magnesium transporter MRS2-F-like       116   6e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010932874.1|  PREDICTED: magnesium transporter MRS2-I-like       115   8e-28   Elaeis guineensis
ref|XP_009799375.1|  PREDICTED: magnesium transporter MRS2-I-like       115   1e-27   Nicotiana sylvestris
ref|XP_008677478.1|  PREDICTED: LOC100283487 isoform X2                 115   1e-27   Zea mays [maize]
ref|XP_011073486.1|  PREDICTED: magnesium transporter MRS2-I-like       115   1e-27   Sesamum indicum [beniseed]
gb|ACN31570.1|  unknown                                                 115   1e-27   Zea mays [maize]
ref|XP_008785924.1|  PREDICTED: magnesium transporter MRS2-F-like       115   1e-27   
ref|XP_006847049.1|  hypothetical protein AMTR_s00017p00188570          115   1e-27   
gb|KCW63394.1|  hypothetical protein EUGRSUZ_G01039                     115   1e-27   Eucalyptus grandis [rose gum]
ref|NP_001149859.1|  LOC100283487                                       115   1e-27   Zea mays [maize]
ref|XP_008677476.1|  PREDICTED: LOC100283487 isoform X1                 114   1e-27   Zea mays [maize]
gb|KHF98502.1|  Magnesium transporter MRS2-10 -like protein             112   2e-27   Gossypium arboreum [tree cotton]
ref|XP_010917593.1|  PREDICTED: magnesium transporter MRS2-I-like       114   2e-27   Elaeis guineensis
gb|KCW63395.1|  hypothetical protein EUGRSUZ_G01040                     114   2e-27   Eucalyptus grandis [rose gum]
ref|XP_006597109.1|  PREDICTED: magnesium transporter MRS2-3-like       108   3e-27   
ref|XP_010065747.1|  PREDICTED: magnesium transporter MRS2-3-like...    114   3e-27   Eucalyptus grandis [rose gum]
ref|XP_010065746.1|  PREDICTED: magnesium transporter MRS2-3-like...    114   3e-27   Eucalyptus grandis [rose gum]
gb|EPS65976.1|  hypothetical protein M569_08801                         114   3e-27   Genlisea aurea
ref|XP_010232713.1|  PREDICTED: magnesium transporter MRS2-F-like       114   3e-27   Brachypodium distachyon [annual false brome]
emb|CDP20394.1|  unnamed protein product                                114   4e-27   Coffea canephora [robusta coffee]
gb|EPS60304.1|  magnesium transporter                                   111   4e-27   Genlisea aurea
sp|Q8L4S2.1|MRS2F_ORYSJ  RecName: Full=Magnesium transporter MRS2-F     114   4e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006411758.1|  hypothetical protein EUTSA_v10027315mg             114   5e-27   
ref|XP_010526977.1|  PREDICTED: magnesium transporter MRS2-F-like       113   6e-27   Tarenaya hassleriana [spider flower]
gb|AFW84241.1|  hypothetical protein ZEAMMB73_119664                    110   6e-27   
ref|XP_008786166.1|  PREDICTED: magnesium transporter MRS2-I-like       113   7e-27   Phoenix dactylifera
ref|XP_010232712.1|  PREDICTED: magnesium transporter MRS2-F-like       113   8e-27   Brachypodium distachyon [annual false brome]
ref|XP_010669638.1|  PREDICTED: magnesium transporter MRS2-I-like       112   9e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006378361.1|  hypothetical protein POPTR_0010s08850g             112   9e-27   
gb|KJB66345.1|  hypothetical protein B456_010G136800                    112   9e-27   Gossypium raimondii
ref|XP_010694561.1|  PREDICTED: magnesium transporter MRS2-I-like       112   9e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB66346.1|  hypothetical protein B456_010G136800                    112   1e-26   Gossypium raimondii
gb|KJB66347.1|  hypothetical protein B456_010G136800                    112   1e-26   Gossypium raimondii
ref|XP_008353796.1|  PREDICTED: magnesium transporter MRS2-1-like       110   1e-26   
ref|XP_004495386.1|  PREDICTED: magnesium transporter MRS2-2-like...    112   1e-26   Cicer arietinum [garbanzo]
gb|KJB72319.1|  hypothetical protein B456_011G170800                    111   1e-26   Gossypium raimondii
ref|XP_003556388.1|  PREDICTED: magnesium transporter MRS2-2-like...    112   1e-26   Glycine max [soybeans]
ref|XP_009761375.1|  PREDICTED: magnesium transporter MRS2-1-like       109   1e-26   Nicotiana sylvestris
gb|KDP21359.1|  hypothetical protein JCGZ_21830                         112   1e-26   Jatropha curcas
ref|XP_008353611.1|  PREDICTED: LOW QUALITY PROTEIN: protein GAME...    114   1e-26   
ref|XP_006368495.1|  hypothetical protein POPTR_0001s03480g             112   1e-26   
ref|XP_010274193.1|  PREDICTED: magnesium transporter MRS2-2-like...    112   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010274191.1|  PREDICTED: magnesium transporter MRS2-I-like...    112   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010927960.1|  PREDICTED: magnesium transporter MRS2-1-like       112   2e-26   
gb|KJB72316.1|  hypothetical protein B456_011G170800                    111   2e-26   Gossypium raimondii
ref|XP_002315734.1|  magnesium transporter CorA-like family protein     112   2e-26   Populus trichocarpa [western balsam poplar]
emb|CDO98239.1|  unnamed protein product                                112   2e-26   Coffea canephora [robusta coffee]
gb|KHN05058.1|  Magnesium transporter MRS2-I                            111   2e-26   Glycine soja [wild soybean]
gb|KJB35251.1|  hypothetical protein B456_006G106900                    112   2e-26   Gossypium raimondii
emb|CAN67333.1|  hypothetical protein VITISV_024485                     109   2e-26   Vitis vinifera
ref|NP_001240913.1|  uncharacterized protein LOC100786817               111   2e-26   Glycine max [soybeans]
ref|XP_006356054.1|  PREDICTED: magnesium transporter MRS2-I-like...    111   2e-26   Solanum tuberosum [potatoes]
emb|CBI17946.3|  unnamed protein product                                108   2e-26   Vitis vinifera
gb|KDP41956.1|  hypothetical protein JCGZ_26974                         111   3e-26   Jatropha curcas
ref|XP_011029888.1|  PREDICTED: magnesium transporter MRS2-2            111   3e-26   Populus euphratica
ref|XP_011073319.1|  PREDICTED: magnesium transporter MRS2-1-like       111   3e-26   Sesamum indicum [beniseed]
emb|CDM85537.1|  unnamed protein product                                111   3e-26   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010278149.1|  PREDICTED: magnesium transporter MRS2-I-like       111   3e-26   Nelumbo nucifera [Indian lotus]
gb|KJB72318.1|  hypothetical protein B456_011G170800                    111   3e-26   Gossypium raimondii
gb|KDO55344.1|  hypothetical protein CISIN_1g013533mg                   111   3e-26   Citrus sinensis [apfelsine]
ref|XP_002263392.1|  PREDICTED: magnesium transporter MRS2-1-like       111   3e-26   Vitis vinifera
ref|XP_010670835.1|  PREDICTED: magnesium transporter MRS2-I-like       111   3e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010260014.1|  PREDICTED: magnesium transporter MRS2-5            111   3e-26   Nelumbo nucifera [Indian lotus]
ref|XP_008788159.1|  PREDICTED: magnesium transporter MRS2-I-like       111   3e-26   
ref|XP_006356053.1|  PREDICTED: magnesium transporter MRS2-I-like...    111   3e-26   Solanum tuberosum [potatoes]
ref|XP_002311660.1|  magnesium transporter CorA-like family protein     111   4e-26   Populus trichocarpa [western balsam poplar]
gb|KHG22959.1|  Magnesium transporter MRS2-I                            111   4e-26   Gossypium arboreum [tree cotton]
ref|XP_007023463.1|  Magnesium transporter isoform 3                    111   4e-26   
emb|CAN71705.1|  hypothetical protein VITISV_001335                     112   4e-26   Vitis vinifera
ref|XP_010917591.1|  PREDICTED: magnesium transporter MRS2-I-like       110   4e-26   Elaeis guineensis
ref|XP_007023462.1|  Magnesium transporter 2 isoform 2                  110   4e-26   
ref|XP_004234030.1|  PREDICTED: magnesium transporter MRS2-I            110   4e-26   Solanum lycopersicum
dbj|BAK02642.1|  predicted protein                                      111   4e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001765484.1|  predicted protein                                  110   4e-26   
sp|B8AJT9.1|MRS2I_ORYSI  RecName: Full=Magnesium transporter MRS2-I     110   5e-26   Oryza sativa Indica Group [Indian rice]
sp|Q10D38.1|MRS2I_ORYSJ  RecName: Full=Magnesium transporter MRS2-I     110   5e-26   Oryza sativa Japonica Group [Japonica rice]
gb|KJB66344.1|  hypothetical protein B456_010G136800                    110   6e-26   Gossypium raimondii
ref|XP_002310546.2|  hypothetical protein POPTR_0007s04910g             110   6e-26   
ref|XP_010537853.1|  PREDICTED: magnesium transporter MRS2-1-like       110   7e-26   Tarenaya hassleriana [spider flower]
ref|XP_006385933.1|  hypothetical protein POPTR_0003s18180g             110   7e-26   
ref|XP_008465136.1|  PREDICTED: magnesium transporter MRS2-1            110   7e-26   Cucumis melo [Oriental melon]
ref|XP_004160340.1|  PREDICTED: magnesium transporter MRS2-1-like       110   7e-26   
ref|XP_004137654.1|  PREDICTED: magnesium transporter MRS2-1-like       110   8e-26   Cucumis sativus [cucumbers]
emb|CDO99157.1|  unnamed protein product                                110   8e-26   Coffea canephora [robusta coffee]
emb|CDX88569.1|  BnaC06g40130D                                          110   8e-26   
ref|XP_009348287.1|  PREDICTED: magnesium transporter MRS2-2-like       110   8e-26   Pyrus x bretschneideri [bai li]
ref|XP_010069167.1|  PREDICTED: magnesium transporter MRS2-I-like       110   9e-26   Eucalyptus grandis [rose gum]
ref|XP_004981821.1|  PREDICTED: magnesium transporter MRS2-I-like       110   9e-26   Setaria italica
ref|NP_001142108.1|  hypothetical protein                               110   9e-26   Zea mays [maize]
ref|XP_006368496.1|  magnesium transporter CorA-like family protein     110   9e-26   Populus trichocarpa [western balsam poplar]
ref|XP_004513485.1|  PREDICTED: magnesium transporter MRS2-2-like...    109   1e-25   Cicer arietinum [garbanzo]
ref|XP_010674588.1|  PREDICTED: magnesium transporter MRS2-F-like       110   1e-25   
ref|XP_011034561.1|  PREDICTED: magnesium transporter MRS2-1 isof...    110   1e-25   Populus euphratica
ref|XP_004514761.1|  PREDICTED: magnesium transporter MRS2-2-like...    109   1e-25   Cicer arietinum [garbanzo]
ref|XP_004495389.1|  PREDICTED: magnesium transporter MRS2-2-like...    109   1e-25   Cicer arietinum [garbanzo]
gb|EYU21742.1|  hypothetical protein MIMGU_mgv1a006408mg                110   1e-25   Erythranthe guttata [common monkey flower]
ref|XP_010539542.1|  PREDICTED: magnesium transporter MRS2-1            110   1e-25   Tarenaya hassleriana [spider flower]
ref|XP_008224183.1|  PREDICTED: LOW QUALITY PROTEIN: magnesium tr...    109   1e-25   Prunus mume [ume]
ref|XP_011034560.1|  PREDICTED: magnesium transporter MRS2-1 isof...    110   1e-25   Populus euphratica
gb|KHN22419.1|  Magnesium transporter MRS2-F                            109   1e-25   Glycine soja [wild soybean]
emb|CDY22292.1|  BnaC02g25960D                                          109   1e-25   Brassica napus [oilseed rape]
ref|XP_004970981.1|  PREDICTED: magnesium transporter MRS2-F-like       109   1e-25   Setaria italica
ref|XP_010273633.1|  PREDICTED: magnesium transporter MRS2-1-like       109   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_007023461.1|  Magnesium transporter isoform 1                    109   1e-25   Theobroma cacao [chocolate]
ref|XP_009106708.1|  PREDICTED: magnesium transporter MRS2-10-like      109   1e-25   Brassica rapa
ref|XP_007034964.1|  Magnesium transporter MRS2-2 isoform 2             109   2e-25   
ref|XP_004486600.1|  PREDICTED: magnesium transporter MRS2-1-like...    109   2e-25   Cicer arietinum [garbanzo]
ref|XP_008674680.1|  PREDICTED: magnesium transporter MRS2-F isof...    108   2e-25   Zea mays [maize]
ref|XP_007223020.1|  hypothetical protein PRUPE_ppa006863mg             109   2e-25   Prunus persica
ref|XP_010651941.1|  PREDICTED: magnesium transporter MRS2-2-like...    108   2e-25   Vitis vinifera
ref|XP_007034963.1|  Magnesium transporter MRS2-2 isoform 1             109   2e-25   
ref|XP_001784777.1|  predicted protein                                  109   2e-25   
ref|XP_003543708.1|  PREDICTED: magnesium transporter MRS2-1-like...    109   2e-25   Glycine max [soybeans]
ref|XP_010094052.1|  Magnesium transporter MRS2-1                       109   2e-25   Morus notabilis
ref|XP_008381115.1|  PREDICTED: magnesium transporter MRS2-1-like...    109   2e-25   Malus domestica [apple tree]
ref|XP_002282145.1|  PREDICTED: magnesium transporter MRS2-I-like...    108   2e-25   Vitis vinifera
ref|XP_006416855.1|  hypothetical protein EUTSA_v10007638mg             109   2e-25   Eutrema salsugineum [saltwater cress]
ref|XP_008674679.1|  PREDICTED: magnesium transporter MRS2-F isof...    109   2e-25   Zea mays [maize]
ref|XP_008342817.1|  PREDICTED: magnesium transporter MRS2-1            109   2e-25   
ref|XP_003546700.1|  PREDICTED: magnesium transporter MRS2-1-like       109   2e-25   Glycine max [soybeans]
ref|XP_011082443.1|  PREDICTED: magnesium transporter MRS2-1-like       109   2e-25   
emb|CDX87352.1|  BnaA07g35210D                                          108   2e-25   
ref|XP_002304732.1|  hypothetical protein POPTR_0003s18180g             109   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_006604483.1|  PREDICTED: magnesium transporter MRS2-I-like...    108   2e-25   Glycine max [soybeans]
ref|XP_010069170.1|  PREDICTED: magnesium transporter MRS2-I-like...    108   2e-25   Eucalyptus grandis [rose gum]
ref|XP_006385931.1|  hypothetical protein POPTR_0003s18180g             109   2e-25   
ref|XP_006604484.1|  PREDICTED: magnesium transporter MRS2-I-like...    108   2e-25   Glycine max [soybeans]
gb|KCW57433.1|  hypothetical protein EUGRSUZ_H00214                     108   2e-25   Eucalyptus grandis [rose gum]
ref|XP_006595191.1|  PREDICTED: magnesium transporter MRS2-1-like...    108   2e-25   
ref|XP_010651940.1|  PREDICTED: magnesium transporter MRS2-2-like...    108   2e-25   Vitis vinifera
ref|XP_002458951.1|  hypothetical protein SORBIDRAFT_03g043270          108   2e-25   Sorghum bicolor [broomcorn]
ref|XP_008381120.1|  PREDICTED: magnesium transporter MRS2-1-like...    108   2e-25   Malus domestica [apple tree]
ref|XP_004303233.1|  PREDICTED: magnesium transporter MRS2-1            108   2e-25   Fragaria vesca subsp. vesca
ref|XP_006304371.1|  hypothetical protein CARUB_v10010853mg             108   2e-25   Capsella rubella
ref|XP_009354204.1|  PREDICTED: magnesium transporter MRS2-1            108   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_009149042.1|  PREDICTED: magnesium transporter MRS2-1            108   2e-25   Brassica rapa
ref|XP_006493378.1|  PREDICTED: magnesium transporter MRS2-1-like...    108   2e-25   Citrus sinensis [apfelsine]
ref|XP_009375484.1|  PREDICTED: magnesium transporter MRS2-1-like...    109   2e-25   
ref|XP_004241677.1|  PREDICTED: magnesium transporter MRS2-1            108   2e-25   Solanum lycopersicum
ref|XP_006427652.1|  hypothetical protein CICLE_v10025612mg             108   2e-25   
ref|XP_004288429.1|  PREDICTED: magnesium transporter MRS2-I-like       108   2e-25   Fragaria vesca subsp. vesca
ref|XP_010476702.1|  PREDICTED: magnesium transporter MRS2-1            108   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006356254.1|  PREDICTED: magnesium transporter MRS2-1-like       108   3e-25   Solanum tuberosum [potatoes]
ref|XP_010649991.1|  PREDICTED: magnesium transporter MRS2-2 isof...    108   3e-25   Vitis vinifera
ref|XP_001785633.1|  predicted protein                                  108   3e-25   
ref|XP_006576925.1|  PREDICTED: magnesium transporter MRS2-I-like...    108   3e-25   Glycine max [soybeans]
ref|XP_006576923.1|  PREDICTED: magnesium transporter MRS2-I-like...    108   3e-25   Glycine max [soybeans]
ref|XP_009375489.1|  PREDICTED: magnesium transporter MRS2-1-like...    108   3e-25   Pyrus x bretschneideri [bai li]
ref|XP_004513500.1|  PREDICTED: magnesium transporter MRS2-2-like       102   3e-25   
ref|XP_007143594.1|  hypothetical protein PHAVU_007G084900g             108   3e-25   
ref|XP_002284181.1|  PREDICTED: magnesium transporter MRS2-I isof...    108   3e-25   
ref|XP_002963050.1|  hypothetical protein SELMODRAFT_165647             108   3e-25   
emb|CDP20392.1|  unnamed protein product                                108   3e-25   
ref|XP_006576922.1|  PREDICTED: magnesium transporter MRS2-I-like...    108   3e-25   
ref|XP_009627899.1|  PREDICTED: magnesium transporter MRS2-1            108   3e-25   
emb|CDY35061.1|  BnaA06g10710D                                          108   3e-25   
ref|XP_011020585.1|  PREDICTED: magnesium transporter MRS2-1-like       108   3e-25   
emb|CDY33361.1|  BnaC05g12220D                                          108   3e-25   
ref|NP_563988.1|  magnesium transporter MRS2-1                          108   4e-25   
ref|XP_010497574.1|  PREDICTED: magnesium transporter MRS2-1-like       108   4e-25   
ref|XP_002892891.1|  hypothetical protein ARALYDRAFT_471800             108   4e-25   
ref|XP_006845374.1|  hypothetical protein AMTR_s00019p00038520          108   4e-25   
ref|XP_009337295.1|  PREDICTED: magnesium transporter MRS2-2-like       108   4e-25   
ref|XP_003559849.1|  PREDICTED: magnesium transporter MRS2-I            108   4e-25   
ref|XP_002980285.1|  hypothetical protein SELMODRAFT_112303             108   4e-25   
ref|XP_003554279.1|  PREDICTED: magnesium transporter MRS2-I-like...    107   5e-25   
ref|XP_007215378.1|  hypothetical protein PRUPE_ppa005729mg             108   5e-25   
ref|XP_006576924.1|  PREDICTED: magnesium transporter MRS2-I-like...    107   5e-25   
gb|KCW70822.1|  hypothetical protein EUGRSUZ_F03969                     107   5e-25   
ref|XP_008228805.1|  PREDICTED: magnesium transporter MRS2-1            108   5e-25   
ref|XP_003521272.1|  PREDICTED: magnesium transporter MRS2-I-like...    107   5e-25   
ref|XP_003591809.1|  Magnesium transporter                              107   5e-25   
ref|XP_009128382.1|  PREDICTED: magnesium transporter MRS2-10           108   5e-25   
emb|CDY49735.1|  BnaA02g19370D                                          107   6e-25   
ref|XP_011075663.1|  PREDICTED: magnesium transporter MRS2-5            107   6e-25   
ref|XP_002463899.1|  hypothetical protein SORBIDRAFT_01g008500          107   6e-25   
ref|XP_008810307.1|  PREDICTED: magnesium transporter MRS2-1-like...    107   6e-25   
ref|XP_009418155.1|  PREDICTED: magnesium transporter MRS2-I-like       107   6e-25   
ref|XP_008810308.1|  PREDICTED: magnesium transporter MRS2-1-like...    107   7e-25   
ref|XP_002962208.1|  hypothetical protein SELMODRAFT_165091             107   7e-25   
emb|CDP03699.1|  unnamed protein product                                107   8e-25   
ref|XP_002512736.1|  RNA splicing protein mrs2, mitochondrial, pu...    107   8e-25   
ref|XP_007150818.1|  hypothetical protein PHAVU_005G183100g             107   8e-25   
gb|ABR16789.1|  unknown                                                 107   8e-25   
ref|XP_007163882.1|  hypothetical protein PHAVU_L008400g                104   9e-25   
gb|KJB12557.1|  hypothetical protein B456_002G024800                    106   9e-25   
ref|XP_006443906.1|  hypothetical protein CICLE_v10021401mg             106   9e-25   
gb|KDO53914.1|  hypothetical protein CISIN_1g016125mg                   106   9e-25   
ref|XP_007162502.1|  hypothetical protein PHAVU_001G157300g             107   9e-25   
ref|XP_006650566.1|  PREDICTED: magnesium transporter MRS2-I-like       107   1e-24   
gb|KJB72317.1|  hypothetical protein B456_011G170800                    106   1e-24   
gb|KDP40276.1|  hypothetical protein JCGZ_02274                         107   1e-24   
ref|XP_010265563.1|  PREDICTED: magnesium transporter MRS2-1            107   1e-24   
ref|XP_007139512.1|  hypothetical protein PHAVU_008G036000g             104   1e-24   
ref|XP_010547642.1|  PREDICTED: magnesium transporter MRS2-2 isof...    106   1e-24   
ref|XP_006420098.1|  hypothetical protein CICLE_v10005128mg             106   1e-24   
gb|KEH44009.1|  magnesium transporter 2                                 106   1e-24   
ref|XP_006489510.1|  PREDICTED: magnesium transporter MRS2-2-like       106   1e-24   
ref|XP_009407221.1|  PREDICTED: magnesium transporter MRS2-I-like       106   1e-24   
gb|KDO53912.1|  hypothetical protein CISIN_1g016125mg                   106   1e-24   
ref|XP_010936261.1|  PREDICTED: magnesium transporter MRS2-I-like...    105   1e-24   
ref|XP_010936254.1|  PREDICTED: magnesium transporter MRS2-I-like...    106   2e-24   
gb|KHG29401.1|  Magnesium transporter MRS2-2 -like protein              106   2e-24   
emb|CDO99158.1|  unnamed protein product                                106   2e-24   
ref|XP_010429885.1|  PREDICTED: magnesium transporter MRS2-10-like      105   2e-24   
ref|XP_002970710.1|  hypothetical protein SELMODRAFT_94109              106   2e-24   
ref|XP_002969379.1|  hypothetical protein SELMODRAFT_91491              106   2e-24   
gb|KJB12556.1|  hypothetical protein B456_002G024800                    105   2e-24   
ref|XP_010063580.1|  PREDICTED: magnesium transporter MRS2-1-like       106   2e-24   
ref|XP_010034036.1|  PREDICTED: magnesium transporter MRS2-1-like       107   2e-24   
ref|XP_001771257.1|  predicted protein                                  104   2e-24   
ref|XP_002517021.1|  RNA splicing protein mrs2, mitochondrial, pu...    106   2e-24   
gb|KJB80576.1|  hypothetical protein B456_013G104900                    105   2e-24   
gb|KJB12555.1|  hypothetical protein B456_002G024800                    106   2e-24   
ref|XP_010936246.1|  PREDICTED: magnesium transporter MRS2-I-like...    106   2e-24   
emb|CDO99156.1|  unnamed protein product                                105   2e-24   
ref|XP_008391050.1|  PREDICTED: magnesium transporter MRS2-I-like       105   2e-24   
gb|KJB80578.1|  hypothetical protein B456_013G104900                    105   2e-24   
ref|XP_006479586.1|  PREDICTED: magnesium transporter MRS2-I-like...    105   2e-24   
gb|KCW68576.1|  hypothetical protein EUGRSUZ_F02186                     105   2e-24   
ref|XP_004496868.1|  PREDICTED: magnesium transporter MRS2-3-like       105   3e-24   
ref|XP_007050411.1|  Magnesium transporter MRS2-2 isoform 2             105   3e-24   
ref|XP_006479587.1|  PREDICTED: magnesium transporter MRS2-I-like...    105   3e-24   
gb|KDO68528.1|  hypothetical protein CISIN_1g045110mg                   105   3e-24   
emb|CDO99155.1|  unnamed protein product                                105   3e-24   
ref|XP_010087765.1|  Magnesium transporter MRS2-2                       105   3e-24   
ref|XP_010547641.1|  PREDICTED: magnesium transporter MRS2-2 isof...    105   3e-24   
ref|XP_008341097.1|  PREDICTED: magnesium transporter MRS2-2-like       105   3e-24   
ref|XP_009125351.1|  PREDICTED: magnesium transporter MRS2-7            105   3e-24   
gb|KCW68575.1|  hypothetical protein EUGRSUZ_F02186                     105   3e-24   
ref|XP_010683570.1|  PREDICTED: magnesium transporter MRS2-1            105   3e-24   
ref|XP_010061592.1|  PREDICTED: magnesium transporter MRS2-I-like       105   4e-24   
gb|AAM62917.1|  unknown                                                 105   4e-24   
gb|KEH39658.1|  magnesium transporter MRS2-like protein                 105   4e-24   
ref|XP_008805128.1|  PREDICTED: magnesium transporter MRS2-5-like       105   4e-24   
ref|XP_006369722.1|  hypothetical protein POPTR_0001s29860g           99.8    5e-24   
gb|KJB80577.1|  hypothetical protein B456_013G104900                    105   5e-24   
gb|KHG04962.1|  Magnesium transporter MRS2-2 -like protein              105   5e-24   
ref|XP_008353298.1|  PREDICTED: magnesium transporter MRS2-I-like       105   5e-24   
ref|XP_007050410.1|  Magnesium transporter MRS2-2 isoform 1             105   5e-24   
ref|XP_010520475.1|  PREDICTED: magnesium transporter MRS2-2 isof...    105   5e-24   
ref|XP_010520469.1|  PREDICTED: magnesium transporter MRS2-2 isof...    105   5e-24   
ref|XP_009398380.1|  PREDICTED: magnesium transporter MRS2-I-like       104   5e-24   
dbj|BAK06708.1|  predicted protein                                      105   5e-24   
ref|NP_565247.1|  magnesium transporter MRS2-10                         105   5e-24   
ref|XP_006847048.1|  hypothetical protein AMTR_s00017p00187240          104   8e-24   
ref|XP_009383004.1|  PREDICTED: magnesium transporter MRS2-5 isof...    104   8e-24   
ref|XP_009383003.1|  PREDICTED: magnesium transporter MRS2-5 isof...    104   8e-24   
ref|XP_008810857.1|  PREDICTED: magnesium transporter MRS2-1-like       104   9e-24   
ref|XP_009356405.1|  PREDICTED: magnesium transporter MRS2-5            104   1e-23   
ref|XP_003630575.1|  Magnesium transporter                              102   1e-23   
ref|XP_009597387.1|  PREDICTED: magnesium transporter MRS2-I-like...    103   1e-23   
gb|KEH39657.1|  magnesium transporter MRS2-like protein                 104   1e-23   
ref|XP_002887805.1|  hypothetical protein ARALYDRAFT_895892             104   1e-23   
ref|XP_001786202.1|  predicted protein                                  105   1e-23   
ref|XP_009417452.1|  PREDICTED: magnesium transporter MRS2-1-like       103   1e-23   
ref|NP_001044924.1|  Os01g0869200                                       103   1e-23   
ref|XP_006389845.1|  hypothetical protein EUTSA_v10018562mg             103   1e-23   
ref|XP_009597389.1|  PREDICTED: magnesium transporter MRS2-I-like...    103   1e-23   
ref|XP_003637279.1|  Magnesium transporter MRS2-like protein            104   1e-23   
ref|XP_010091579.1|  hypothetical protein L484_026426                   101   2e-23   
gb|AEW09296.1|  hypothetical protein UMN_2814_01                      97.4    2e-23   
ref|XP_006394137.1|  hypothetical protein EUTSA_v10004289mg             103   3e-23   
ref|XP_010474504.1|  PREDICTED: magnesium transporter MRS2-10-like      103   3e-23   
ref|XP_010906144.1|  PREDICTED: magnesium transporter MRS2-5-like...    102   3e-23   
ref|XP_010417651.1|  PREDICTED: magnesium transporter MRS2-10           103   3e-23   
ref|XP_002866621.1|  hypothetical protein ARALYDRAFT_496668             102   3e-23   
ref|XP_006845843.1|  hypothetical protein AMTR_s00154p00031530          102   3e-23   
ref|XP_010906145.1|  PREDICTED: magnesium transporter MRS2-5-like...    102   3e-23   
gb|KHN16925.1|  Magnesium transporter MRS2-F                            102   3e-23   
ref|XP_010912175.1|  PREDICTED: magnesium transporter MRS2-1-like       103   3e-23   
gb|KEH23861.1|  magnesium transporter MRS2-like protein                 102   4e-23   
ref|XP_006646586.1|  PREDICTED: magnesium transporter MRS2-F-like       102   4e-23   
ref|XP_008389410.1|  PREDICTED: magnesium transporter MRS2-5            102   4e-23   
emb|CDY64844.1|  BnaCnng45320D                                          102   4e-23   
ref|NP_974757.2|  magnesium transporter MRS2-7                          102   4e-23   
ref|XP_010906142.1|  PREDICTED: magnesium transporter MRS2-5-like...    102   4e-23   
ref|XP_006584667.1|  PREDICTED: magnesium transporter MRS2-F-like       102   4e-23   
ref|XP_006369719.1|  hypothetical protein POPTR_0001s29800g           98.2    5e-23   
ref|XP_004493751.1|  PREDICTED: magnesium transporter MRS2-I-like...    102   5e-23   
ref|XP_004493752.1|  PREDICTED: magnesium transporter MRS2-I-like...    102   5e-23   
ref|XP_010326431.1|  PREDICTED: magnesium transporter MRS2-2 isof...    101   6e-23   
ref|XP_006394138.1|  hypothetical protein EUTSA_v10004289mg             102   6e-23   
gb|ACU20087.1|  unknown                                                 102   6e-23   
ref|XP_010326430.1|  PREDICTED: magnesium transporter MRS2-2 isof...    101   6e-23   
emb|CDY64845.1|  BnaCnng45330D                                          101   6e-23   
ref|XP_002274070.1|  PREDICTED: magnesium transporter MRS2-5            102   7e-23   
gb|KEH23863.1|  magnesium transporter MRS2-like protein                 101   7e-23   
ref|XP_011082609.1|  PREDICTED: magnesium transporter MRS2-I-like       102   7e-23   
dbj|BAB09524.1|  unnamed protein product                                102   7e-23   
gb|KEH23860.1|  magnesium transporter MRS2-like protein                 101   7e-23   
ref|XP_009793321.1|  PREDICTED: magnesium transporter MRS2-I-like...    101   8e-23   
gb|KJB12553.1|  hypothetical protein B456_002G024800                    101   8e-23   
gb|KJB12554.1|  hypothetical protein B456_002G024800                    101   8e-23   
gb|AAN73217.1|  MRS2-7                                                  101   8e-23   
ref|XP_009793323.1|  PREDICTED: magnesium transporter MRS2-I-like...    101   9e-23   
ref|NP_196531.2|  magnesium transporter MRS2-7                          101   9e-23   
ref|NP_001078557.1|  magnesium transporter MRS2-7                       101   1e-22   
ref|NP_850802.2|  magnesium transporter MRS2-7                          101   1e-22   
ref|XP_006395688.1|  hypothetical protein EUTSA_v10004291mg             101   1e-22   
ref|XP_009420311.1|  PREDICTED: magnesium transporter MRS2-1-like       101   1e-22   
ref|XP_004247216.1|  PREDICTED: magnesium transporter MRS2-I isof...    100   1e-22   
emb|CDY02984.1|  BnaC07g22430D                                          101   1e-22   
ref|XP_007222604.1|  hypothetical protein PRUPE_ppa006302mg             101   1e-22   
gb|AAN73215.1|  MRS2-5                                                  101   1e-22   
ref|XP_006293016.1|  hypothetical protein CARUB_v10019294mg             101   1e-22   
ref|XP_002876889.1|  hypothetical protein ARALYDRAFT_904644             101   1e-22   
ref|NP_178460.1|  magnesium transporter 3                               101   1e-22   
ref|XP_010514129.1|  PREDICTED: magnesium transporter MRS2-5-like...    101   1e-22   
emb|CDY36615.1|  BnaC06g06680D                                          101   1e-22   
ref|XP_010514130.1|  PREDICTED: magnesium transporter MRS2-5-like...    100   2e-22   
ref|XP_009150539.1|  PREDICTED: magnesium transporter MRS2-2-like...    100   2e-22   
emb|CDY51207.1|  BnaA06g39860D                                          100   2e-22   
ref|XP_009152159.1|  PREDICTED: magnesium transporter MRS2-5            100   2e-22   
ref|NP_201261.2|  magnesium transporter MRS2-2                          100   2e-22   
ref|XP_008243846.1|  PREDICTED: LOW QUALITY PROTEIN: magnesium tr...    100   2e-22   
ref|XP_010502379.1|  PREDICTED: magnesium transporter MRS2-5            100   2e-22   
ref|XP_008352958.1|  PREDICTED: magnesium transporter MRS2-5-like       100   2e-22   
gb|AES65934.2|  magnesium transporter MRS2-I, putative                95.9    2e-22   
emb|CDY56489.1|  BnaCnng30470D                                          100   2e-22   
ref|XP_009130460.1|  PREDICTED: magnesium transporter MRS2-2-like       100   2e-22   
emb|CDY31314.1|  BnaA02g34270D                                          100   2e-22   
gb|KJB50535.1|  hypothetical protein B456_008G177000                  99.0    2e-22   
emb|CDY46811.1|  BnaC02g43190D                                          100   2e-22   
emb|CDY51292.1|  BnaA06g23540D                                          100   2e-22   
ref|NP_851269.1|  magnesium transporter MRS2-2                          100   2e-22   
ref|XP_003595683.1|  Mg2+ transporter protein MGT7                    95.1    3e-22   
ref|XP_009592707.1|  PREDICTED: magnesium transporter MRS2-5            100   3e-22   
ref|XP_006351630.1|  PREDICTED: magnesium transporter MRS2-I-like       100   3e-22   
ref|XP_009150538.1|  PREDICTED: magnesium transporter MRS2-2-like...    100   3e-22   
gb|ABA26989.1|  TO36-3rc                                              95.5    3e-22   
ref|XP_010044397.1|  PREDICTED: magnesium transporter MRS2-5            100   3e-22   
ref|XP_010425160.1|  PREDICTED: magnesium transporter MRS2-5-like       100   4e-22   
emb|CDX81228.1|  BnaC09g06390D                                        99.8    4e-22   
ref|XP_009112139.1|  PREDICTED: magnesium transporter MRS2-2-like     99.8    4e-22   
ref|XP_010923549.1|  PREDICTED: magnesium transporter MRS2-I-like     99.8    4e-22   
emb|CDY18706.1|  BnaA09g06890D                                        99.8    4e-22   
ref|XP_010680685.1|  PREDICTED: magnesium transporter MRS2-5          99.8    4e-22   
ref|XP_004503914.1|  PREDICTED: magnesium transporter MRS2-F-like     99.8    4e-22   
emb|CAB89361.1|  putative protein                                     99.8    4e-22   
gb|KFK25273.1|  hypothetical protein AALP_AA8G090600                    100   5e-22   
ref|XP_002873417.1|  MRS2-7                                           99.4    6e-22   
ref|XP_004490198.1|  PREDICTED: magnesium transporter MRS2-5-like     99.4    6e-22   
ref|XP_007139490.1|  hypothetical protein PHAVU_008G033900g           98.6    6e-22   
dbj|BAJ86606.1|  predicted protein                                    99.8    6e-22   
gb|KJB50542.1|  hypothetical protein B456_008G177000                  99.0    7e-22   
gb|KJB50540.1|  hypothetical protein B456_008G177000                  98.6    8e-22   
gb|KHG20336.1|  Magnesium transporter MRS2-5 -like protein            98.6    8e-22   
gb|KDO57931.1|  hypothetical protein CISIN_1g014053mg                 99.0    1e-21   
gb|KDO57932.1|  hypothetical protein CISIN_1g014053mg                 99.0    1e-21   
ref|XP_004297232.1|  PREDICTED: magnesium transporter MRS2-5          99.0    1e-21   
ref|XP_002512073.1|  RNA splicing protein mrs2, mitochondrial, pu...  99.0    1e-21   
dbj|BAK05306.1|  predicted protein                                    98.6    1e-21   
gb|KDO57933.1|  hypothetical protein CISIN_1g014053mg                 98.2    1e-21   
ref|XP_011011912.1|  PREDICTED: magnesium transporter MRS2-5 isof...  98.6    1e-21   
ref|XP_002315002.1|  magnesium transporter CorA-like family protein   98.6    1e-21   
ref|XP_010320857.1|  PREDICTED: magnesium transporter MRS2-5 isof...  98.2    1e-21   
ref|XP_010491608.1|  PREDICTED: magnesium transporter MRS2-7-like     98.2    1e-21   
ref|XP_010422953.1|  PREDICTED: magnesium transporter MRS2-7          98.2    1e-21   
ref|XP_004239046.1|  PREDICTED: magnesium transporter MRS2-5 isof...  98.2    1e-21   
ref|XP_006348684.1|  PREDICTED: magnesium transporter MRS2-5-like     98.2    2e-21   
ref|XP_010679175.1|  PREDICTED: magnesium transporter MRS2-I-like     97.8    2e-21   
ref|XP_006574946.1|  PREDICTED: magnesium transporter MRS2-5-like...  98.2    2e-21   
dbj|BAJ88295.1|  predicted protein                                    98.2    2e-21   
ref|NP_001149635.1|  MRS2-10                                          98.2    2e-21   
gb|AET04849.2|  magnesium transporter MRS2-like protein               98.2    2e-21   
ref|XP_003630373.1|  Mitochondrial inner membrane magnesium trans...  98.2    2e-21   
ref|XP_004965717.1|  PREDICTED: magnesium transporter MRS2-B-like...  97.8    2e-21   
gb|EYU17897.1|  hypothetical protein MIMGU_mgv1a007590mg              97.8    2e-21   



>ref|XP_006346286.1| PREDICTED: magnesium transporter MRS2-3-like [Solanum tuberosum]
Length=498

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 95/116 (82%), Gaps = 7/116 (6%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGH----NAAVPG---IGSGLRKKASGVRSWLLLDSTGQAQVV  239
            MRG  P +  + P+ DDD      N A+PG   +G+ +RKKA+GVRSWLLLDSTGQ QVV
Sbjct  1    MRGVTPPQKFSVPSPDDDADIHRPNTAIPGGVTVGAAMRKKATGVRSWLLLDSTGQTQVV  60

Query  240  EAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            EAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  61   EAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  116



>ref|XP_004230684.1| PREDICTED: magnesium transporter MRS2-3 [Solanum lycopersicum]
Length=498

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 94/116 (81%), Gaps = 7/116 (6%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGH----NAAVPG---IGSGLRKKASGVRSWLLLDSTGQAQVV  239
            MRG  P +  + P+ DDD      N  +PG   +G+ +RKKA+GVRSWLLLDSTGQ QVV
Sbjct  1    MRGVTPPQKFSVPSPDDDADIIRPNTVIPGGVTVGAAMRKKATGVRSWLLLDSTGQTQVV  60

Query  240  EAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            EAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  61   EAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  116



>ref|XP_009603567.1| PREDICTED: magnesium transporter MRS2-3 isoform X2 [Nicotiana 
tomentosiformis]
Length=407

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 90/117 (77%), Gaps = 8/117 (7%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGH-----NAAVPG---IGSGLRKKASGVRSWLLLDSTGQAQV  236
            MRG  P      P+ +DD       N A+PG   +G GLRKK +G+RSWLLLDSTGQ QV
Sbjct  1    MRGITPPPKFTVPSPEDDAADILRPNTAIPGGINVGPGLRKKGTGIRSWLLLDSTGQTQV  60

Query  237  VEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            VE GKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIIT Q VLL
Sbjct  61   VEVGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITGQEVLL  117



>ref|XP_008344292.1| PREDICTED: magnesium transporter MRS2-3-like [Malus domestica]
Length=416

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 91/118 (77%), Gaps = 9/118 (8%)
 Frame = +3

Query  81   MRGPPPT----KVNAAPAVDD-DGHNAAVPGIG----SGLRKKASGVRSWLLLDSTGQAQ  233
            MR P PT    K   APA DD D      PG+G     GLRKK  GVR WLLLDS+GQAQ
Sbjct  1    MRVPHPTNHPSKSGTAPAEDDPDATRPTXPGLGMSVAGGLRKKGLGVRPWLLLDSSGQAQ  60

Query  234  VVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            VVEAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  61   VVEAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  118



>ref|XP_011077822.1| PREDICTED: magnesium transporter MRS2-3 [Sesamum indicum]
Length=502

 Score =   160 bits (406),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 92/123 (75%), Gaps = 16/123 (13%)
 Frame = +3

Query  81   MRGPPPTKVNAA---PAVDDDGHNAAVP-----------GIGSGLRKKASGVRSWLLLDS  218
            MRG PP     A   P  +DDG   A P            IG GLRKKA+GVR WLLLDS
Sbjct  1    MRGAPPQPPKQAAGPPQAEDDG--TAEPLLRPATAAGGVSIGGGLRKKAAGVRPWLLLDS  58

Query  219  TGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQX  398
            TGQAQVVEAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ 
Sbjct  59   TGQAQVVEAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQE  118

Query  399  VLL  407
            VLL
Sbjct  119  VLL  121



>ref|XP_006486900.1| PREDICTED: magnesium transporter MRS2-3-like [Citrus sinensis]
Length=281

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  162  GSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGR  341
            G GLRKKA+GVR WLLLDSTGQAQVVEAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGR
Sbjct  30   GVGLRKKAAGVRPWLLLDSTGQAQVVEAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGR  89

Query  342  ERAIVINLEHIKAIITAQXVLL  407
            ERAIVINLEHIKAIITAQ VLL
Sbjct  90   ERAIVINLEHIKAIITAQEVLL  111



>ref|XP_009603566.1| PREDICTED: magnesium transporter MRS2-3 isoform X1 [Nicotiana 
tomentosiformis]
Length=499

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 90/117 (77%), Gaps = 8/117 (7%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGH-----NAAVPG---IGSGLRKKASGVRSWLLLDSTGQAQV  236
            MRG  P      P+ +DD       N A+PG   +G GLRKK +G+RSWLLLDSTGQ QV
Sbjct  1    MRGITPPPKFTVPSPEDDAADILRPNTAIPGGINVGPGLRKKGTGIRSWLLLDSTGQTQV  60

Query  237  VEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            VE GKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIIT Q VLL
Sbjct  61   VEVGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITGQEVLL  117



>ref|XP_006422781.1| hypothetical protein CICLE_v10028291mg [Citrus clementina]
 gb|ESR36021.1| hypothetical protein CICLE_v10028291mg [Citrus clementina]
Length=493

 Score =   159 bits (402),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 77/82 (94%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  162  GSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGR  341
            G+GLRKKA+GVR WLLLDSTGQAQVVEAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGR
Sbjct  30   GAGLRKKAAGVRPWLLLDSTGQAQVVEAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGR  89

Query  342  ERAIVINLEHIKAIITAQXVLL  407
            ERAIVINLEHIKAIITAQ VLL
Sbjct  90   ERAIVINLEHIKAIITAQEVLL  111



>gb|EYU38670.1| hypothetical protein MIMGU_mgv1a021974mg, partial [Erythranthe 
guttata]
Length=440

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 95/118 (81%), Gaps = 9/118 (8%)
 Frame = +3

Query  81   MRGPPPT--KVNAAPAV-DDDGHNA----AVPG--IGSGLRKKASGVRSWLLLDSTGQAQ  233
            MRG PP   K  AAP + ++DG       A  G  IG GLRKKA+GVR WLLLDSTGQAQ
Sbjct  13   MRGTPPQPLKQTAAPPLPEEDGSGEPLLRASTGVIIGGGLRKKAAGVRPWLLLDSTGQAQ  72

Query  234  VVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            VVEAGKH+IMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIK+IITAQ VLL
Sbjct  73   VVEAGKHSIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKSIITAQEVLL  130



>ref|XP_009790318.1| PREDICTED: magnesium transporter MRS2-3 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009790319.1| PREDICTED: magnesium transporter MRS2-3 isoform X2 [Nicotiana 
sylvestris]
Length=499

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 90/117 (77%), Gaps = 8/117 (7%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGH-----NAAVPG---IGSGLRKKASGVRSWLLLDSTGQAQV  236
            MRG  P      P+ +DD       N  +PG   +G+GLRKK +G+RSWLLLDSTGQ QV
Sbjct  1    MRGITPPPKFTVPSPEDDAADILRPNTVIPGGINVGAGLRKKGTGIRSWLLLDSTGQTQV  60

Query  237  VEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            VE GKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIIT Q VLL
Sbjct  61   VEVGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITGQEVLL  117



>ref|XP_006486899.1| PREDICTED: magnesium transporter MRS2-3-like [Citrus sinensis]
Length=493

 Score =   159 bits (401),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 77/82 (94%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  162  GSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGR  341
            G GLRKKA+GVR WLLLDSTGQAQVVEAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGR
Sbjct  30   GVGLRKKAAGVRPWLLLDSTGQAQVVEAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGR  89

Query  342  ERAIVINLEHIKAIITAQXVLL  407
            ERAIVINLEHIKAIITAQ VLL
Sbjct  90   ERAIVINLEHIKAIITAQEVLL  111



>ref|XP_008351798.1| PREDICTED: magnesium transporter MRS2-3 isoform X3 [Malus domestica]
Length=400

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 91/118 (77%), Gaps = 9/118 (8%)
 Frame = +3

Query  81   MRGPPPT----KVNAAPAVDD-DGHNAAVPGIG----SGLRKKASGVRSWLLLDSTGQAQ  233
            MR P PT    K   APA DD D     +PG+G     GLRKK  GVR WLLLDS+GQAQ
Sbjct  1    MRIPHPTHHPSKSATAPAEDDSDPTRPTMPGLGISVAGGLRKKGLGVRPWLLLDSSGQAQ  60

Query  234  VVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            VVEAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITA  VLL
Sbjct  61   VVEAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAHEVLL  118



>ref|XP_009343185.1| PREDICTED: magnesium transporter MRS2-3-like [Pyrus x bretschneideri]
Length=490

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 88/109 (81%), Gaps = 5/109 (5%)
 Frame = +3

Query  96   PTKVNAAPAVDD-DGHNAAVPGIG----SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAI  260
            P+K   APA DD D     +PG+G     GLRKK  GVR WLLLDS+GQAQVVE GKHAI
Sbjct  10   PSKSGTAPAEDDPDATRPTMPGLGMSVAGGLRKKGLGVRPWLLLDSSGQAQVVEVGKHAI  69

Query  261  MRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            MRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  70   MRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  118



>ref|XP_008351785.1| PREDICTED: magnesium transporter MRS2-3 isoform X1 [Malus domestica]
Length=492

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 91/118 (77%), Gaps = 9/118 (8%)
 Frame = +3

Query  81   MRGPPPT----KVNAAPAVDD-DGHNAAVPGIG----SGLRKKASGVRSWLLLDSTGQAQ  233
            MR P PT    K   APA DD D     +PG+G     GLRKK  GVR WLLLDS+GQAQ
Sbjct  1    MRIPHPTHHPSKSATAPAEDDSDPTRPTMPGLGISVAGGLRKKGLGVRPWLLLDSSGQAQ  60

Query  234  VVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            VVEAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITA  VLL
Sbjct  61   VVEAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAHEVLL  118



>ref|XP_008351791.1| PREDICTED: magnesium transporter MRS2-3 isoform X2 [Malus domestica]
Length=469

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 91/118 (77%), Gaps = 9/118 (8%)
 Frame = +3

Query  81   MRGPPPT----KVNAAPAVDD-DGHNAAVPGIG----SGLRKKASGVRSWLLLDSTGQAQ  233
            MR P PT    K   APA DD D     +PG+G     GLRKK  GVR WLLLDS+GQAQ
Sbjct  1    MRIPHPTHHPSKSATAPAEDDSDPTRPTMPGLGISVAGGLRKKGLGVRPWLLLDSSGQAQ  60

Query  234  VVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            VVEAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITA  VLL
Sbjct  61   VVEAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAHEVLL  118



>emb|CAN74924.1| hypothetical protein VITISV_038591 [Vitis vinifera]
Length=274

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 92/116 (79%), Gaps = 6/116 (5%)
 Frame = +3

Query  78   MMRGPP--PTKVNAAPAVDDDG----HNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVV  239
            MMR PP  P+K   AP  +D      + +   G  +G+RKK +GVR+WLLLD+TGQAQVV
Sbjct  1    MMRNPPSIPSKSGLAPPEEDPDPARPNGSVGVGGAAGIRKKGTGVRAWLLLDTTGQAQVV  60

Query  240  EAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            EAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIIT Q VLL
Sbjct  61   EAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITCQEVLL  116



>ref|XP_010691547.1| PREDICTED: magnesium transporter MRS2-3 [Beta vulgaris subsp. 
vulgaris]
Length=479

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  129  DDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDP  308
            D G    VPG+  G RKK SGVR+WL++DSTGQAQVVEAGKH+IMRRTGLPGRDLRILDP
Sbjct  8    DMGRPGLVPGLIGGHRKKQSGVRAWLVIDSTGQAQVVEAGKHSIMRRTGLPGRDLRILDP  67

Query  309  LLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            LLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  68   LLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  100



>ref|XP_009343909.1| PREDICTED: magnesium transporter MRS2-3-like isoform X2 [Pyrus 
x bretschneideri]
Length=400

 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 5/109 (5%)
 Frame = +3

Query  96   PTKVNAAPAVDD-DGHNAAVPGIG----SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAI  260
            P+K+   PA DD D     +PG+G     GLRKK  GVR WLLLDS+GQAQVVEAGKHAI
Sbjct  10   PSKLATVPAEDDSDPIRPTMPGLGMSVAGGLRKKGLGVRPWLLLDSSGQAQVVEAGKHAI  69

Query  261  MRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            MRRTGLP RDLRILDPLLSYPST+LGRERAIVINLEHIKAIITA  VLL
Sbjct  70   MRRTGLPARDLRILDPLLSYPSTLLGRERAIVINLEHIKAIITAHEVLL  118



>gb|KDP44523.1| hypothetical protein JCGZ_16356 [Jatropha curcas]
Length=494

 Score =   155 bits (391),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 82/115 (71%), Positives = 87/115 (76%), Gaps = 6/115 (5%)
 Frame = +3

Query  78   MMRGPPPTKVNAAPAVDDDGH-----NAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVE  242
            M   PPP    A P  DDD       N   P + S +RKK +GVR WLLLDSTGQ+QVVE
Sbjct  1    MRSHPPPLSKPAYPQPDDDVDPLIRPNVTQPALPS-VRKKGTGVRPWLLLDSTGQSQVVE  59

Query  243  AGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            AGKHAIMRRTGLP RDLRILDP LSYPST+LGRERAIVINLEHIKAIITAQ VLL
Sbjct  60   AGKHAIMRRTGLPARDLRILDPQLSYPSTILGRERAIVINLEHIKAIITAQEVLL  114



>ref|XP_009343908.1| PREDICTED: magnesium transporter MRS2-3-like isoform X1 [Pyrus 
x bretschneideri]
Length=492

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 5/109 (5%)
 Frame = +3

Query  96   PTKVNAAPAVDD-DGHNAAVPGIG----SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAI  260
            P+K+   PA DD D     +PG+G     GLRKK  GVR WLLLDS+GQAQVVEAGKHAI
Sbjct  10   PSKLATVPAEDDSDPIRPTMPGLGMSVAGGLRKKGLGVRPWLLLDSSGQAQVVEAGKHAI  69

Query  261  MRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            MRRTGLP RDLRILDPLLSYPST+LGRERAIVINLEHIKAIITA  VLL
Sbjct  70   MRRTGLPARDLRILDPLLSYPSTLLGRERAIVINLEHIKAIITAHEVLL  118



>gb|ABR17972.1| unknown [Picea sitchensis]
Length=494

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 84/105 (80%), Gaps = 2/105 (2%)
 Frame = +3

Query  93   PPTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRT  272
            P T    A    DD      P IG+GLRKK  GVR+WLLLD++GQAQVVEAGKHAIMRRT
Sbjct  3    PRTVTKTATNGGDDAEEG--PRIGAGLRKKGMGVRAWLLLDASGQAQVVEAGKHAIMRRT  60

Query  273  GLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            GLP RDLRILDPLLSYP T+LGRERAIVINLEHIKAIITAQ VLL
Sbjct  61   GLPARDLRILDPLLSYPFTILGRERAIVINLEHIKAIITAQEVLL  105



>ref|XP_002300279.2| hypothetical protein POPTR_0001s29920g, partial [Populus trichocarpa]
 gb|EEE85084.2| hypothetical protein POPTR_0001s29920g, partial [Populus trichocarpa]
Length=315

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 79/98 (81%), Gaps = 4/98 (4%)
 Frame = +3

Query  114  APAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDL  293
            APA     HN  +P      RKK +GVR WLLLDSTGQAQVVE GKHAIMR TGLP RDL
Sbjct  24   APASTTTSHNVPLPSS----RKKGTGVRPWLLLDSTGQAQVVEVGKHAIMRPTGLPARDL  79

Query  294  RILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            RILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  80   RILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  117



>ref|XP_002268333.1| PREDICTED: magnesium transporter MRS2-3 [Vitis vinifera]
Length=502

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 92/116 (79%), Gaps = 6/116 (5%)
 Frame = +3

Query  78   MMRGPP--PTKVNAAPAVDDDG----HNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVV  239
            MMR PP  P+K   AP  +D      + +   G  +G+RKK +GVR+WLLLD+TGQAQVV
Sbjct  1    MMRNPPSIPSKSGLAPPEEDPDPARPNGSVGVGGAAGIRKKGTGVRAWLLLDTTGQAQVV  60

Query  240  EAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            EAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIIT Q VLL
Sbjct  61   EAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITCQEVLL  116



>ref|XP_009375650.1| PREDICTED: magnesium transporter MRS2-3-like [Pyrus x bretschneideri]
Length=491

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 87/109 (80%), Gaps = 5/109 (5%)
 Frame = +3

Query  96   PTKVNAAPAVDD-DGHNAAVPGIG----SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAI  260
            P+K+   PA DD D     +PG+G     GLRKK  GVR WLLL S+GQAQVVEAGKHAI
Sbjct  10   PSKLATVPAEDDSDPIRPTMPGLGMSVAGGLRKKGLGVRPWLLLGSSGQAQVVEAGKHAI  69

Query  261  MRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            MRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITA  VLL
Sbjct  70   MRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAHEVLL  118



>ref|XP_010273130.1| PREDICTED: magnesium transporter MRS2-3 [Nelumbo nucifera]
Length=497

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  96   PTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTG  275
            P+K+   P  D+     A  G   GLRKK +GV++WLLLD TGQAQ+VEAGKH IMRRTG
Sbjct  7    PSKLGVTPVEDEADVVRATGGSVGGLRKKGAGVKTWLLLDVTGQAQLVEAGKHTIMRRTG  66

Query  276  LPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            LP RDLRILDPLLSYPSTVLGRE+AIVINLEHIKAIITAQ VLL
Sbjct  67   LPARDLRILDPLLSYPSTVLGREKAIVINLEHIKAIITAQEVLL  110



>ref|XP_007042676.1| Magnesium transporter 4 isoform 2 [Theobroma cacao]
 gb|EOX98507.1| Magnesium transporter 4 isoform 2 [Theobroma cacao]
Length=484

 Score =   150 bits (378),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 71/81 (88%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            +G RKK +GVR+WLLLDSTGQ QVVEAGKHAIM+RTGLP RDLRILDPLLSYPST+LGRE
Sbjct  35   AGHRKKGTGVRAWLLLDSTGQTQVVEAGKHAIMKRTGLPARDLRILDPLLSYPSTILGRE  94

Query  345  RAIVINLEHIKAIITAQXVLL  407
            RAIVINLEHIKAIITAQ VLL
Sbjct  95   RAIVINLEHIKAIITAQEVLL  115



>ref|XP_007200985.1| hypothetical protein PRUPE_ppa004809mg [Prunus persica]
 gb|EMJ02184.1| hypothetical protein PRUPE_ppa004809mg [Prunus persica]
Length=490

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 89/116 (77%), Gaps = 7/116 (6%)
 Frame = +3

Query  81   MRGPPPTK--VNAAPAVDD-DGHNAAVPGIG----SGLRKKASGVRSWLLLDSTGQAQVV  239
            MR P P      +  A DD D     +PG+G    +G+RKK  GVR WL+LD++GQ QVV
Sbjct  1    MRAPNPIHHPSKSGAAEDDPDPTRPTMPGMGMSVAAGMRKKGLGVRPWLVLDASGQTQVV  60

Query  240  EAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            EAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  61   EAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  116



>ref|XP_007042675.1| Magnesium transporter 4 isoform 1 [Theobroma cacao]
 gb|EOX98506.1| Magnesium transporter 4 isoform 1 [Theobroma cacao]
Length=475

 Score =   149 bits (376),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 71/81 (88%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            +G RKK +GVR+WLLLDSTGQ QVVEAGKHAIM+RTGLP RDLRILDPLLSYPST+LGRE
Sbjct  35   AGHRKKGTGVRAWLLLDSTGQTQVVEAGKHAIMKRTGLPARDLRILDPLLSYPSTILGRE  94

Query  345  RAIVINLEHIKAIITAQXVLL  407
            RAIVINLEHIKAIITAQ VLL
Sbjct  95   RAIVINLEHIKAIITAQEVLL  115



>ref|XP_008236295.1| PREDICTED: magnesium transporter MRS2-3-like [Prunus mume]
Length=490

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 89/116 (77%), Gaps = 7/116 (6%)
 Frame = +3

Query  81   MRGPPPTK--VNAAPAVDD-DGHNAAVPGIG----SGLRKKASGVRSWLLLDSTGQAQVV  239
            MR P P      +  A DD D     +PG+G    +G+RKK  GVR WL+LD++GQ QVV
Sbjct  1    MRAPNPIHHPSKSGAAEDDPDPTRPTMPGMGMSVAAGMRKKGLGVRPWLVLDASGQTQVV  60

Query  240  EAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            EAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  61   EAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  116



>ref|XP_006422784.1| hypothetical protein CICLE_v10028752mg [Citrus clementina]
 gb|ESR36024.1| hypothetical protein CICLE_v10028752mg [Citrus clementina]
Length=257

 Score =   144 bits (362),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = +3

Query  141  NAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSY  320
            N AV  +G G+RKK +GVR WL+LDSTGQ QVVEAGKHAIMRRTGLP RDLRILDP+LSY
Sbjct  25   NLAVTSVG-GVRKKVAGVRPWLVLDSTGQTQVVEAGKHAIMRRTGLPARDLRILDPMLSY  83

Query  321  PSTVLGRERAIVINLEHIKAIITAQXVLL  407
            PST+LGRE AIVINLE IKAIITAQ VLL
Sbjct  84   PSTILGRESAIVINLEQIKAIITAQEVLL  112



>ref|XP_008455051.1| PREDICTED: magnesium transporter MRS2-3 isoform X2 [Cucumis melo]
Length=494

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 89/117 (76%), Gaps = 9/117 (8%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGHN--------AAVPGIGSGLRKKASGVRSWLLLDSTGQAQV  236
            MRG     + + PA  DD +           +P +G+G+RKK +GVR WLLLDSTG AQV
Sbjct  1    MRGQHSHPLKSGPAGPDDENEPVRSYLAGTNIP-LGTGIRKKGTGVRPWLLLDSTGGAQV  59

Query  237  VEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            VEAGKHAIMRRTGLP RDLRILDPLLSYPST+LGRE+AIVINLEHIKAIITAQ V +
Sbjct  60   VEAGKHAIMRRTGLPARDLRILDPLLSYPSTILGREKAIVINLEHIKAIITAQDVFV  116



>ref|XP_008455050.1| PREDICTED: magnesium transporter MRS2-3 isoform X1 [Cucumis melo]
Length=495

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 89/117 (76%), Gaps = 9/117 (8%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGHN--------AAVPGIGSGLRKKASGVRSWLLLDSTGQAQV  236
            MRG     + + PA  DD +           +P +G+G+RKK +GVR WLLLDSTG AQV
Sbjct  1    MRGQHSHPLKSGPAGPDDENEPVRSYLAGTNIP-LGTGIRKKGTGVRPWLLLDSTGGAQV  59

Query  237  VEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            VEAGKHAIMRRTGLP RDLRILDPLLSYPST+LGRE+AIVINLEHIKAIITAQ V +
Sbjct  60   VEAGKHAIMRRTGLPARDLRILDPLLSYPSTILGREKAIVINLEHIKAIITAQDVFV  116



>gb|KJB12309.1| hypothetical protein B456_002G010900 [Gossypium raimondii]
 gb|KJB12312.1| hypothetical protein B456_002G010900 [Gossypium raimondii]
Length=314

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            G RKK +GVR+WL+LDST Q Q+VEAGKHAIMRRTGLP RDLRILDPLLSYPST+LGRER
Sbjct  40   GHRKKGTGVRAWLILDSTCQTQMVEAGKHAIMRRTGLPARDLRILDPLLSYPSTILGRER  99

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIVINLEHIKAIITAQ VLL
Sbjct  100  AIVINLEHIKAIITAQEVLL  119



>ref|XP_006422782.1| hypothetical protein CICLE_v10028752mg [Citrus clementina]
 gb|ESR36022.1| hypothetical protein CICLE_v10028752mg [Citrus clementina]
Length=227

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = +3

Query  141  NAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSY  320
            N AV  +G G+RKK +GVR WL+LDSTGQ QVVEAGKHAIMRRTGLP RDLRILDP+LSY
Sbjct  25   NLAVTSVG-GVRKKVAGVRPWLVLDSTGQTQVVEAGKHAIMRRTGLPARDLRILDPMLSY  83

Query  321  PSTVLGRERAIVINLEHIKAIITAQXVLL  407
            PST+LGRE AIVINLE IKAIITAQ VLL
Sbjct  84   PSTILGRESAIVINLEQIKAIITAQEVLL  112



>ref|XP_010028349.1| PREDICTED: LOW QUALITY PROTEIN: magnesium transporter MRS2-3-like 
[Eucalyptus grandis]
Length=513

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
             LRKK + VR+WLLLDSTGQAQVVEAGKHAIMRRTGLP RDLRILDPLLSYPST+LGRER
Sbjct  63   ALRKKGTSVRAWLLLDSTGQAQVVEAGKHAIMRRTGLPARDLRILDPLLSYPSTILGRER  122

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIVINLEHIKAIITAQ VLL
Sbjct  123  AIVINLEHIKAIITAQEVLL  142



>ref|XP_004136933.1| PREDICTED: magnesium transporter MRS2-3-like [Cucumis sativus]
 ref|XP_004159919.1| PREDICTED: magnesium transporter MRS2-3-like [Cucumis sativus]
 gb|KGN43840.1| hypothetical protein Csa_7G070800 [Cucumis sativus]
Length=494

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 89/116 (77%), Gaps = 7/116 (6%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGHN---AAVPG----IGSGLRKKASGVRSWLLLDSTGQAQVV  239
            MRG     + + PA  DD +    + + G    +G G+RKK +GVR WLLLDSTG AQVV
Sbjct  1    MRGQHSHPLKSGPAGPDDENEPVRSYIAGMNIPLGPGIRKKGTGVRPWLLLDSTGGAQVV  60

Query  240  EAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            EAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGRE+AIVINLEHIKAIITAQ V +
Sbjct  61   EAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGREKAIVINLEHIKAIITAQDVFV  116



>ref|XP_006422786.1| hypothetical protein CICLE_v10028752mg [Citrus clementina]
 gb|ESR36026.1| hypothetical protein CICLE_v10028752mg [Citrus clementina]
Length=276

 Score =   143 bits (361),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = +3

Query  141  NAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSY  320
            N AV  +G G+RKK +GVR WL+LDSTGQ QVVEAGKHAIMRRTGLP RDLRILDP+LSY
Sbjct  25   NLAVTSVG-GVRKKVAGVRPWLVLDSTGQTQVVEAGKHAIMRRTGLPARDLRILDPMLSY  83

Query  321  PSTVLGRERAIVINLEHIKAIITAQXVLL  407
            PST+LGRE AIVINLE IKAIITAQ VLL
Sbjct  84   PSTILGRESAIVINLEQIKAIITAQEVLL  112



>ref|XP_006422787.1| hypothetical protein CICLE_v10028752mg [Citrus clementina]
 gb|ESR36027.1| hypothetical protein CICLE_v10028752mg [Citrus clementina]
Length=345

 Score =   145 bits (365),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = +3

Query  141  NAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSY  320
            N AV  +G G+RKK +GVR WL+LDSTGQ QVVEAGKHAIMRRTGLP RDLRILDP+LSY
Sbjct  25   NLAVTSVG-GVRKKVAGVRPWLVLDSTGQTQVVEAGKHAIMRRTGLPARDLRILDPMLSY  83

Query  321  PSTVLGRERAIVINLEHIKAIITAQXVLL  407
            PST+LGRE AIVINLE IKAIITAQ VLL
Sbjct  84   PSTILGRESAIVINLEQIKAIITAQEVLL  112



>ref|XP_004292113.1| PREDICTED: magnesium transporter MRS2-3 [Fragaria vesca subsp. 
vesca]
Length=483

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 77/87 (89%), Gaps = 2/87 (2%)
 Frame = +3

Query  153  PGIGSG--LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPS  326
            PG+  G  LRKK +GV+ WLLLDS GQAQVVE GKHAIMRRTGLP RDLRILDPLLSYPS
Sbjct  31   PGMSVGGPLRKKGTGVKPWLLLDSNGQAQVVEVGKHAIMRRTGLPARDLRILDPLLSYPS  90

Query  327  TVLGRERAIVINLEHIKAIITAQXVLL  407
            TVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  91   TVLGRERAIVINLEHIKAIITAQEVLL  117



>ref|XP_010088315.1| Magnesium transporter MRS2-3 [Morus notabilis]
 gb|EXB33540.1| Magnesium transporter MRS2-3 [Morus notabilis]
Length=495

 Score =   147 bits (370),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/78 (92%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            RKK +GVR WLL+DSTGQAQVVEAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAI
Sbjct  40   RKKGTGVRPWLLVDSTGQAQVVEAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAI  99

Query  354  VINLEHIKAIITAQXVLL  407
            VINLEHIKAIITAQ VLL
Sbjct  100  VINLEHIKAIITAQEVLL  117



>ref|XP_002313918.2| magnesium transporter CorA-like family protein [Populus trichocarpa]
 gb|EEE87873.2| magnesium transporter CorA-like family protein [Populus trichocarpa]
Length=493

 Score =   147 bits (370),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 78/106 (74%), Positives = 80/106 (75%), Gaps = 4/106 (4%)
 Frame = +3

Query  90   PPPTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRR  269
            PP     A PA         +P      RKK +GVR WLLLDSTGQAQVVE GKHAIMRR
Sbjct  8    PPHQDPMARPAPTTTSLTVPLPSS----RKKGTGVRPWLLLDSTGQAQVVEVGKHAIMRR  63

Query  270  TGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            TGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  64   TGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  109



>gb|KJB12311.1| hypothetical protein B456_002G010900 [Gossypium raimondii]
Length=388

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            G RKK +GVR+WL+LDST Q Q+VEAGKHAIMRRTGLP RDLRILDPLLSYPST+LGRER
Sbjct  40   GHRKKGTGVRAWLILDSTCQTQMVEAGKHAIMRRTGLPARDLRILDPLLSYPSTILGRER  99

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIVINLEHIKAIITAQ VLL
Sbjct  100  AIVINLEHIKAIITAQEVLL  119



>ref|XP_006422785.1| hypothetical protein CICLE_v10028752mg [Citrus clementina]
 gb|ESR36025.1| hypothetical protein CICLE_v10028752mg [Citrus clementina]
Length=313

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = +3

Query  141  NAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSY  320
            N AV  +G G+RKK +GVR WL+LDSTGQ QVVEAGKHAIMRRTGLP RDLRILDP+LSY
Sbjct  25   NLAVTSVG-GVRKKVAGVRPWLVLDSTGQTQVVEAGKHAIMRRTGLPARDLRILDPMLSY  83

Query  321  PSTVLGRERAIVINLEHIKAIITAQXVLL  407
            PST+LGRE AIVINLE IKAIITAQ VLL
Sbjct  84   PSTILGRESAIVINLEQIKAIITAQEVLL  112



>ref|XP_006422783.1| hypothetical protein CICLE_v10028752mg [Citrus clementina]
 gb|ESR36023.1| hypothetical protein CICLE_v10028752mg [Citrus clementina]
Length=343

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = +3

Query  141  NAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSY  320
            N AV  +G G+RKK +GVR WL+LDSTGQ QVVEAGKHAIMRRTGLP RDLRILDP+LSY
Sbjct  25   NLAVTSVG-GVRKKVAGVRPWLVLDSTGQTQVVEAGKHAIMRRTGLPARDLRILDPMLSY  83

Query  321  PSTVLGRERAIVINLEHIKAIITAQXVLL  407
            PST+LGRE AIVINLE IKAIITAQ VLL
Sbjct  84   PSTILGRESAIVINLEQIKAIITAQEVLL  112



>ref|XP_011094263.1| PREDICTED: magnesium transporter MRS2-3-like [Sesamum indicum]
Length=489

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 89/122 (73%), Gaps = 12/122 (10%)
 Frame = +3

Query  78   MMRG--PPPTKVNAAP--AVDDDGHNAAVP--------GIGSGLRKKASGVRSWLLLDST  221
            M RG  P P+K  A P  A D+   +A V          I  G RKK +G++SWL+LDST
Sbjct  1    MARGISPQPSKQAATPPHAEDETVGDANVRYAASSGGVNISGGHRKKTAGLKSWLVLDST  60

Query  222  GQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXV  401
            GQAQVVEA KHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIV NLEHIKAIITAQ V
Sbjct  61   GQAQVVEAEKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVTNLEHIKAIITAQEV  120

Query  402  LL  407
             L
Sbjct  121  FL  122



>ref|XP_006433222.1| hypothetical protein CICLE_v10003981mg [Citrus clementina]
 gb|ESR46462.1| hypothetical protein CICLE_v10003981mg [Citrus clementina]
Length=257

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query  141  NAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSY  320
            N AV  +G G+RKK +GVR WL+LDSTGQ QVVEAGKHAIMRRTGLP RDLRILDP+LSY
Sbjct  6    NLAVTSVG-GVRKKVAGVRPWLVLDSTGQTQVVEAGKHAIMRRTGLPARDLRILDPMLSY  64

Query  321  PSTVLGRERAIVINLEHIKAIITAQXVLL  407
            PST+LGRE AIVINLE IK IITAQ VLL
Sbjct  65   PSTILGRESAIVINLEQIKDIITAQEVLL  93



>ref|XP_004511321.1| PREDICTED: magnesium transporter MRS2-3-like [Cicer arietinum]
Length=454

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  162  GSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGR  341
            G+ +RKK +GVR+WL++D TG+AQVVEAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGR
Sbjct  21   GTAIRKKGTGVRAWLVVDGTGEAQVVEAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGR  80

Query  342  ERAIVINLEHIKAIITAQXVLL  407
            ERAIVINLEHIKAIITA  VLL
Sbjct  81   ERAIVINLEHIKAIITANEVLL  102



>ref|XP_011002248.1| PREDICTED: magnesium transporter MRS2-3-like [Populus euphratica]
Length=490

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            RKK +GVR WLLLDSTGQAQVVE GKH +MRRTGLP RDLRILDPLLSYPSTVLGRERAI
Sbjct  32   RKKGTGVRPWLLLDSTGQAQVVEVGKHTVMRRTGLPARDLRILDPLLSYPSTVLGRERAI  91

Query  354  VINLEHIKAIITAQXVLL  407
            VINLEHIKAIITAQ VLL
Sbjct  92   VINLEHIKAIITAQEVLL  109



>ref|XP_011030313.1| PREDICTED: magnesium transporter MRS2-3-like isoform X2 [Populus 
euphratica]
Length=412

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 82/117 (70%), Gaps = 8/117 (7%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGHNAAVPGIGS--------GLRKKASGVRSWLLLDSTGQAQV  236
            MR  P T   + P  D D      P   +          RKK +GVR WLLLDSTGQAQV
Sbjct  1    MRSRPQTPQLSKPEDDTDPMTRPAPASTTTSLNVPFPSSRKKGTGVRPWLLLDSTGQAQV  60

Query  237  VEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            VE GKHAIMRRTGL  RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  61   VEVGKHAIMRRTGLHARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  117



>ref|XP_011030312.1| PREDICTED: magnesium transporter MRS2-3-like isoform X1 [Populus 
euphratica]
Length=497

 Score =   144 bits (364),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 79/117 (68%), Positives = 82/117 (70%), Gaps = 8/117 (7%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGHNAAVPGIGS--------GLRKKASGVRSWLLLDSTGQAQV  236
            MR  P T   + P  D D      P   +          RKK +GVR WLLLDSTGQAQV
Sbjct  1    MRSRPQTPQLSKPEDDTDPMTRPAPASTTTSLNVPFPSSRKKGTGVRPWLLLDSTGQAQV  60

Query  237  VEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            VE GKHAIMRRTGL  RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  61   VEVGKHAIMRRTGLHARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  117



>ref|XP_011071765.1| PREDICTED: magnesium transporter MRS2-3-like [Sesamum indicum]
Length=490

 Score =   144 bits (363),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 85/105 (81%), Gaps = 2/105 (2%)
 Frame = +3

Query  93   PPTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRT  272
            PP+K +A P     G    +P I  G RKK + VR+WL +DSTG+AQVVEAGKHAIMRRT
Sbjct  8    PPSK-HAEPRPGGSGEPLLLP-IPGGHRKKVASVRAWLTVDSTGEAQVVEAGKHAIMRRT  65

Query  273  GLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            GLPGRDLRILDP+LSYPSTVLGRERAIV+NLEHIKAIITAQ VL 
Sbjct  66   GLPGRDLRILDPVLSYPSTVLGRERAIVVNLEHIKAIITAQEVLF  110



>ref|XP_007157203.1| hypothetical protein PHAVU_002G051200g [Phaseolus vulgaris]
 gb|ESW29197.1| hypothetical protein PHAVU_002G051200g [Phaseolus vulgaris]
Length=415

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  162  GSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGR  341
             +G+RKK +GVR WLLLD  G+ +VVEAGKHAIMRRTGLP RDLRILDPLLSYPST+LGR
Sbjct  10   ATGIRKKGTGVRQWLLLDMKGETEVVEAGKHAIMRRTGLPARDLRILDPLLSYPSTLLGR  69

Query  342  ERAIVINLEHIKAIITAQXVLL  407
            ERAIVINLEHIKAIITAQ VLL
Sbjct  70   ERAIVINLEHIKAIITAQQVLL  91



>gb|KJB12308.1| hypothetical protein B456_002G010900 [Gossypium raimondii]
Length=485

 Score =   143 bits (361),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            G RKK +GVR+WL+LDST Q Q+VEAGKHAIMRRTGLP RDLRILDPLLSYPST+LGRER
Sbjct  40   GHRKKGTGVRAWLILDSTCQTQMVEAGKHAIMRRTGLPARDLRILDPLLSYPSTILGRER  99

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIVINLEHIKAIITAQ VLL
Sbjct  100  AIVINLEHIKAIITAQEVLL  119



>gb|KJB12310.1| hypothetical protein B456_002G010900 [Gossypium raimondii]
Length=486

 Score =   143 bits (361),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            G RKK +GVR+WL+LDST Q Q+VEAGKHAIMRRTGLP RDLRILDPLLSYPST+LGRER
Sbjct  40   GHRKKGTGVRAWLILDSTCQTQMVEAGKHAIMRRTGLPARDLRILDPLLSYPSTILGRER  99

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIVINLEHIKAIITAQ VLL
Sbjct  100  AIVINLEHIKAIITAQEVLL  119



>gb|KHG12836.1| Magnesium transporter MRS2-3 -like protein [Gossypium arboreum]
Length=485

 Score =   143 bits (361),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            G RKK +GVR+WL+LDST Q Q+VEAGKHAIMRRTGLP RDLRILDPLLSYPST+LGRER
Sbjct  40   GHRKKGTGVRAWLILDSTCQTQMVEAGKHAIMRRTGLPARDLRILDPLLSYPSTILGRER  99

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIVINLEHIKAIITAQ VLL
Sbjct  100  AIVINLEHIKAIITAQEVLL  119



>ref|XP_002522142.1| RNA splicing protein mrs2, mitochondrial, putative [Ricinus communis]
 gb|EEF40342.1| RNA splicing protein mrs2, mitochondrial, putative [Ricinus communis]
Length=456

 Score =   143 bits (360),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 69/78 (88%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            RKK  GVR+WLLLDSTGQ Q+VEAGKHAIMRRTGLP RDLRILDP LSYPSTVLGRERAI
Sbjct  35   RKKGIGVRAWLLLDSTGQTQIVEAGKHAIMRRTGLPARDLRILDPQLSYPSTVLGRERAI  94

Query  354  VINLEHIKAIITAQXVLL  407
            VINLEHIKAIIT+Q VLL
Sbjct  95   VINLEHIKAIITSQEVLL  112



>gb|KHN35209.1| Magnesium transporter MRS2-3 [Glycine soja]
Length=375

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            +G+RKK SGVR WL+LD  G+ +VVEAGKHAIMRRTGLP RDLRILDPLLSYPST+LGRE
Sbjct  10   TGIRKKGSGVRQWLVLDGKGETEVVEAGKHAIMRRTGLPARDLRILDPLLSYPSTLLGRE  69

Query  345  RAIVINLEHIKAIITAQXVLL  407
            RAIVINLEHIKAIITAQ +LL
Sbjct  70   RAIVINLEHIKAIITAQELLL  90



>ref|XP_006857124.1| hypothetical protein AMTR_s00065p00139210 [Amborella trichopoda]
 gb|ERN18591.1| hypothetical protein AMTR_s00065p00139210 [Amborella trichopoda]
Length=494

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 82/108 (76%), Gaps = 7/108 (6%)
 Frame = +3

Query  93   PPTKVNAAPAVDDDGHNAAVPGIGS---GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIM  263
            PP K       DDD    A  G GS   G RKK  GVR WLL+D++GQ QVVEAGKHAIM
Sbjct  6    PPLKPYPLSPFDDD----AAEGGGSARPGARKKGVGVRPWLLVDASGQTQVVEAGKHAIM  61

Query  264  RRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            +RTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITA  VLL
Sbjct  62   KRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAHEVLL  109



>ref|XP_006486898.1| PREDICTED: magnesium transporter MRS2-3-like [Citrus sinensis]
Length=490

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query  141  NAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSY  320
            N AV  +G G+RKK +GVR WL+LDSTGQ QVVEAGKHAIMRRTGLP RDLRILDP+LSY
Sbjct  25   NLAVTSVG-GIRKKVAGVRPWLVLDSTGQTQVVEAGKHAIMRRTGLPARDLRILDPMLSY  83

Query  321  PSTVLGRERAIVINLEHIKAIITAQXVLL  407
            PST+LGRE AIVINLE IK IITAQ VLL
Sbjct  84   PSTILGRESAIVINLEQIKDIITAQEVLL  112



>emb|CDY58861.1| BnaCnng33870D [Brassica napus]
Length=730

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 80/109 (73%), Gaps = 2/109 (2%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAI  260
            MRGP P      P+    G     P   +G RKK  GVR+WL+L + GQAQ  E GKHAI
Sbjct  1    MRGPRPEDFETNPSTPITGQ--PTPTYPAGARKKGVGVRTWLVLCARGQAQTTEVGKHAI  58

Query  261  MRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            MRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  59   MRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  107



>ref|XP_003610633.1| Magnesium transporter [Medicago truncatula]
 gb|AES93591.1| magnesium transporter 2 [Medicago truncatula]
Length=444

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 76/88 (86%), Gaps = 4/88 (5%)
 Frame = +3

Query  144  AAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYP  323
            AAVP I    RKK + VR WL++D TG+AQV+EAGKHAIMRRTGLP RDLRILDPLLSYP
Sbjct  21   AAVPAI----RKKGTSVRQWLVVDGTGEAQVIEAGKHAIMRRTGLPARDLRILDPLLSYP  76

Query  324  STVLGRERAIVINLEHIKAIITAQXVLL  407
            STVLGRERAIVINLEHIKAIITA  VLL
Sbjct  77   STVLGRERAIVINLEHIKAIITANEVLL  104



>emb|CDY66275.1| BnaAnng21960D [Brassica napus]
Length=441

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 79/110 (72%), Gaps = 2/110 (2%)
 Frame = +3

Query  78   MMRGPPPTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHA  257
            M  GP P      P+    G     P   +G RKK  GVR+WL+L S GQAQ  E GKHA
Sbjct  1    MRGGPRPEDFETNPSTPITGQ--PTPTYPAGARKKGVGVRTWLVLCSRGQAQTTEVGKHA  58

Query  258  IMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            IMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  59   IMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  108



>ref|XP_006590388.1| PREDICTED: magnesium transporter MRS2-3-like [Glycine max]
Length=399

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            +G+RKK SGVR WL+LD  G+ +VVEAGKHAIMRRTGLP RDLRILDPLLSYPST+LGRE
Sbjct  10   TGIRKKGSGVRQWLVLDGKGETEVVEAGKHAIMRRTGLPARDLRILDPLLSYPSTLLGRE  69

Query  345  RAIVINLEHIKAIITAQXVLL  407
            RAIVINLEHIKAIITAQ +LL
Sbjct  70   RAIVINLEHIKAIITAQELLL  90



>ref|XP_002522143.1| RNA splicing protein mrs2, mitochondrial, putative [Ricinus communis]
 gb|EEF40343.1| RNA splicing protein mrs2, mitochondrial, putative [Ricinus communis]
Length=451

 Score =   142 bits (358),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 75/115 (65%), Positives = 83/115 (72%), Gaps = 9/115 (8%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGHNAAVP------GIGSGLRKKASGVRSWLLLDSTGQAQVVE  242
            MR  PP  +   P  D+D      P       +    RKK +GVR+WLLLDS GQ Q++E
Sbjct  1    MRSYPPPLI---PRPDEDSDPLIRPTQTTTTAVLPITRKKGTGVRAWLLLDSRGQTQIIE  57

Query  243  AGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            AGKHAIMRRTGLP RDLRILDP LSYPSTVLGRERAIVINLEHIKAIIT+Q VLL
Sbjct  58   AGKHAIMRRTGLPARDLRILDPQLSYPSTVLGRERAIVINLEHIKAIITSQEVLL  112



>ref|XP_009145765.1| PREDICTED: magnesium transporter MRS2-3-like [Brassica rapa]
Length=472

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 79/110 (72%), Gaps = 2/110 (2%)
 Frame = +3

Query  78   MMRGPPPTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHA  257
            M  GP P      P+    G     P   +G RKK  GVR+WL+L S GQAQ  E GKHA
Sbjct  1    MRGGPRPEDFETNPSTPITGQ--PTPTYPAGARKKGVGVRTWLVLCSRGQAQTTEVGKHA  58

Query  258  IMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            IMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  59   IMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  108



>ref|XP_003516767.1| PREDICTED: magnesium transporter MRS2-3-like [Glycine max]
Length=393

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  162  GSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGR  341
             +G+RKK SGVR WL+LD  G+ +VVEAGKHAIMRRTGLP RDLRILDPLLSYPST+LGR
Sbjct  8    STGIRKKGSGVRQWLVLDGRGETEVVEAGKHAIMRRTGLPARDLRILDPLLSYPSTLLGR  67

Query  342  ERAIVINLEHIKAIITAQXVLL  407
            ERAIVINLEHIKAIITA  VLL
Sbjct  68   ERAIVINLEHIKAIITAHEVLL  89



>gb|EPS69517.1| hypothetical protein M569_05248, partial [Genlisea aurea]
Length=400

 Score =   140 bits (353),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERA  350
            LRKKA+GVR WL+LDS G A+VVEAGKHAIMRRTGLP RDLRILDPLLSYPSTVLGR+ A
Sbjct  12   LRKKATGVRQWLVLDSEGNAEVVEAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRDHA  71

Query  351  IVINLEHIKAIITAQXVLL  407
            IVIN+EHIKAIITA+ VLL
Sbjct  72   IVINMEHIKAIITAEEVLL  90



>gb|KFK39291.1| hypothetical protein AALP_AA3G225600 [Arabis alpina]
Length=475

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 81/109 (74%), Gaps = 3/109 (3%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAI  260
            MRG         PA  + GH    P   +G RKK  GVR WL+L S+GQAQ+ EAGKH I
Sbjct  1    MRGARFDDFETNPATPNTGH--PTPMYPAG-RKKGVGVRPWLVLCSSGQAQMTEAGKHTI  57

Query  261  MRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            MRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  58   MRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  106



>gb|KFK39290.1| hypothetical protein AALP_AA3G225600 [Arabis alpina]
Length=474

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 81/109 (74%), Gaps = 3/109 (3%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAI  260
            MRG         PA  + GH    P   +G RKK  GVR WL+L S+GQAQ+ EAGKH I
Sbjct  1    MRGARFDDFETNPATPNTGH--PTPMYPAG-RKKGVGVRPWLVLCSSGQAQMTEAGKHTI  57

Query  261  MRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            MRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  58   MRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  106



>gb|KJB79462.1| hypothetical protein B456_013G051100 [Gossypium raimondii]
Length=470

 Score =   137 bits (346),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 67/78 (86%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            RKK S +RSWLLLDST     +EAGKH+IMRRTGLPGRDLRILDPLLSYPSTVLGRERAI
Sbjct  39   RKKGSSIRSWLLLDSTAHTFRLEAGKHSIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  98

Query  354  VINLEHIKAIITAQXVLL  407
            VINLEHIKAIITAQ VLL
Sbjct  99   VINLEHIKAIITAQEVLL  116



>emb|CDY42196.1| BnaA01g25990D [Brassica napus]
Length=456

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 81/110 (74%), Gaps = 8/110 (7%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGH-NAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHA  257
            MRGP P   ++     + GH     P  GS  RKK  GVR+WL+L S+G+ Q  EAGKH 
Sbjct  1    MRGPRPEDFDS-----NAGHPTPTFPAGGS--RKKGMGVRTWLVLCSSGKEQATEAGKHT  53

Query  258  IMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            IMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIIT Q VL+
Sbjct  54   IMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITGQEVLI  103



>ref|XP_009111645.1| PREDICTED: magnesium transporter MRS2-3-like isoform X2 [Brassica 
rapa]
Length=453

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 80/110 (73%), Gaps = 8/110 (7%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGH-NAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHA  257
            MRGP P   +      + GH     P  GS  RKK  GVR+WL+L S+G+ Q  EAGKH 
Sbjct  1    MRGPRPEDFDT-----NAGHPTPTFPAGGS--RKKGMGVRTWLVLCSSGKEQATEAGKHT  53

Query  258  IMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            IMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIIT Q VL+
Sbjct  54   IMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITGQEVLI  103



>ref|XP_009111637.1| PREDICTED: magnesium transporter MRS2-3-like isoform X1 [Brassica 
rapa]
Length=454

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 80/110 (73%), Gaps = 8/110 (7%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGH-NAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHA  257
            MRGP P   +      + GH     P  GS  RKK  GVR+WL+L S+G+ Q  EAGKH 
Sbjct  1    MRGPRPEDFDT-----NAGHPTPTFPAGGS--RKKGMGVRTWLVLCSSGKEQATEAGKHT  53

Query  258  IMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            IMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIIT Q VL+
Sbjct  54   IMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITGQEVLI  103



>gb|AFK48474.1| unknown [Lotus japonicus]
Length=422

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERA  350
            +RKKA+GVR+WLLL + G  +VVEAGKH IMRRTGLP RDLRILDPLLSYPSTVLGRERA
Sbjct  14   VRKKATGVRAWLLLQANGDTEVVEAGKHTIMRRTGLPARDLRILDPLLSYPSTVLGRERA  73

Query  351  IVINLEHIKAIITAQXVLL  407
            IVINLEHIKAII A  VLL
Sbjct  74   IVINLEHIKAIIIAHEVLL  92



>gb|EPS72108.1| hypothetical protein M569_02647 [Genlisea aurea]
Length=893

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERA  350
            +RKKA+G+R+WL+LD +G +Q+VEAGKHAIMRRTGL GRDLRILDP+ SYPSTVLGRERA
Sbjct  44   IRKKAAGLRTWLVLDPSGHSQLVEAGKHAIMRRTGLHGRDLRILDPVFSYPSTVLGRERA  103

Query  351  IVINLEHIKAIITAQXVLL  407
            IVINLEHIKAIITAQ VLL
Sbjct  104  IVINLEHIKAIITAQEVLL  122



>emb|CDP20393.1| unnamed protein product [Coffea canephora]
Length=456

 Score =   134 bits (336),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 61/88 (69%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +3

Query  144  AAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYP  323
            A + G G  LRKKA+GVR+WL LDSTG++ +VEAGKH +MRRTGL G DLRILDP LSYP
Sbjct  2    AGISGGGDHLRKKATGVRTWLQLDSTGESNIVEAGKHGVMRRTGLSGLDLRILDPFLSYP  61

Query  324  STVLGRERAIVINLEHIKAIITAQXVLL  407
            +T++GRERAI+++LEHIKAI+TA  VLL
Sbjct  62   ATLIGRERAIIVHLEHIKAIVTAHEVLL  89



>gb|KFK31826.1| hypothetical protein AALP_AA6G163500 [Arabis alpina]
Length=446

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = +3

Query  144  AAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYP  323
            A V G G+G RKK  GVR WL+L S+GQAQ+ E GKH IMR+TGLP RDLRILDPLLSYP
Sbjct  14   AGVIGGGNG-RKKGVGVRQWLVLSSSGQAQLTEVGKHKIMRQTGLPARDLRILDPLLSYP  72

Query  324  STVLGRERAIVINLEHIKAIITAQXVLL  407
            S VLGRE+AIVINLEHIKAIITAQ VLL
Sbjct  73   SAVLGREKAIVINLEHIKAIITAQEVLL  100



>ref|XP_008236348.1| PREDICTED: magnesium transporter MRS2-3-like [Prunus mume]
Length=604

 Score =   134 bits (337),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 74/113 (65%), Positives = 80/113 (71%), Gaps = 5/113 (4%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGHNAAVPGIGSGLRKKAS----GVRSWLLLDSTGQAQVVEAG  248
            MR P P      P   +     A    G G RKK+S    GVRSWLL+DS G+ QVVEAG
Sbjct  1    MRPPSPHHPRQLPHPSNSAPLMASLPTG-GQRKKSSKGTTGVRSWLLMDSGGKTQVVEAG  59

Query  249  KHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            KH IMRRTGLP RDLRILDP+L YPSTVLGRERAIVINLEHIKAI+TA  VLL
Sbjct  60   KHVIMRRTGLPARDLRILDPVLMYPSTVLGRERAIVINLEHIKAIVTAHEVLL  112



>emb|CDX95430.1| BnaC01g33220D [Brassica napus]
Length=455

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 79/112 (71%), Gaps = 12/112 (11%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGHNAAVP---GIGSGLRKKASGVRSWLLLDSTGQAQVVEAGK  251
            MRGP P   ++         NA  P       G RKK  GVR+WL+L S+G+ Q  EAGK
Sbjct  1    MRGPRPEGFDS---------NAGQPRPTFPAGGSRKKGMGVRTWLVLWSSGKEQATEAGK  51

Query  252  HAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            H IMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIIT Q VL+
Sbjct  52   HTIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITGQEVLI  103



>ref|XP_006406476.1| hypothetical protein EUTSA_v10020646mg [Eutrema salsugineum]
 gb|ESQ47929.1| hypothetical protein EUTSA_v10020646mg [Eutrema salsugineum]
Length=475

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 78/109 (72%), Gaps = 2/109 (2%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAI  260
            MRGP     +  P   + G     P    G RKK  GVR WL L STG+A++ E GKH I
Sbjct  1    MRGPRREDFSTNPETPNVG--LPTPTYPVGGRKKGVGVRPWLELLSTGEAEMKEDGKHTI  58

Query  261  MRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            MR+TGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  59   MRKTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLL  107



>ref|XP_009399090.1| PREDICTED: magnesium transporter MRS2-3 [Musa acuminata subsp. 
malaccensis]
Length=493

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 79/103 (77%), Gaps = 4/103 (4%)
 Frame = +3

Query  111  AAPAVDDDGHNAAVPG----IGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGL  278
            A PA DD+   A   G     G+G RKK +G R+WL +D+ G A+VVEAGKH IMRRTGL
Sbjct  15   AVPATDDEPEAAVAAGGFRGSGAGARKKWAGPRAWLAVDAAGVARVVEAGKHDIMRRTGL  74

Query  279  PGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            PGRDLRILDP LS PSTVLGRERAIV+NLEHIKAIITA  VLL
Sbjct  75   PGRDLRILDPQLSCPSTVLGRERAIVVNLEHIKAIITAHEVLL  117



>ref|XP_007199181.1| hypothetical protein PRUPE_ppa020091mg [Prunus persica]
 gb|EMJ00380.1| hypothetical protein PRUPE_ppa020091mg [Prunus persica]
Length=442

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 72/84 (86%), Gaps = 4/84 (5%)
 Frame = +3

Query  168  GLRKKAS----GVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVL  335
            G RKK+S    GVRSWLL+DS G+ QV+EAGKH IMRRTGLP RDLRILDP+L YPSTVL
Sbjct  29   GQRKKSSKGTTGVRSWLLMDSGGKTQVMEAGKHVIMRRTGLPARDLRILDPVLMYPSTVL  88

Query  336  GRERAIVINLEHIKAIITAQXVLL  407
            GRERAIVINLEHIKAI+TA  VLL
Sbjct  89   GRERAIVINLEHIKAIVTAHEVLL  112



>ref|XP_004296095.1| PREDICTED: magnesium transporter MRS2-3-like [Fragaria vesca 
subsp. vesca]
Length=452

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 87/115 (76%), Gaps = 11/115 (10%)
 Frame = +3

Query  90   PPPTKVNAAPAVDDDGHN-----AAVPGIGSGLRKK----ASGVRSWLLLDSTGQAQVVE  242
            P P+K +  PAV+D   +     AA+ G+  G RKK     + VR+WL++DS G +QVVE
Sbjct  8    PQPSK-STPPAVEDPAGSHRPPAAALAGL-HGPRKKGIKSTTSVRAWLVIDSGGNSQVVE  65

Query  243  AGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            AGKHAIMRRTGLP RDLRILDP+L  PSTVLGRERAIVINLEHIKAIITAQ VLL
Sbjct  66   AGKHAIMRRTGLPARDLRILDPVLQCPSTVLGRERAIVINLEHIKAIITAQEVLL  120



>ref|XP_010941938.1| PREDICTED: magnesium transporter MRS2-3-like [Elaeis guineensis]
Length=485

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 82/102 (80%), Gaps = 8/102 (8%)
 Frame = +3

Query  111  AAPAVDDDGHNA-AVPGIGSGLRKKAS--GVRSWLLLDSTGQAQVVEAGKHAIMRRTGLP  281
            A PA +D+   A A PG     RKKAS  GVR+WL +D+ G+A+VVEAG+H++MRRTGLP
Sbjct  12   AGPAGEDEPELAGARPG-----RKKASAAGVRAWLTVDAAGEARVVEAGRHSVMRRTGLP  66

Query  282  GRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
             RDLRILDP LSYPSTVLGRERAIV+NLEHIKAIITA  VLL
Sbjct  67   ARDLRILDPQLSYPSTVLGRERAIVVNLEHIKAIITAHEVLL  108



>ref|XP_010558892.1| PREDICTED: magnesium transporter MRS2-3 [Tarenaya hassleriana]
Length=458

 Score =   128 bits (321),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +3

Query  189  GVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLE  368
            G   WL+L+S GQAQ++EAGKH IMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLE
Sbjct  13   GAGPWLVLNSAGQAQMLEAGKHTIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLE  72

Query  369  HIKAIITAQXVLL  407
            HIKAIITAQ VLL
Sbjct  73   HIKAIITAQEVLL  85



>gb|EPS69518.1| hypothetical protein M569_05249 [Genlisea aurea]
Length=448

 Score =   127 bits (319),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  156  GIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVL  335
            G+ S +RKK+  VR WL+LDS G A+V+E+GKHAIMRRTGLP  DLRILDP LSYPS+VL
Sbjct  24   GVVSLVRKKSVAVREWLVLDSDGNAEVLESGKHAIMRRTGLPATDLRILDPQLSYPSSVL  83

Query  336  GRERAIVINLEHIKAIITAQXVLL  407
            GRE AIV+NLEHIKA+ITA  VLL
Sbjct  84   GREHAIVVNLEHIKAVITADEVLL  107



>gb|ABR17877.1| unknown [Picea sitchensis]
Length=483

 Score =   126 bits (317),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/79 (77%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERA  350
            + KK  GVR+WLL+D  G  QVVEAGKH IMRRTGLP RDLR+LDPLLSYPST+LGR+ A
Sbjct  22   VSKKGIGVRAWLLIDGHGGTQVVEAGKHDIMRRTGLPARDLRVLDPLLSYPSTILGRDTA  81

Query  351  IVINLEHIKAIITAQXVLL  407
            IVINLEHIKAIITA  VLL
Sbjct  82   IVINLEHIKAIITAHEVLL  100



>ref|XP_002980531.1| hypothetical protein SELMODRAFT_53759, partial [Selaginella moellendorffii]
 gb|EFJ18182.1| hypothetical protein SELMODRAFT_53759, partial [Selaginella moellendorffii]
Length=442

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            G+RKK  GVR WL+++S+G  Q +EAGKHAIMRRT LP RDLRILDPLLSYPST+LGRER
Sbjct  1    GMRKKGMGVRMWLVINSSG-VQRLEAGKHAIMRRTSLPARDLRILDPLLSYPSTILGRER  59

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLEHIKAII+A  VLL
Sbjct  60   AIVVNLEHIKAIISAHEVLL  79



>ref|XP_002976803.1| hypothetical protein SELMODRAFT_53758, partial [Selaginella moellendorffii]
 gb|EFJ21913.1| hypothetical protein SELMODRAFT_53758, partial [Selaginella moellendorffii]
Length=442

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            G+RKK  GVR WL+++S+G  Q +EAGKHAIMRRT LP RDLRILDPLLSYPST+LGRER
Sbjct  1    GMRKKGMGVRMWLVINSSG-VQRLEAGKHAIMRRTSLPARDLRILDPLLSYPSTILGRER  59

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLEHIKAII+A  VLL
Sbjct  60   AIVVNLEHIKAIISAHEVLL  79



>ref|XP_010030273.1| PREDICTED: magnesium transporter MRS2-3-like [Eucalyptus grandis]
Length=135

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            R+K  G R+WL++  +GQ++V E GKHAIMRRTGLP RDLR+LDP+LSYPS++LGRERA+
Sbjct  27   RRKGIGTRAWLIVSESGQSRVEEIGKHAIMRRTGLPARDLRVLDPVLSYPSSILGRERAV  86

Query  354  VINLEHIKAIITAQXVLL  407
            V+NLEHIKA+ITA+ V++
Sbjct  87   VVNLEHIKAVITAKEVVM  104



>ref|XP_010487909.1| PREDICTED: magnesium transporter MRS2-3-like [Camelina sativa]
Length=482

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +3

Query  198  SWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIK  377
            SWL+LDS+G+ Q  E GKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIK
Sbjct  44   SWLVLDSSGKPQPKEEGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIK  103

Query  378  AIITAQXVLL  407
            AIITAQ VLL
Sbjct  104  AIITAQEVLL  113



>ref|XP_010507876.1| PREDICTED: magnesium transporter MRS2-3 [Camelina sativa]
Length=484

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +3

Query  198  SWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIK  377
            SWL+LDS+G+ Q  E GKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIK
Sbjct  46   SWLVLDSSGKPQPKEEGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIK  105

Query  378  AIITAQXVLL  407
            AIITAQ VLL
Sbjct  106  AIITAQEVLL  115



>ref|XP_010466120.1| PREDICTED: magnesium transporter MRS2-3-like [Camelina sativa]
Length=483

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +3

Query  198  SWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIK  377
            SWL+LDS+G+ Q  E GKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIK
Sbjct  45   SWLVLDSSGKPQPKEEGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIK  104

Query  378  AIITAQXVLL  407
            AIITAQ VLL
Sbjct  105  AIITAQEVLL  114



>ref|XP_002883195.1| hypothetical protein ARALYDRAFT_479481 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59454.1| hypothetical protein ARALYDRAFT_479481 [Arabidopsis lyrata subsp. 
lyrata]
Length=484

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +3

Query  198  SWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIK  377
            SWL+LDS+G++ + E GKH+IMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIK
Sbjct  46   SWLVLDSSGKSDLKEEGKHSIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIK  105

Query  378  AIITAQXVLL  407
            AIITAQ VLL
Sbjct  106  AIITAQEVLL  115



>gb|KFK40012.1| hypothetical protein AALP_AA3G318600 [Arabis alpina]
Length=448

 Score =   124 bits (312),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 59/71 (83%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +3

Query  195  RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHI  374
            R WL+L S+GQAQ++EA KH IMRRTG+P RDLRILDPLLSYPSTVLGRERAIVINLEHI
Sbjct  34   RQWLVLCSSGQAQMMEADKHTIMRRTGIPARDLRILDPLLSYPSTVLGRERAIVINLEHI  93

Query  375  KAIITAQXVLL  407
            KAIIT+Q VLL
Sbjct  94   KAIITSQEVLL  104



>ref|XP_009402632.1| PREDICTED: magnesium transporter MRS2-F-like [Musa acuminata 
subsp. malaccensis]
Length=446

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +3

Query  123  VDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRIL  302
            ++DD H+ A P   +G R+K S  R WL++  +G++   E GKH+IMRRTGLP RDLR+L
Sbjct  8    MEDDLHHRATPTAAAG-RRKGSVNREWLVVSDSGRSYHEEVGKHSIMRRTGLPARDLRVL  66

Query  303  DPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            DPLLSYPST+LGRERAIVINLEHIKAIITA  VL+
Sbjct  67   DPLLSYPSTILGRERAIVINLEHIKAIITATEVLV  101



>ref|XP_010242791.1| PREDICTED: magnesium transporter MRS2-F-like [Nelumbo nucifera]
Length=432

 Score =   123 bits (309),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            R+K +G+R+WL++  +GQ+ + E GKH+IMRRTGLP RDLRILDP LSYPST+LGRERAI
Sbjct  23   RRKGAGIRAWLVVSESGQSHLEEVGKHSIMRRTGLPARDLRILDPALSYPSTILGRERAI  82

Query  354  VINLEHIKAIITAQXVLL  407
            V+NLEHIKAIITA  VL+
Sbjct  83   VVNLEHIKAIITATEVLV  100



>gb|KCW54071.1| hypothetical protein EUGRSUZ_I00051 [Eucalyptus grandis]
Length=273

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            R+K  G R+WL++  +GQ+ V E GKHAIMRRTGLP RDLR+LDP+LSYPS++LGRERA+
Sbjct  39   RRKGIGTRAWLIVSESGQSPVEEIGKHAIMRRTGLPARDLRVLDPVLSYPSSILGRERAV  98

Query  354  VINLEHIKAIITAQXVLL  407
            V+NLEHIKA+ITA+ VL+
Sbjct  99   VVNLEHIKAVITAKEVLM  116



>ref|XP_010242771.1| PREDICTED: magnesium transporter MRS2-F-like isoform X1 [Nelumbo 
nucifera]
Length=449

 Score =   122 bits (307),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = +3

Query  114  APAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDL  293
            +P V  D      P I    R+K  G R+WL++   GQ+ V E GKH IM+RTGLP RDL
Sbjct  3    SPKVSSDEEFNQTPFIPPQTRRKGIGTRTWLVISEFGQSHVEEVGKHVIMKRTGLPARDL  62

Query  294  RILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            R+LDP+LSYPS++LGRERAIVINLEHIKAIITA  V +
Sbjct  63   RVLDPMLSYPSSILGRERAIVINLEHIKAIITATEVFV  100



>ref|XP_006492023.1| PREDICTED: magnesium transporter MRS2-F-like [Citrus sinensis]
Length=412

 Score =   122 bits (306),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            +K  G+R+WL++  +GQ++V E GKH IMRRTGLP RDLR+LDPLLSYPS++LGRERAIV
Sbjct  22   RKGMGLRTWLVVSESGQSRVEEVGKHVIMRRTGLPARDLRVLDPLLSYPSSILGRERAIV  81

Query  357  INLEHIKAIITAQXVLL  407
            INLEHIKAI+TA+ VL+
Sbjct  82   INLEHIKAIVTAKEVLM  98



>ref|XP_006427735.1| hypothetical protein CICLE_v10027569mg, partial [Citrus clementina]
 gb|ESR40975.1| hypothetical protein CICLE_v10027569mg, partial [Citrus clementina]
Length=449

 Score =   122 bits (306),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            +K  G+R+WL++  +GQ++V E GKH IMRRTGLP RDLR+LDPLLSYPS++LGRERAIV
Sbjct  84   RKGMGLRTWLVVSESGQSRVEEVGKHVIMRRTGLPARDLRVLDPLLSYPSSILGRERAIV  143

Query  357  INLEHIKAIITAQXVLL  407
            INLEHIKAI+TA+ VL+
Sbjct  144  INLEHIKAIVTAKEVLM  160



>gb|KDO45570.1| hypothetical protein CISIN_1g015133mg [Citrus sinensis]
Length=412

 Score =   122 bits (306),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            +K  G+R+WL++  +GQ++V E GKH IMRRTGLP RDLR+LDPLLSYPS++LGRERAIV
Sbjct  22   RKGMGLRTWLVVSESGQSRVEEVGKHVIMRRTGLPARDLRVLDPLLSYPSSILGRERAIV  81

Query  357  INLEHIKAIITAQXVLL  407
            INLEHIKAI+TA+ VL+
Sbjct  82   INLEHIKAIVTAKEVLM  98



>ref|XP_010652955.1| PREDICTED: magnesium transporter MRS2-F-like [Vitis vinifera]
 emb|CBI21632.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   122 bits (305),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            R+K  G+R+WL++  +GQ+ + E GKH++MRRTGLP RDLR+LDP+LSYPST+LGRERAI
Sbjct  22   RRKGIGIRAWLVVLESGQSHLEELGKHSVMRRTGLPARDLRVLDPVLSYPSTILGRERAI  81

Query  354  VINLEHIKAIITAQXVLL  407
            VINLEHIKAIITA+ VL+
Sbjct  82   VINLEHIKAIITAKEVLM  99



>ref|XP_010027528.1| PREDICTED: magnesium transporter MRS2-F-like [Eucalyptus grandis]
Length=411

 Score =   121 bits (303),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            R+K  G R+WL++  +GQ+ V E GKHAIMRRTGLP RDLR+LDP+LSYPS++LGRERA+
Sbjct  39   RRKGIGTRAWLIVSESGQSPVEEIGKHAIMRRTGLPARDLRVLDPVLSYPSSILGRERAV  98

Query  354  VINLEHIKAIITAQXVLL  407
            V+NLEHIKA+ITA+ VL+
Sbjct  99   VVNLEHIKAVITAKEVLM  116



>ref|XP_008465203.1| PREDICTED: magnesium transporter MRS2-2-like [Cucumis melo]
Length=185

 Score =   117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = +3

Query  132  DGHNAAV-PGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDP  308
            DGH   V P     ++KK    R+W+LLD TGQ  V++  KHAIM R  +  RDLRILDP
Sbjct  4    DGHVVPVDPQTALTVKKKKQSSRNWILLDCTGQGTVLDVDKHAIMHRVQIHARDLRILDP  63

Query  309  LLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            LLSYPST+LGRERAIV+NLEHIKAIITA  VLL
Sbjct  64   LLSYPSTILGRERAIVLNLEHIKAIITADEVLL  96



>ref|XP_006297595.1| hypothetical protein CARUB_v10013617mg [Capsella rubella]
 gb|EOA30493.1| hypothetical protein CARUB_v10013617mg [Capsella rubella]
Length=472

 Score =   121 bits (303),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 60/70 (86%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +3

Query  198  SWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIK  377
            SWL+L+S+G A   E GKHAIMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIK
Sbjct  45   SWLVLNSSGSADPKEEGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIK  104

Query  378  AIITAQXVLL  407
            AIITAQ VLL
Sbjct  105  AIITAQEVLL  114



>ref|NP_188598.2| magnesium transporter MRS2-3 [Arabidopsis thaliana]
 sp|Q9LJN2.1|MRS23_ARATH RecName: Full=Magnesium transporter MRS2-3; AltName: Full=Magnesium 
Transporter 4; Short=AtMGT4 [Arabidopsis thaliana]
 dbj|BAB02549.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN17435.1| unknown protein [Arabidopsis thaliana]
 gb|AAN73213.1| MRS2-3 [Arabidopsis thaliana]
 gb|AAP31966.1| At3g19640 [Arabidopsis thaliana]
 gb|AEE76270.1| magnesium transporter MRS2-3 [Arabidopsis thaliana]
Length=484

 Score =   121 bits (303),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/70 (83%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +3

Query  198  SWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIK  377
            +WL+L+S+GQ++  E GKH+IMRRTGLP RDLRILDPLLSYPSTVLGRERAIVINLEHIK
Sbjct  46   TWLVLNSSGQSEPKEEGKHSIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIK  105

Query  378  AIITAQXVLL  407
            AIITAQ VLL
Sbjct  106  AIITAQEVLL  115



>ref|XP_006595173.1| PREDICTED: magnesium transporter MRS2-F-like [Glycine max]
 gb|KHN31895.1| Magnesium transporter MRS2-F [Glycine soja]
Length=415

 Score =   120 bits (302),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 70/82 (85%), Gaps = 3/82 (4%)
 Frame = +3

Query  171  LRKKA---SGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGR  341
            +R+K    +GV+SW+++  TG A++ + GKH+IMRRTGLP RDLR+LDP+LSYPS++LGR
Sbjct  1    MRRKGVGTTGVKSWMVVSETGHARLEDVGKHSIMRRTGLPARDLRVLDPVLSYPSSILGR  60

Query  342  ERAIVINLEHIKAIITAQXVLL  407
            ERAIV+NLEH+KAIITA  VLL
Sbjct  61   ERAIVVNLEHVKAIITASEVLL  82



>gb|KDO41916.1| hypothetical protein CISIN_1g032866mg [Citrus sinensis]
Length=131

 Score =   114 bits (286),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            +K  G+R+WL++  +GQ++V E GKH IMRRTGLP RDLR+LDPLLSYPS++LGRE A+V
Sbjct  21   RKGMGLRTWLVVSESGQSRVEEVGKHVIMRRTGLPARDLRVLDPLLSYPSSILGRELAVV  80

Query  357  INLEHIKAIITAQXVL  404
            INLEH+KAI+TA+ V 
Sbjct  81   INLEHVKAIVTAKEVF  96



>gb|EYU33006.1| hypothetical protein MIMGU_mgv1a008815mg [Erythranthe guttata]
Length=361

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  153  PGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTV  332
            P   +G +KK +G RSW+L+DS+GQ  +++  KHAIM+R  +  RDLRILDPLLSYPST+
Sbjct  15   PTAVAGFKKKGAGSRSWILMDSSGQENLMDVDKHAIMQRVQIHARDLRILDPLLSYPSTI  74

Query  333  LGRERAIVINLEHIKAIITAQXVLL  407
            LGRERAIV+NLEHIKAIITA  VLL
Sbjct  75   LGRERAIVLNLEHIKAIITADEVLL  99



>ref|XP_008785925.1| PREDICTED: magnesium transporter MRS2-F-like [Phoenix dactylifera]
Length=519

 Score =   120 bits (301),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 75/102 (74%), Gaps = 5/102 (5%)
 Frame = +3

Query  114  APAVDDDGHNAAV----PGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLP  281
            APA DD  H  A     P   +  R+K +  R WL++  +G++ + E GKH+IMRRTGLP
Sbjct  7    APA-DDPRHRPAAATTAPPHSAAGRRKGTTSRPWLVVSDSGRSCLEEVGKHSIMRRTGLP  65

Query  282  GRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
             RDLRILDPLLSYPST+LGRERAIV+NLEHIKAIITA  VL+
Sbjct  66   ARDLRILDPLLSYPSTILGRERAIVVNLEHIKAIITATEVLI  107



>gb|AHB08883.1| magnesium transporter MRS2-I isoform 1 [Suaeda glauca]
Length=392

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  156  GIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVL  335
            G+  GL+KKA+G RSW+LLDS GQ  V++  K+AIM R  +  RDLRILDPLLSYPST+L
Sbjct  15   GLSVGLKKKAAGSRSWILLDSLGQGTVLDLDKYAIMNRVHIHARDLRILDPLLSYPSTIL  74

Query  336  GRERAIVINLEHIKAIITAQXVLL  407
            GRE+AIV+NLEHIKAI+TA  VLL
Sbjct  75   GREKAIVLNLEHIKAIVTADEVLL  98



>ref|XP_006492020.1| PREDICTED: magnesium transporter MRS2-F-like isoform X4 [Citrus 
sinensis]
Length=203

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            +K  G+R+WL++  +GQ++V E GKH IMRRTGLP RDLR+LDPLLSYPS++LGRE A+V
Sbjct  21   RKGMGLRTWLVVSESGQSRVEEVGKHVIMRRTGLPARDLRVLDPLLSYPSSILGRELAVV  80

Query  357  INLEHIKAIITAQXVL  404
            INLEH+KAI+TA+ V 
Sbjct  81   INLEHVKAIVTAKEVF  96



>ref|XP_006492021.1| PREDICTED: magnesium transporter MRS2-F-like isoform X5 [Citrus 
sinensis]
Length=200

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            +K  G+R+WL++  +GQ++V E GKH IMRRTGLP RDLR+LDPLLSYPS++LGRE A+V
Sbjct  21   RKGMGLRTWLVVSESGQSRVEEVGKHVIMRRTGLPARDLRVLDPLLSYPSSILGRELAVV  80

Query  357  INLEHIKAIITAQXVL  404
            INLEH+KAI+TA+ V 
Sbjct  81   INLEHVKAIVTAKEVF  96



>ref|XP_006492018.1| PREDICTED: magnesium transporter MRS2-F-like isoform X2 [Citrus 
sinensis]
Length=209

 Score =   115 bits (288),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            +K  G+R+WL++  +GQ++V E GKH IMRRTGLP RDLR+LDPLLSYPS++LGRE A+V
Sbjct  21   RKGMGLRTWLVVSESGQSRVEEVGKHVIMRRTGLPARDLRVLDPLLSYPSSILGRELAVV  80

Query  357  INLEHIKAIITAQXVL  404
            INLEH+KAI+TA+ V 
Sbjct  81   INLEHVKAIVTAKEVF  96



>ref|XP_008775464.1| PREDICTED: magnesium transporter MRS2-I-like [Phoenix dactylifera]
Length=166

 Score =   114 bits (285),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            S L+KK +  RSW+LLD TG+  +++  K+AIM R  +  RDLRILDPLLSYPST+LGRE
Sbjct  22   SALKKKTAVSRSWILLDCTGEGTILDVDKYAIMHRVQIHARDLRILDPLLSYPSTILGRE  81

Query  345  RAIVINLEHIKAIITAQXVLL  407
            RAIV+NLEHIKAIITA+ VLL
Sbjct  82   RAIVLNLEHIKAIITAEEVLL  102



>ref|XP_010065748.1| PREDICTED: magnesium transporter MRS2-3-like [Eucalyptus grandis]
Length=473

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERA  350
            LRKK  G+++WL+++STGQAQ+V+AGKH I RRTGL  RDLRILDP LSYPSTV+GRERA
Sbjct  32   LRKKDIGIKTWLVVNSTGQAQLVDAGKHLIKRRTGLSARDLRILDPSLSYPSTVIGRERA  91

Query  351  IVINLEHIKAIITAQXVLL  407
            +VI LEHIK +ITA+ V L
Sbjct  92   VVIKLEHIKGVITAKDVWL  110



>ref|XP_006847050.1| hypothetical protein AMTR_s00017p00189670 [Amborella trichopoda]
 gb|ERN08631.1| hypothetical protein AMTR_s00017p00189670 [Amborella trichopoda]
Length=424

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            RK A+G++ WL++ ++GQ+ + E GKH+IMRRTGLP RDLR+LDP LSYPST+LGRERAI
Sbjct  15   RKGATGLKPWLVITASGQSHLEEVGKHSIMRRTGLPARDLRVLDPALSYPSTILGRERAI  74

Query  354  VINLEHIKAIITAQXVLL  407
            VINLEHI+A+ITA  VL+
Sbjct  75   VINLEHIRAVITAAEVLV  92



>gb|EYU32515.1| hypothetical protein MIMGU_mgv1a024210mg [Erythranthe guttata]
Length=397

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            +GL+KK +G RSW+L+DS+GQ  +++  K+AIM R  +  RDLRILDPLLSYPST+LGRE
Sbjct  21   AGLKKKGAGSRSWILMDSSGQEIILDVDKYAIMHRVQIHARDLRILDPLLSYPSTILGRE  80

Query  345  RAIVINLEHIKAIITAQXVLL  407
            RAIV+NLEHIKAIIT++ VLL
Sbjct  81   RAIVLNLEHIKAIITSEEVLL  101



>ref|XP_006492017.1| PREDICTED: magnesium transporter MRS2-F-like isoform X1 [Citrus 
sinensis]
Length=298

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            +K  G+R+WL++  +GQ++V E GKH IMRRTGLP RDLR+LDPLLSYPS++LGRE A+V
Sbjct  21   RKGMGLRTWLVVSESGQSRVEEVGKHVIMRRTGLPARDLRVLDPLLSYPSSILGRELAVV  80

Query  357  INLEHIKAIITAQXVL  404
            INLEH+KAI+TA+ V 
Sbjct  81   INLEHVKAIVTAKEVF  96



>ref|XP_004150432.1| PREDICTED: magnesium transporter MRS2-2-like [Cucumis sativus]
 ref|XP_004164422.1| PREDICTED: magnesium transporter MRS2-2-like [Cucumis sativus]
 gb|KGN61641.1| hypothetical protein Csa_2G199910 [Cucumis sativus]
Length=393

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = +3

Query  132  DGHNAAV-PGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDP  308
            DGH   V P     ++KK    R+W+LLD TGQ  V++  KHAIM R  +  RDLRILDP
Sbjct  4    DGHVVPVDPQTALTVKKKKQSSRNWILLDCTGQGTVLDVDKHAIMHRVQIHARDLRILDP  63

Query  309  LLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            LLSYPST+LGRERAIV+NLEHIKAIITA  VLL
Sbjct  64   LLSYPSTILGRERAIVLNLEHIKAIITADEVLL  96



>ref|XP_011091115.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Sesamum 
indicum]
Length=401

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            +G +KK +G RSW+L+DS+GQ  V++  K+AIM R  +  RDLRILDPLLSYPST+LGRE
Sbjct  25   AGFKKKGAGSRSWILMDSSGQEIVLDVDKYAIMHRVQIHARDLRILDPLLSYPSTILGRE  84

Query  345  RAIVINLEHIKAIITAQXVLL  407
            RAIV+NLEHIKAIITA  VLL
Sbjct  85   RAIVLNLEHIKAIITADEVLL  105



>ref|XP_011091116.1| PREDICTED: magnesium transporter MRS2-I-like isoform X2 [Sesamum 
indicum]
Length=393

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            +G +KK +G RSW+L+DS+GQ  V++  K+AIM R  +  RDLRILDPLLSYPST+LGRE
Sbjct  25   AGFKKKGAGSRSWILMDSSGQEIVLDVDKYAIMHRVQIHARDLRILDPLLSYPSTILGRE  84

Query  345  RAIVINLEHIKAIITAQXVLL  407
            RAIV+NLEHIKAIITA  VLL
Sbjct  85   RAIVLNLEHIKAIITADEVLL  105



>ref|XP_010912043.1| PREDICTED: magnesium transporter MRS2-F-like [Elaeis guineensis]
Length=437

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = +3

Query  150  VPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPST  329
             PG  +  R+K +  R+WL++ S G A + E GKH+IMRRTGLP RDLR+LDPLLSYPST
Sbjct  24   TPGHTAAGRRKGTASRAWLVV-SDGGAHLEEVGKHSIMRRTGLPARDLRVLDPLLSYPST  82

Query  330  VLGRERAIVINLEHIKAIITAQXVLL  407
            +LGRERAIVINLEHIKAIITA  VL+
Sbjct  83   ILGRERAIVINLEHIKAIITATEVLI  108



>ref|XP_002310545.2| hypothetical protein POPTR_0007s04900g [Populus trichocarpa]
 gb|EEE90995.2| hypothetical protein POPTR_0007s04900g [Populus trichocarpa]
Length=413

 Score =   117 bits (293),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/83 (64%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  159  IGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLG  338
            + S L+K   GV++WL++  +GQ+ V E GKH+IM+RTGLP RDLR LDP+LSYPS++LG
Sbjct  1    MASKLKKGMIGVKAWLVISESGQSFVEEVGKHSIMKRTGLPARDLRALDPVLSYPSSILG  60

Query  339  RERAIVINLEHIKAIITAQXVLL  407
            RERAIV+NLEHI+AIITA  VL+
Sbjct  61   RERAIVVNLEHIRAIITATEVLM  83



>ref|XP_007143876.1| hypothetical protein PHAVU_007G109400g [Phaseolus vulgaris]
 gb|ESW15870.1| hypothetical protein PHAVU_007G109400g [Phaseolus vulgaris]
Length=314

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +3

Query  147  AVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPS  326
            A PG  + ++KK    RSW+L D+TGQ  +++  K+AIM R  +  RDLRILDPLLSYPS
Sbjct  10   ADPGAMAVVKKKTQSARSWILFDTTGQGSLLDVDKYAIMHRVQIHARDLRILDPLLSYPS  69

Query  327  TVLGRERAIVINLEHIKAIITAQXVLL  407
            T+LGRE+AIV+NLEHIKAIITA+ VLL
Sbjct  70   TILGREKAIVLNLEHIKAIITAEEVLL  96



>ref|XP_009599329.1| PREDICTED: magnesium transporter MRS2-I-like [Nicotiana tomentosiformis]
Length=393

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  153  PGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTV  332
            PG   GL+KK +G RSWLL+D++G   V++  K+AIM R  +  RDLRILDPLLSYPST+
Sbjct  13   PGQVVGLKKKGTGSRSWLLMDASGLETVLDVDKYAIMHRVQIHARDLRILDPLLSYPSTI  72

Query  333  LGRERAIVINLEHIKAIITAQXVLL  407
            LGRERAIV+NLEHIKAIIT++ V+L
Sbjct  73   LGRERAIVLNLEHIKAIITSEEVIL  97



>ref|XP_002520990.1| RNA splicing protein mrs2, mitochondrial, putative [Ricinus communis]
 gb|EEF41407.1| RNA splicing protein mrs2, mitochondrial, putative [Ricinus communis]
Length=392

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            + L+KK +  RSW+LLDS GQ+ +++  K+AIMRR  +  RDLRILDPLLSYPST+LGRE
Sbjct  14   ASLKKKTAVSRSWILLDSNGQSSILDVDKYAIMRRVQIHARDLRILDPLLSYPSTILGRE  73

Query  345  RAIVINLEHIKAIITAQXVLL  407
            R IV+NLEHIKAIITA+ VLL
Sbjct  74   RVIVLNLEHIKAIITAEEVLL  94



>ref|XP_010912044.1| PREDICTED: LOW QUALITY PROTEIN: magnesium transporter MRS2-F-like 
[Elaeis guineensis]
Length=397

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            R+K +  R WL++  +G++ + E GKH+IMRRTGLP RDLRILDPLLSYPST+LGRERAI
Sbjct  29   RRKGTTSRPWLVVSDSGRSCLEEVGKHSIMRRTGLPARDLRILDPLLSYPSTILGRERAI  88

Query  354  VINLEHIKAIITAQXVLL  407
            V+NLEHIKAIITA  VL+
Sbjct  89   VVNLEHIKAIITATEVLI  106



>ref|XP_006838858.1| hypothetical protein AMTR_s00002p00265910 [Amborella trichopoda]
 gb|ERN01427.1| hypothetical protein AMTR_s00002p00265910 [Amborella trichopoda]
Length=391

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  147  AVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPS  326
            ++  + +  +KKA+  RSW+LLDSTG+  V++A K+AIM R  +  RDLRILDPLLSYPS
Sbjct  8    SILDVQNATKKKAAAPRSWILLDSTGEGTVLDADKYAIMHRVQIHARDLRILDPLLSYPS  67

Query  327  TVLGRERAIVINLEHIKAIITAQXVLL  407
            T+LGRERAIV+NLEHIKAIIT++ VLL
Sbjct  68   TILGRERAIVLNLEHIKAIITSEEVLL  94



>ref|XP_011022848.1| PREDICTED: magnesium transporter MRS2-F-like [Populus euphratica]
Length=413

 Score =   116 bits (291),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 53/83 (64%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  159  IGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLG  338
            + S L+K   GV++WL++  +GQ+ V E GKH+IM+RTGLP RDLR LDP+LSYPS++LG
Sbjct  1    MASKLKKGMIGVKAWLVISESGQSFVDEVGKHSIMKRTGLPARDLRALDPVLSYPSSILG  60

Query  339  RERAIVINLEHIKAIITAQXVLL  407
            RERAIV+NLEHI+AIITA  VL+
Sbjct  61   RERAIVVNLEHIRAIITATEVLM  83



>ref|XP_009385103.1| PREDICTED: magnesium transporter MRS2-F-like [Musa acuminata 
subsp. malaccensis]
Length=444

 Score =   116 bits (290),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 63/110 (57%), Positives = 79/110 (72%), Gaps = 9/110 (8%)
 Frame = +3

Query  78   MMRGPPPTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHA  257
            M+R P PT        +DD H+ A     +  R+K +  R+WL+L  +G++   E GKH+
Sbjct  1    MVRSPKPTP-------EDDVHHRAA--PAAAGRRKGTVNRAWLVLSDSGRSYHEEVGKHS  51

Query  258  IMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            IMRRTGLP RDLR+LDPLLSYPST+LGRERAIVINLEHIKA+ITA  VL+
Sbjct  52   IMRRTGLPARDLRVLDPLLSYPSTILGRERAIVINLEHIKAVITATEVLI  101



>ref|XP_010932874.1| PREDICTED: magnesium transporter MRS2-I-like [Elaeis guineensis]
Length=389

 Score =   115 bits (289),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            + L+KK +  RSW+LLDS G+  +++A K+AIM R  +  RDLRILDPLLSYPST+LGRE
Sbjct  13   NALKKKTAVSRSWILLDSRGEGTILDADKYAIMHRVQIHARDLRILDPLLSYPSTILGRE  72

Query  345  RAIVINLEHIKAIITAQXVLL  407
            RAIV+NLEHIKAIITAQ VLL
Sbjct  73   RAIVLNLEHIKAIITAQEVLL  93



>ref|XP_009799375.1| PREDICTED: magnesium transporter MRS2-I-like [Nicotiana sylvestris]
Length=393

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+KK +G RSWLL+D++G   V++  K+AIM R  +  RDLRI+DPLLSYPST+LGRER
Sbjct  18   GLKKKGTGSRSWLLMDASGLETVLDVDKYAIMHRVQIHARDLRIIDPLLSYPSTILGRER  77

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLEHIKAIIT++ VLL
Sbjct  78   AIVLNLEHIKAIITSEEVLL  97



>ref|XP_008677478.1| PREDICTED: LOC100283487 isoform X2 [Zea mays]
Length=374

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +3

Query  147  AVPGIGSGLRKKASGV-RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYP  323
            A  G G+G   K  G  RSW+LLD+ G+ Q+++A K+AIMRR  +  RDLRILDPLLSYP
Sbjct  2    AAAGAGTGSEGKKRGASRSWILLDAAGEEQLLDADKYAIMRRVDINARDLRILDPLLSYP  61

Query  324  STVLGRERAIVINLEHIKAIITAQXVLL  407
            ST+LGRERAIV+NLEHIKAIIT+  VLL
Sbjct  62   STILGRERAIVLNLEHIKAIITSNEVLL  89



>ref|XP_011073486.1| PREDICTED: magnesium transporter MRS2-I-like [Sesamum indicum]
Length=395

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +3

Query  153  PGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTV  332
            P    GL+KK +G RSW+L+DS+GQ  +++  K+AIM R  +  RDLRILDPLLSYPS +
Sbjct  15   PNAVGGLKKKGAGSRSWILIDSSGQEIILDVDKYAIMHRVQIHARDLRILDPLLSYPSAI  74

Query  333  LGRERAIVINLEHIKAIITAQXVLL  407
            LGRERAIV+NLEHIKAIIT++ VLL
Sbjct  75   LGRERAIVLNLEHIKAIITSEEVLL  99



>gb|ACN31570.1| unknown [Zea mays]
 tpg|DAA51272.1| TPA: metal ion transporter [Zea mays]
Length=384

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +3

Query  147  AVPGIGSGLRKKASGV-RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYP  323
            A  G G+G   K  G  RSW+LLD+ G+ Q+++A K+AIMRR  +  RDLRILDPLLSYP
Sbjct  2    AAAGAGTGSEGKKRGASRSWILLDAAGEEQLLDADKYAIMRRVDINARDLRILDPLLSYP  61

Query  324  STVLGRERAIVINLEHIKAIITAQXVLL  407
            ST+LGRERAIV+NLEHIKAIIT+  VLL
Sbjct  62   STILGRERAIVLNLEHIKAIITSNEVLL  89



>ref|XP_008785924.1| PREDICTED: magnesium transporter MRS2-F-like [Phoenix dactylifera]
Length=382

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 1/78 (1%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            R+K +  R+WL++   G A + E GKH+IMRRTGLP RDLR+LDPLLSYPST+LGRERAI
Sbjct  32   RRKGTASRAWLVVSDCG-AYLEEVGKHSIMRRTGLPARDLRVLDPLLSYPSTILGRERAI  90

Query  354  VINLEHIKAIITAQXVLL  407
            VINLEHIKAIITA  VL+
Sbjct  91   VINLEHIKAIITATEVLI  108



>ref|XP_006847049.1| hypothetical protein AMTR_s00017p00188570 [Amborella trichopoda]
 gb|ERN08630.1| hypothetical protein AMTR_s00017p00188570 [Amborella trichopoda]
Length=441

 Score =   115 bits (288),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 59/100 (59%), Positives = 75/100 (75%), Gaps = 3/100 (3%)
 Frame = +3

Query  108  NAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGR  287
            N+A  + +D    AV   G   RK ASG + W+++  +G++ + EAGKH+IMRRTGLP R
Sbjct  10   NSAKVMAED---EAVRVPGGPRRKGASGPKPWMVITVSGRSYLEEAGKHSIMRRTGLPAR  66

Query  288  DLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            DLR+LDP LSYPS +LGRERAI+INLEHIKAIITA  VL+
Sbjct  67   DLRVLDPALSYPSAILGRERAIMINLEHIKAIITAVEVLV  106



>gb|KCW63394.1| hypothetical protein EUGRSUZ_G01039 [Eucalyptus grandis]
Length=416

 Score =   115 bits (287),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            KKA  V++WL++DSTG+ Q ++AGKH+IMRRTGL  RDLRILDP LSYPS++ GRERAIV
Sbjct  25   KKAVRVKTWLVIDSTGRVQQIDAGKHSIMRRTGLSARDLRILDPFLSYPSSITGRERAIV  84

Query  357  INLEHIKAIITAQXVLL  407
            I LEHIK I+TA  V L
Sbjct  85   IKLEHIKGILTAHDVWL  101



>ref|NP_001149859.1| LOC100283487 [Zea mays]
 gb|ACG37034.1| metal ion transporter [Zea mays]
Length=384

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +3

Query  147  AVPGIGSGLRKKASGV-RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYP  323
            A  G G+G   K  G  RSW+LLD+ G+ Q+++A K+AIMRR  +  RDLRILDPLLSYP
Sbjct  2    AAAGAGTGSEGKKRGASRSWILLDAAGEEQLLDADKYAIMRRVDINARDLRILDPLLSYP  61

Query  324  STVLGRERAIVINLEHIKAIITAQXVLL  407
            ST+LGRERAIV+NLEHIKAIIT+  VLL
Sbjct  62   STILGRERAIVLNLEHIKAIITSNEVLL  89



>ref|XP_008677476.1| PREDICTED: LOC100283487 isoform X1 [Zea mays]
 tpg|DAA51271.1| TPA: hypothetical protein ZEAMMB73_884019 [Zea mays]
Length=380

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +3

Query  147  AVPGIGSGLRKKASGV-RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYP  323
            A  G G+G   K  G  RSW+LLD+ G+ Q+++A K+AIMRR  +  RDLRILDPLLSYP
Sbjct  2    AAAGAGTGSEGKKRGASRSWILLDAAGEEQLLDADKYAIMRRVDINARDLRILDPLLSYP  61

Query  324  STVLGRERAIVINLEHIKAIITAQXVLL  407
            ST+LGRERAIV+NLEHIKAIIT+  VLL
Sbjct  62   STILGRERAIVLNLEHIKAIITSNEVLL  89



>gb|KHF98502.1| Magnesium transporter MRS2-10 -like protein [Gossypium arboreum]
Length=206

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            SGL+K+  G+RSW+ +D++G +QV+E  K  +MRR  LP RDLR+LDPL  YPST+LGRE
Sbjct  60   SGLKKRGQGLRSWIRVDTSGNSQVIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGRE  119

Query  345  RAIVINLEHIKAIITAQXVLL  407
            +AIV+NLE I+ IITA  VLL
Sbjct  120  KAIVVNLEQIRCIITADEVLL  140



>ref|XP_010917593.1| PREDICTED: magnesium transporter MRS2-I-like [Elaeis guineensis]
Length=390

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            S L+KK +  RSW+LLD +G+  +++  K+AIM R  +  RDLRILDPLLSYPST+LGRE
Sbjct  14   SALKKKTAAARSWILLDCSGEETILDVDKYAIMHRVQIHARDLRILDPLLSYPSTILGRE  73

Query  345  RAIVINLEHIKAIITAQXVLL  407
            RAIV+NLEHIKAIITA+ VLL
Sbjct  74   RAIVLNLEHIKAIITAEEVLL  94



>gb|KCW63395.1| hypothetical protein EUGRSUZ_G01040, partial [Eucalyptus grandis]
Length=430

 Score =   114 bits (286),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  180  KASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVI  359
            K  G+++WL+++STGQAQ+V+AGKH I RRTGL  RDLRILDP LSYPSTV+GRERA+VI
Sbjct  1    KDIGIKTWLVVNSTGQAQLVDAGKHLIKRRTGLSARDLRILDPSLSYPSTVIGRERAVVI  60

Query  360  NLEHIKAIITAQXVLL  407
             LEHIK +ITA+ V L
Sbjct  61   KLEHIKGVITAKDVWL  76



>ref|XP_006597109.1| PREDICTED: magnesium transporter MRS2-3-like [Glycine max]
Length=108

 Score =   108 bits (270),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 67/82 (82%), Gaps = 3/82 (4%)
 Frame = +3

Query  171  LRKKASG---VRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGR  341
            +R+K  G   V+SW+++  TG +++ + GKH+IMRRTGLP RD R+LDP+LSYPS++LGR
Sbjct  1    MRRKGVGTTAVKSWMVVSETGHSRLEDVGKHSIMRRTGLPARDPRVLDPVLSYPSSILGR  60

Query  342  ERAIVINLEHIKAIITAQXVLL  407
            ERAIV+N EH+KAIITA  +LL
Sbjct  61   ERAIVVNFEHVKAIITASELLL  82



>ref|XP_010065747.1| PREDICTED: magnesium transporter MRS2-3-like isoform X2 [Eucalyptus 
grandis]
Length=454

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            KKA  V++WL++DSTG+ Q ++AGKH+IMRRTGL  RDLRILDP LSYPS++ GRERAIV
Sbjct  35   KKAVRVKTWLVIDSTGRVQQIDAGKHSIMRRTGLSARDLRILDPFLSYPSSITGRERAIV  94

Query  357  INLEHIKAIITAQXVLL  407
            I LEHIK I+TA  V L
Sbjct  95   IKLEHIKGILTAHDVWL  111



>ref|XP_010065746.1| PREDICTED: magnesium transporter MRS2-3-like isoform X1 [Eucalyptus 
grandis]
Length=457

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            KKA  V++WL++DSTG+ Q ++AGKH+IMRRTGL  RDLRILDP LSYPS++ GRERAIV
Sbjct  35   KKAVRVKTWLVIDSTGRVQQIDAGKHSIMRRTGLSARDLRILDPFLSYPSSITGRERAIV  94

Query  357  INLEHIKAIITAQXVLL  407
            I LEHIK I+TA  V L
Sbjct  95   IKLEHIKGILTAHDVWL  111



>gb|EPS65976.1| hypothetical protein M569_08801 [Genlisea aurea]
Length=395

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +3

Query  129  DDGHNAAVPGIG--SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRIL  302
            D GH A    +   +G +KK  G R+W+L+DS+G+  V++  K+AIM R  +  RDLRIL
Sbjct  6    DGGHLAPADLVNAVTGFKKKGGGSRNWILMDSSGKETVLDVDKYAIMHRVHIHARDLRIL  65

Query  303  DPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            DPLLSYPST+LGRERAIV+NLEHIKAI+TA  VLL
Sbjct  66   DPLLSYPSTILGRERAIVLNLEHIKAIVTADEVLL  100



>ref|XP_010232713.1| PREDICTED: magnesium transporter MRS2-F-like [Brachypodium distachyon]
Length=452

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  195  RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHI  374
            R WL++ +TG+A+V EAGKHA+M RTGLP RDLR+LDPLLSYPST+LGRERAIV+NLE I
Sbjct  31   REWLVVPATGRARVEEAGKHAVMARTGLPARDLRVLDPLLSYPSTILGRERAIVVNLERI  90

Query  375  KAIITAQXVLL  407
            KA+ITA  VLL
Sbjct  91   KAVITAAEVLL  101



>emb|CDP20394.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  162  GSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGR  341
             S L KK  GVR WLL +S+GQ+ ++EAGKHAIMRRTG+ GRDLRILDP LSYP T+ GR
Sbjct  7    SSPLGKKPLGVRPWLLFNSSGQSHILEAGKHAIMRRTGITGRDLRILDPDLSYPCTISGR  66

Query  342  ERAIVINLEHIKAIITAQXVLL  407
            ERAI+ ++E+IKA+I A  VLL
Sbjct  67   ERAIIFSVENIKAVIMAHEVLL  88



>gb|EPS60304.1| magnesium transporter, partial [Genlisea aurea]
Length=243

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            SGL+K+  GVRSW+ +D +G +QV+E  K  +MRR  LP RDLR+LDPL  YPST+LGRE
Sbjct  41   SGLKKRGQGVRSWIRVDVSGNSQVIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGRE  100

Query  345  RAIVINLEHIKAIITAQXVLL  407
            +AIV+NLE I+ IITA  VLL
Sbjct  101  KAIVVNLEQIRCIITADEVLL  121



>sp|Q8L4S2.1|MRS2F_ORYSJ RecName: Full=Magnesium transporter MRS2-F [Oryza sativa Japonica 
Group]
 sp|A2WY50.1|MRS2F_ORYSI RecName: Full=Magnesium transporter MRS2-F [Oryza sativa Indica 
Group]
 dbj|BAB92573.1| P0497A05.17 [Oryza sativa Japonica Group]
 dbj|BAB92606.1| putative MRS2-7 [Oryza sativa Japonica Group]
 dbj|BAD82756.1| putative MRS2-7 [Oryza sativa Japonica Group]
 gb|EAY76896.1| hypothetical protein OsI_04855 [Oryza sativa Indica Group]
 gb|EAZ14556.1| hypothetical protein OsJ_04478 [Oryza sativa Japonica Group]
 dbj|BAH00210.1| unnamed protein product [Oryza sativa Japonica Group]
Length=444

 Score =   114 bits (284),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  195  RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHI  374
            R WL++ ++GQA+V EAGKHA+M RTGLP RDLR+LDPLLSYPST+LGRERAIV+NLE +
Sbjct  28   REWLVVPASGQARVEEAGKHAVMARTGLPARDLRVLDPLLSYPSTILGRERAIVVNLERV  87

Query  375  KAIITAQXVLL  407
            KA+ITA  VLL
Sbjct  88   KAVITAAEVLL  98



>ref|XP_006411758.1| hypothetical protein EUTSA_v10027315mg [Eutrema salsugineum]
 gb|ESQ53211.1| hypothetical protein EUTSA_v10027315mg [Eutrema salsugineum]
Length=448

 Score =   114 bits (284),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 64/109 (59%), Positives = 70/109 (64%), Gaps = 8/109 (7%)
 Frame = +3

Query  81   MRGPPPTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAI  260
            MRG    K NA       G        G G RKK   VR WL+L S+G    +  GKH I
Sbjct  1    MRGMIQAKPNA-------GQPTPTYSTGGGGRKKGVCVRPWLVLYSSGDEPKL-IGKHDI  52

Query  261  MRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            MRRTGLP RDLRILDPLLSYPS+VLGRE+AIV+NLEHIK IIT Q V L
Sbjct  53   MRRTGLPARDLRILDPLLSYPSSVLGREKAIVVNLEHIKTIITPQEVFL  101



>ref|XP_010526977.1| PREDICTED: magnesium transporter MRS2-F-like [Tarenaya hassleriana]
Length=405

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = +3

Query  129  DDGHNAAVPGIGSGLRKKASG-VRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILD  305
            D+   A +P      R K SG VR+W ++ + G +++ + GKH+IMRRTGLP RDLR LD
Sbjct  8    DEDPTARIPAAAQAKRVKGSGGVRTWTVVTAAGDSRLEDVGKHSIMRRTGLPARDLRALD  67

Query  306  PLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            P+LSYPS++LGRERAIV+NLEHIK IITA+ V L
Sbjct  68   PVLSYPSSILGRERAIVVNLEHIKCIITAKEVFL  101



>gb|AFW84241.1| hypothetical protein ZEAMMB73_119664 [Zea mays]
Length=230

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  195  RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHI  374
            R WL++ ++G A+V EAGKHA+M RTGLP RDLR+LDPLLSYPST+LGRERAIV+NLE +
Sbjct  27   REWLVVPASGPARVEEAGKHAVMARTGLPARDLRVLDPLLSYPSTILGRERAIVVNLERV  86

Query  375  KAIITAQXVLL  407
            KA+ITA  VLL
Sbjct  87   KALITAAEVLL  97



>ref|XP_008786166.1| PREDICTED: magnesium transporter MRS2-I-like [Phoenix dactylifera]
Length=398

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +3

Query  114  APAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDL  293
            A A++  G  AA+   G      +S  R W++LD TG+A+V++  K+AIM R  +  RDL
Sbjct  7    AAALEAHGEAAALEANGEVAEASSSTTRRWIVLDFTGEAKVLDVDKYAIMHRVQVHARDL  66

Query  294  RILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            RI+DPLLSYPS++LGRERAIV+NLEHIKAIITA+ VLL
Sbjct  67   RIIDPLLSYPSSILGRERAIVLNLEHIKAIITAEEVLL  104



>ref|XP_010232712.1| PREDICTED: magnesium transporter MRS2-F-like [Brachypodium distachyon]
Length=455

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  195  RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHI  374
            R WL++ +TG+A+V EAGKHA+M RTGLP RDLR+LDPLLSYPST+LGRERAIV+NLE +
Sbjct  29   REWLVVPATGRARVEEAGKHAVMARTGLPARDLRVLDPLLSYPSTILGRERAIVVNLERV  88

Query  375  KAIITAQXVLL  407
            KA+ITA  VLL
Sbjct  89   KAVITAAEVLL  99



>ref|XP_010669638.1| PREDICTED: magnesium transporter MRS2-I-like [Beta vulgaris subsp. 
vulgaris]
Length=390

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +3

Query  156  GIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVL  335
            G+  GL+KK  G R+W+LLDS+ Q  V+   K+AIM R  +  RDLRILDPLLSYPST+L
Sbjct  15   GLSVGLKKKLVGSRNWVLLDSSRQGTVLNLDKYAIMHRVHIHARDLRILDPLLSYPSTIL  74

Query  336  GRERAIVINLEHIKAIITAQXVLL  407
            GRE+AIV+NLEHIKAIITA  VLL
Sbjct  75   GREKAIVLNLEHIKAIITADEVLL  98



>ref|XP_006378361.1| hypothetical protein POPTR_0010s08850g [Populus trichocarpa]
 gb|ERP56158.1| hypothetical protein POPTR_0010s08850g [Populus trichocarpa]
Length=359

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +3

Query  147  AVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPS  326
            A P   + ++KK    RSW+L+D+TGQ  +++A KHAIM R  +  RDLRILDPLLSYPS
Sbjct  10   ADPPAVTSVKKKTQPARSWILVDATGQGTILDADKHAIMNRVQIHARDLRILDPLLSYPS  69

Query  327  TVLGRERAIVINLEHIKAIITAQXVLL  407
            T+LGRE AIV+NLEHIKAIIT++ VLL
Sbjct  70   TILGREGAIVLNLEHIKAIITSEEVLL  96



>gb|KJB66345.1| hypothetical protein B456_010G136800 [Gossypium raimondii]
Length=375

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            SGL+K+  G+RSW+ +D++G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE
Sbjct  40   SGLKKRGQGLRSWIRVDTSGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGRE  99

Query  345  RAIVINLEHIKAIITAQXVLL  407
            +AIV+NLE I+ IITA  VLL
Sbjct  100  KAIVVNLEQIRCIITADEVLL  120



>ref|XP_010694561.1| PREDICTED: magnesium transporter MRS2-I-like [Beta vulgaris subsp. 
vulgaris]
Length=392

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +3

Query  156  GIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVL  335
            G+  GL+KK  G R+W+LLD  GQ  V++  K+AIM R  +  RDLRILDPLLSYPST+L
Sbjct  15   GLSVGLKKKPVGSRNWILLDLLGQGTVLDLDKYAIMHRVHIHARDLRILDPLLSYPSTIL  74

Query  336  GRERAIVINLEHIKAIITAQXVLL  407
            GRE+AIV+NLEHIKAIITA  VLL
Sbjct  75   GREKAIVLNLEHIKAIITADEVLL  98



>gb|KJB66346.1| hypothetical protein B456_010G136800 [Gossypium raimondii]
Length=358

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            SGL+K+  G+RSW+ +D++G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE
Sbjct  40   SGLKKRGQGLRSWIRVDTSGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGRE  99

Query  345  RAIVINLEHIKAIITAQXVLL  407
            +AIV+NLE I+ IITA  VLL
Sbjct  100  KAIVVNLEQIRCIITADEVLL  120



>gb|KJB66347.1| hypothetical protein B456_010G136800 [Gossypium raimondii]
Length=371

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            SGL+K+  G+RSW+ +D++G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE
Sbjct  40   SGLKKRGQGLRSWIRVDTSGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGRE  99

Query  345  RAIVINLEHIKAIITAQXVLL  407
            +AIV+NLE I+ IITA  VLL
Sbjct  100  KAIVVNLEQIRCIITADEVLL  120



>ref|XP_008353796.1| PREDICTED: magnesium transporter MRS2-1-like [Malus domestica]
Length=216

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +D++G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  44   GLKKRGQGLRSWIRVDTSGNSQIIEVDKFXMMRRCDLPARDLRLLDPLFVYPSTILGREK  103

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  104  AIVVNLEQIRCIITADEVLL  123



>ref|XP_004495386.1| PREDICTED: magnesium transporter MRS2-2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004495387.1| PREDICTED: magnesium transporter MRS2-2-like isoform X2 [Cicer 
arietinum]
 ref|XP_004495388.1| PREDICTED: magnesium transporter MRS2-2-like isoform X3 [Cicer 
arietinum]
 ref|XP_004495390.1| PREDICTED: magnesium transporter MRS2-2-like isoform X5 [Cicer 
arietinum]
Length=390

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERA  350
            ++KK    RSW+L+D+TGQ  +++  K+AIM R  +  RDLRILDPLLSYPST+LGRE+A
Sbjct  18   MKKKTQTSRSWILIDATGQGSMLDVDKYAIMHRVQINARDLRILDPLLSYPSTILGREKA  77

Query  351  IVINLEHIKAIITAQXVLL  407
            IV+NLEHIKAIITA+ VLL
Sbjct  78   IVLNLEHIKAIITAEEVLL  96



>gb|KJB72319.1| hypothetical protein B456_011G170800 [Gossypium raimondii]
Length=286

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
             ++KKA   RSW+LLDSTG+  V++  K+AIM R  +  RDLRILDPLLSYPST+LGR+ 
Sbjct  14   AVKKKAQSSRSWVLLDSTGETTVLDVDKYAIMHRVNIHARDLRILDPLLSYPSTILGRDG  73

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLEHIKAIIT++ VLL
Sbjct  74   AIVLNLEHIKAIITSEEVLL  93



>ref|XP_003556388.1| PREDICTED: magnesium transporter MRS2-2-like isoform X1 [Glycine 
max]
Length=395

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +3

Query  153  PGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTV  332
            P   + ++KK    RSW+L D+TGQ  +++  K+AIM R  +  RDLRILDPLLSYPST+
Sbjct  13   PQTMAVVKKKTQSSRSWILFDATGQGSLLDVDKYAIMHRVHIHARDLRILDPLLSYPSTI  72

Query  333  LGRERAIVINLEHIKAIITAQXVLL  407
            LGRE+AIV+NLEHIKAIITA+ VLL
Sbjct  73   LGREKAIVLNLEHIKAIITAEEVLL  97



>ref|XP_009761375.1| PREDICTED: magnesium transporter MRS2-1-like [Nicotiana sylvestris]
Length=214

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +D++G +QV+E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGLRSWIRVDTSGNSQVIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  101  AIVVNLEQIRCIITADEVLL  120



>gb|KDP21359.1| hypothetical protein JCGZ_21830 [Jatropha curcas]
Length=391

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            + L+KK +   SW+LLD +GQ  +++  K+AIMRR  +  RDLRILDPLLSYPST+LGRE
Sbjct  14   ASLKKKTAVSTSWILLDQSGQGAIIDVDKYAIMRRVQIHARDLRILDPLLSYPSTILGRE  73

Query  345  RAIVINLEHIKAIITAQXVLL  407
            R IV+NLEHIKAIITA+ VLL
Sbjct  74   RVIVLNLEHIKAIITAEEVLL  94



>ref|XP_008353611.1| PREDICTED: LOW QUALITY PROTEIN: protein GAMETE EXPRESSED 1-like 
[Malus domestica]
Length=710

 Score =   114 bits (286),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 73/105 (70%), Gaps = 9/105 (9%)
 Frame = +3

Query  78   MMRGPPP----TKVNAAPAVDD-DGHNAAVPGIG----SGLRKKASGVRSWLLLDSTGQA  230
            +MR P P    +K + APA DD D     +PG+G     GL KK   V+ WLLL+S+GQA
Sbjct  605  VMRTPHPNHHPSKSSTAPAKDDSDSTRPTMPGLGVSVADGLLKKGVCVKPWLLLNSSGQA  664

Query  231  QVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINL  365
            QV++A KH IMR TGLP RD +ILDPLLSYPSTVLG+ERAIV+  
Sbjct  665  QVIKADKHTIMRXTGLPARDHQILDPLLSYPSTVLGQERAIVLEF  709



>ref|XP_006368495.1| hypothetical protein POPTR_0001s03480g [Populus trichocarpa]
 gb|ERP65064.1| hypothetical protein POPTR_0001s03480g [Populus trichocarpa]
Length=374

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +DS+G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGLRSWIRVDSSGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  101  AIVVNLEQIRCIITADEVLL  120



>ref|XP_010274193.1| PREDICTED: magnesium transporter MRS2-2-like isoform X2 [Nelumbo 
nucifera]
Length=365

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            + L+KK +  RSW+LLD TG+  +++  K+AIM R  +  RDLRILDPLLSYPST+LGRE
Sbjct  14   ASLKKKTAVSRSWILLDCTGEGTILDVDKYAIMHRVQIHARDLRILDPLLSYPSTILGRE  73

Query  345  RAIVINLEHIKAIITAQXVLL  407
            +AIV+NLEHIKAIITA+ VLL
Sbjct  74   KAIVLNLEHIKAIITAEEVLL  94



>ref|XP_010274191.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010274192.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Nelumbo 
nucifera]
Length=391

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            + L+KK +  RSW+LLD TG+  +++  K+AIM R  +  RDLRILDPLLSYPST+LGRE
Sbjct  14   ASLKKKTAVSRSWILLDCTGEGTILDVDKYAIMHRVQIHARDLRILDPLLSYPSTILGRE  73

Query  345  RAIVINLEHIKAIITAQXVLL  407
            +AIV+NLEHIKAIITA+ VLL
Sbjct  74   KAIVLNLEHIKAIITAEEVLL  94



>ref|XP_010927960.1| PREDICTED: magnesium transporter MRS2-1-like [Elaeis guineensis]
Length=438

 Score =   112 bits (280),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 56/104 (54%), Positives = 70/104 (67%), Gaps = 4/104 (4%)
 Frame = +3

Query  108  NAAPAVDDDGHNAAVPGIGS----GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTG  275
            ++ PA    GH    P        GL+K+  G+RSW+ +DSTG  QV+E  K  IMRR  
Sbjct  30   SSVPAGGGSGHAGRRPVFQGMDFVGLKKRGQGLRSWIRVDSTGNHQVIEVDKFTIMRRCD  89

Query  276  LPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            LP RDLR+LDPL  YPST+LGRE+AIV+NLE I+ IITA+ VLL
Sbjct  90   LPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITAEEVLL  133



>gb|KJB72316.1| hypothetical protein B456_011G170800 [Gossypium raimondii]
Length=326

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +3

Query  147  AVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPS  326
            A P     ++KKA   RSW+LLDSTG+  V++  K+AIM R  +  RDLRILDPLLSYPS
Sbjct  7    ADPQAVVAVKKKAQSSRSWVLLDSTGETTVLDVDKYAIMHRVNIHARDLRILDPLLSYPS  66

Query  327  TVLGRERAIVINLEHIKAIITAQXVLL  407
            T+LGR+ AIV+NLEHIKAIIT++ VLL
Sbjct  67   TILGRDGAIVLNLEHIKAIITSEEVLL  93



>ref|XP_002315734.1| magnesium transporter CorA-like family protein [Populus trichocarpa]
 gb|EEF01905.1| magnesium transporter CorA-like family protein [Populus trichocarpa]
Length=398

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            + ++KK    RSW+L+D+TGQ  +++A KHAIM R  +  RDLRILDPLLSYPST+LGRE
Sbjct  16   TSVKKKTQPARSWILVDATGQGTILDADKHAIMNRVQIHARDLRILDPLLSYPSTILGRE  75

Query  345  RAIVINLEHIKAIITAQXVLL  407
             AIV+NLEHIKAIIT++ VLL
Sbjct  76   GAIVLNLEHIKAIITSEEVLL  96



>emb|CDO98239.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   112 bits (279),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 57/111 (51%), Positives = 75/111 (68%), Gaps = 6/111 (5%)
 Frame = +3

Query  93   PPTKVNAAPAVDDDGHNAA-----VPGIGS-GLRKKASGVRSWLLLDSTGQAQVVEAGKH  254
            PP   +AA   D     +A      PG+   GL+K+  G+RSW+ +DS+G +QV+E  K 
Sbjct  10   PPKPASAANLRDVSYRPSASGRPPFPGVDVLGLKKRGQGLRSWIRVDSSGNSQVIEVDKF  69

Query  255  AIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            ++MRR  LP RDLR+LDPL  YPST+LGRE+AIV+NLE I+ IITA  VLL
Sbjct  70   SMMRRCDLPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITADEVLL  120



>gb|KHN05058.1| Magnesium transporter MRS2-I [Glycine soja]
Length=394

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERA  350
            ++KK    RSW+L D+TGQ  +++  K+AIM R  +  RDLRILDPLLSYPST+LGRE+A
Sbjct  18   VKKKTQSSRSWILFDATGQGSLLDVDKYAIMHRVHIHARDLRILDPLLSYPSTILGREKA  77

Query  351  IVINLEHIKAIITAQXVLL  407
            IV+NLEHIKAIITA+ VLL
Sbjct  78   IVLNLEHIKAIITAEEVLL  96



>gb|KJB35251.1| hypothetical protein B456_006G106900 [Gossypium raimondii]
 gb|KJB35252.1| hypothetical protein B456_006G106900 [Gossypium raimondii]
 gb|KJB35253.1| hypothetical protein B456_006G106900 [Gossypium raimondii]
 gb|KJB35254.1| hypothetical protein B456_006G106900 [Gossypium raimondii]
 gb|KJB35255.1| hypothetical protein B456_006G106900 [Gossypium raimondii]
Length=437

 Score =   112 bits (279),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            SGL+K+  G+RSW+ +D++G +QV+E  K  +MRR  LP RDLR+LDPL  YPST+LGRE
Sbjct  40   SGLKKRGQGLRSWIRVDTSGNSQVIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGRE  99

Query  345  RAIVINLEHIKAIITAQXVLL  407
            +AIV+NLE I+ IITA  VLL
Sbjct  100  KAIVVNLEQIRCIITADEVLL  120



>emb|CAN67333.1| hypothetical protein VITISV_024485 [Vitis vinifera]
Length=221

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +3

Query  150  VPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPST  329
            VP       KK +  R+W+++D +G+  V++  K+AIM R  +  RDLRILDPLLSYPST
Sbjct  8    VPADPQAAMKKKTASRNWIMMDCSGEKTVLDLDKYAIMHRVQIHARDLRILDPLLSYPST  67

Query  330  VLGRERAIVINLEHIKAIITAQXVLL  407
            +LGRERAIV+NLEHIKAIITA+ VLL
Sbjct  68   ILGRERAIVLNLEHIKAIITAEEVLL  93



>ref|NP_001240913.1| uncharacterized protein LOC100786817 [Glycine max]
 gb|ACU21339.1| unknown [Glycine max]
 gb|KHN30564.1| Magnesium transporter MRS2-2 [Glycine soja]
Length=390

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +3

Query  147  AVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPS  326
            A P   + ++KK    RSW+L D+TGQ  +++  K+AIM R  +  RDLRILDPLLSYPS
Sbjct  10   ADPQAMAVVKKKTQSSRSWILFDATGQGTLLDMDKYAIMHRVQIHARDLRILDPLLSYPS  69

Query  327  TVLGRERAIVINLEHIKAIITAQXVLL  407
            T+LGRE+AIV+NLEHIKAIITA+ VLL
Sbjct  70   TILGREKAIVLNLEHIKAIITAEEVLL  96



>ref|XP_006356054.1| PREDICTED: magnesium transporter MRS2-I-like isoform X2 [Solanum 
tuberosum]
Length=344

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+KK +G RSWLL+D++G   V++  K+ IM R  +  RDLRI+DPLLSYPS +LGRER
Sbjct  23   GLKKKGAGARSWLLMDASGLETVLDVDKYEIMHRVQIHARDLRIIDPLLSYPSAILGRER  82

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLEHIKAIIT++ VLL
Sbjct  83   AIVLNLEHIKAIITSEEVLL  102



>emb|CBI17946.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +3

Query  150  VPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPST  329
            VPG      KK + V SW+L++  G++ +++  K+ IMRR  +  RDLRILDPLLSYPST
Sbjct  8    VPGDIQLASKKKTAVSSWVLMNDNGESTILDVDKYVIMRRVHIHARDLRILDPLLSYPST  67

Query  330  VLGRERAIVINLEHIKAIITAQXVLL  407
            +LGRERAIV+NLEHIKAIITA  VLL
Sbjct  68   ILGRERAIVLNLEHIKAIITADEVLL  93



>gb|KDP41956.1| hypothetical protein JCGZ_26974 [Jatropha curcas]
Length=443

 Score =   111 bits (278),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +DSTG +QV+E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGLRSWIRVDSTGNSQVIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  101  AIVVNLEQIRCIITADEVLL  120



>ref|XP_011029888.1| PREDICTED: magnesium transporter MRS2-2 [Populus euphratica]
Length=394

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            + ++KK    RSW+L+D+TGQ  +++A KHAIM R  +  RDLRILDPLLSYPST+LGRE
Sbjct  16   AAVKKKTQPARSWILVDATGQGTILDADKHAIMNRVQIHARDLRILDPLLSYPSTILGRE  75

Query  345  RAIVINLEHIKAIITAQXVLL  407
             AIV+NLEHIKAIIT++ VLL
Sbjct  76   GAIVLNLEHIKAIITSEEVLL  96



>ref|XP_011073319.1| PREDICTED: magnesium transporter MRS2-1-like [Sesamum indicum]
Length=444

 Score =   111 bits (278),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 55/111 (50%), Positives = 74/111 (67%), Gaps = 7/111 (6%)
 Frame = +3

Query  96   PTKVNAAPAVDDDGHNAAVPGI-------GSGLRKKASGVRSWLLLDSTGQAQVVEAGKH  254
            P K ++A  + D  + A+  G         SGL+K+  G+RSW+ +D +G +QV+E  K 
Sbjct  10   PPKPSSAVNLRDSSYRASASGRLPFQGVDVSGLKKRGQGLRSWIRVDVSGNSQVIEVDKF  69

Query  255  AIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
             +MRR  LP RDLR+LDPL  YPST+LGRE+AIV+NLE I+ IITA  VLL
Sbjct  70   TMMRRCDLPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITADEVLL  120



>emb|CDM85537.1| unnamed protein product [Triticum aestivum]
Length=449

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  195  RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHI  374
            R WL++ ++G+A+V EAGKHA+M RTGLP RDLR+LDPLLSYPST+LGRERAIV+NLE +
Sbjct  28   REWLVVPASGRARVEEAGKHAVMARTGLPARDLRVLDPLLSYPSTILGRERAIVVNLERV  87

Query  375  KAIITAQXVLL  407
            KA+ITA  VLL
Sbjct  88   KAVITAAEVLL  98



>ref|XP_010278149.1| PREDICTED: magnesium transporter MRS2-I-like [Nelumbo nucifera]
 ref|XP_010278150.1| PREDICTED: magnesium transporter MRS2-I-like [Nelumbo nucifera]
Length=391

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            + L+KK +  RSW+LLD TG+  +++  K+AIM R  +  RDLRILDPLLSYPST+LGRE
Sbjct  14   AALKKKTAVSRSWILLDCTGEGTILDVDKYAIMHRVQIHARDLRILDPLLSYPSTILGRE  73

Query  345  RAIVINLEHIKAIITAQXVLL  407
            +AIV+NLEHIKAIITA+ V L
Sbjct  74   KAIVLNLEHIKAIITAEEVFL  94



>gb|KJB72318.1| hypothetical protein B456_011G170800 [Gossypium raimondii]
Length=385

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
             ++KKA   RSW+LLDSTG+  V++  K+AIM R  +  RDLRILDPLLSYPST+LGR+ 
Sbjct  14   AVKKKAQSSRSWVLLDSTGETTVLDVDKYAIMHRVNIHARDLRILDPLLSYPSTILGRDG  73

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLEHIKAIIT++ VLL
Sbjct  74   AIVLNLEHIKAIITSEEVLL  93



>gb|KDO55344.1| hypothetical protein CISIN_1g013533mg [Citrus sinensis]
Length=399

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +D +G +Q++E  K ++MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGLRSWIRVDVSGNSQIIEVDKFSMMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  101  AIVVNLEQIRCIITADEVLL  120



>ref|XP_002263392.1| PREDICTED: magnesium transporter MRS2-1-like [Vitis vinifera]
Length=444

 Score =   111 bits (278),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  GVRSW+ +D++G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGVRSWIRVDASGNSQIIEVDKFTVMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  101  AIVVNLEQIRCIITADEVLL  120



>ref|XP_010670835.1| PREDICTED: magnesium transporter MRS2-I-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010670836.1| PREDICTED: magnesium transporter MRS2-I-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010670837.1| PREDICTED: magnesium transporter MRS2-I-like [Beta vulgaris subsp. 
vulgaris]
Length=392

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +3

Query  156  GIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVL  335
            G+  G++KK  G R+W+LLD  GQ  V++  K+AIM R  +  RDLRILDPLLSYPST+L
Sbjct  15   GLSVGVKKKPVGSRNWVLLDLLGQGTVLDLDKYAIMHRVHIHARDLRILDPLLSYPSTIL  74

Query  336  GRERAIVINLEHIKAIITAQXVLL  407
            GRE+AIV+NLEHIKAIITA  VLL
Sbjct  75   GREKAIVLNLEHIKAIITADEVLL  98



>ref|XP_010260014.1| PREDICTED: magnesium transporter MRS2-5 [Nelumbo nucifera]
 ref|XP_010260022.1| PREDICTED: magnesium transporter MRS2-5 [Nelumbo nucifera]
Length=421

 Score =   111 bits (277),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 54/108 (50%), Positives = 74/108 (69%), Gaps = 2/108 (2%)
 Frame = +3

Query  90   PPPTKVNAAPAVDDDGH-NAAVPGIG-SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIM  263
            P P   + A  ++ DG  N+   G G SGL+K+  G RSW+ +D  G +++++  K  IM
Sbjct  14   PLPVSSHNAARLNTDGSVNSFSKGFGLSGLKKRGHGSRSWIRIDRNGNSKILDLDKTTIM  73

Query  264  RRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            RR  LPGRDLR+LDPL  YPST+LGRE+AIV++LE I+ IITA  V+L
Sbjct  74   RRCSLPGRDLRLLDPLFIYPSTILGREKAIVVSLEQIRCIITADEVIL  121



>ref|XP_008788159.1| PREDICTED: magnesium transporter MRS2-I-like [Phoenix dactylifera]
Length=381

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            +K AS  RSW+LLDSTG+ ++++  K+AIM R  +  RDLRI+DPLLSYPS +L RERAI
Sbjct  18   KKAASSTRSWILLDSTGKEKILDVDKYAIMHRVQIDARDLRIIDPLLSYPSAILVRERAI  77

Query  354  VINLEHIKAIITAQXVLL  407
            V+NLEHIKAIITA+ VLL
Sbjct  78   VLNLEHIKAIITAEEVLL  95



>ref|XP_006356053.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Solanum 
tuberosum]
Length=398

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+KK +G RSWLL+D++G   V++  K+ IM R  +  RDLRI+DPLLSYPS +LGRER
Sbjct  23   GLKKKGAGARSWLLMDASGLETVLDVDKYEIMHRVQIHARDLRIIDPLLSYPSAILGRER  82

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLEHIKAIIT++ VLL
Sbjct  83   AIVLNLEHIKAIITSEEVLL  102



>ref|XP_002311660.1| magnesium transporter CorA-like family protein [Populus trichocarpa]
 gb|EEE89027.1| magnesium transporter CorA-like family protein [Populus trichocarpa]
Length=394

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            + ++KK    RSW+L+D+TGQ  +++A KHAIM R  +  RDLRILDPLLSYPST+LGRE
Sbjct  16   AAVKKKTHPARSWILVDATGQGTILDADKHAIMNRVQIHARDLRILDPLLSYPSTILGRE  75

Query  345  RAIVINLEHIKAIITAQXVLL  407
             AIV+NLEHIKAIIT++ VLL
Sbjct  76   GAIVLNLEHIKAIITSEEVLL  96



>gb|KHG22959.1| Magnesium transporter MRS2-I [Gossypium arboreum]
Length=401

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
             ++KKA   RSW+LLDSTG+  V++  K+AIM R  +  RDLRILDPLLSYPST+LGR+ 
Sbjct  14   AVKKKAQSSRSWVLLDSTGETTVLDVDKYAIMHRVNIHARDLRILDPLLSYPSTILGRDG  73

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLEHIKAIIT++ VLL
Sbjct  74   AIVLNLEHIKAIITSEEVLL  93



>ref|XP_007023463.1| Magnesium transporter isoform 3 [Theobroma cacao]
 gb|EOY26085.1| Magnesium transporter isoform 3 [Theobroma cacao]
Length=405

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +D++G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  5    GLKKRGQGLRSWIRVDTSGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  64

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  65   AIVVNLEQIRCIITADEVLL  84



>emb|CAN71705.1| hypothetical protein VITISV_001335 [Vitis vinifera]
Length=559

 Score =   112 bits (280),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  GVRSW+ +D++G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGVRSWIRVDASGNSQIIEVDKFTVMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  101  AIVVNLEQIRCIITADEVLL  120



>ref|XP_010917591.1| PREDICTED: magnesium transporter MRS2-I-like [Elaeis guineensis]
 ref|XP_010917592.1| PREDICTED: magnesium transporter MRS2-I-like [Elaeis guineensis]
Length=391

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            S L+KK +   SW+LLD TG+  +++  K+AIM R  +  RDLRILDPLLSYPST+LGRE
Sbjct  15   SALKKKTAVSGSWMLLDCTGKGTILDVDKYAIMHRAQIHARDLRILDPLLSYPSTILGRE  74

Query  345  RAIVINLEHIKAIITAQXVLL  407
            RAIV+NLEHIKAIITA+ VLL
Sbjct  75   RAIVLNLEHIKAIITAEEVLL  95



>ref|XP_007023462.1| Magnesium transporter 2 isoform 2 [Theobroma cacao]
 gb|EOY26084.1| Magnesium transporter 2 isoform 2 [Theobroma cacao]
Length=331

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +D++G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGLRSWIRVDTSGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  101  AIVVNLEQIRCIITADEVLL  120



>ref|XP_004234030.1| PREDICTED: magnesium transporter MRS2-I [Solanum lycopersicum]
Length=399

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+KK +G RSWLL+D++G   V++  K+ IM R  +  RDLRI+DPLLSYPS +LGRER
Sbjct  24   GLKKKGAGARSWLLMDASGLETVLDVDKYEIMHRVQIHARDLRIIDPLLSYPSAILGRER  83

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLEHIKAIIT++ VLL
Sbjct  84   AIVLNLEHIKAIITSEEVLL  103



>dbj|BAK02642.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  195  RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHI  374
            R WL++ ++G+A++ EAGKHA+M RTGLP RDLR+LDPLLSYPST+LGRERAIV+NLE +
Sbjct  28   REWLVVPASGRARIEEAGKHAVMARTGLPARDLRVLDPLLSYPSTILGRERAIVVNLERV  87

Query  375  KAIITAQXVLL  407
            KA+ITA  VLL
Sbjct  88   KAVITAAEVLL  98



>ref|XP_001765484.1| predicted protein [Physcomitrella patens]
 gb|EDQ69745.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERA  350
            L KK    ++W++LD+ G+ +V+E  K+AIM R G+  RDLRILDPLLSYPST+LGRERA
Sbjct  11   LAKKKQASKTWMVLDNEGEKRVLEVDKYAIMHRVGIHARDLRILDPLLSYPSTILGRERA  70

Query  351  IVINLEHIKAIITAQXVLL  407
            IV+NLEHIKAIITA  V L
Sbjct  71   IVLNLEHIKAIITADEVFL  89



>sp|B8AJT9.1|MRS2I_ORYSI RecName: Full=Magnesium transporter MRS2-I [Oryza sativa Indica 
Group]
 gb|EEC76157.1| hypothetical protein OsI_13458 [Oryza sativa Indica Group]
Length=381

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            KK    RSW+L D+ G+ +V++A K+AIM R  +  RDLRILDPLLSYPST+LGRERAIV
Sbjct  20   KKRGASRSWILFDAAGEERVLDADKYAIMHRVDINARDLRILDPLLSYPSTILGRERAIV  79

Query  357  INLEHIKAIITAQXVLL  407
            +NLEHIKAIITA+ VLL
Sbjct  80   LNLEHIKAIITAEEVLL  96



>sp|Q10D38.1|MRS2I_ORYSJ RecName: Full=Magnesium transporter MRS2-I [Oryza sativa Japonica 
Group]
 gb|ABF98804.1| magnesium transporter CorA-like family protein, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EEE59906.1| hypothetical protein OsJ_12521 [Oryza sativa Japonica Group]
Length=384

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            KK    RSW+L D+ G+ +V++A K+AIM R  +  RDLRILDPLLSYPST+LGRERAIV
Sbjct  23   KKRGASRSWILFDAAGEERVLDADKYAIMHRVDINARDLRILDPLLSYPSTILGRERAIV  82

Query  357  INLEHIKAIITAQXVLL  407
            +NLEHIKAIITA+ VLL
Sbjct  83   LNLEHIKAIITAEEVLL  99



>gb|KJB66344.1| hypothetical protein B456_010G136800 [Gossypium raimondii]
Length=442

 Score =   110 bits (276),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            SGL+K+  G+RSW+ +D++G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE
Sbjct  40   SGLKKRGQGLRSWIRVDTSGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGRE  99

Query  345  RAIVINLEHIKAIITAQXVLL  407
            +AIV+NLE I+ IITA  VLL
Sbjct  100  KAIVVNLEQIRCIITADEVLL  120



>ref|XP_002310546.2| hypothetical protein POPTR_0007s04910g [Populus trichocarpa]
 gb|EEE90996.2| hypothetical protein POPTR_0007s04910g [Populus trichocarpa]
Length=419

 Score =   110 bits (275),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  159  IGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLG  338
            + + L+K    V++WL++  +GQ+ + E GKH++M+R+GLP RDLR LDP+LSYPS++LG
Sbjct  1    MATKLKKGMPVVKAWLVISESGQSSIEEIGKHSMMKRSGLPARDLRALDPVLSYPSSILG  60

Query  339  RERAIVINLEHIKAIITAQXVLL  407
            RERAIV++LEHI+AIIT++ VLL
Sbjct  61   RERAIVVSLEHIRAIITSKEVLL  83



>ref|XP_010537853.1| PREDICTED: magnesium transporter MRS2-1-like [Tarenaya hassleriana]
Length=429

 Score =   110 bits (275),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            SGL+K+  G+RSW+ +D+ G  QV+E  K  +MRR  LP RDLR+LDPL  YPST+LGRE
Sbjct  40   SGLKKRGQGLRSWIRVDTLGDTQVIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGRE  99

Query  345  RAIVINLEHIKAIITAQXVLL  407
            +AIV+NLE I+ IITA  VLL
Sbjct  100  KAIVVNLEQIRCIITADEVLL  120



>ref|XP_006385933.1| hypothetical protein POPTR_0003s18180g [Populus trichocarpa]
 gb|ERP63730.1| hypothetical protein POPTR_0003s18180g [Populus trichocarpa]
Length=385

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +DS+G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGLRSWIRVDSSGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV NLE I+ IITA  VLL
Sbjct  101  AIVANLEQIRCIITADEVLL  120



>ref|XP_008465136.1| PREDICTED: magnesium transporter MRS2-1 [Cucumis melo]
Length=447

 Score =   110 bits (275),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 54/109 (50%), Positives = 75/109 (69%), Gaps = 4/109 (4%)
 Frame = +3

Query  93   PPTKVNAAPAVDD-DGHNAAVPGIGS---GLRKKASGVRSWLLLDSTGQAQVVEAGKHAI  260
            P + +N   A+++    +  VP  G    GL+K+  G+RSW+ +DS+G +Q++E  K  +
Sbjct  13   PSSAINLREAINNRPSASGRVPFQGVDVLGLKKRGQGLRSWIRVDSSGNSQIIEVDKFTM  72

Query  261  MRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            MRR  LP RDLR+LDPL  YPST+LGRE+AIV+NLE I+ IITA  VLL
Sbjct  73   MRRCDLPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITADEVLL  121



>ref|XP_004160340.1| PREDICTED: magnesium transporter MRS2-1-like [Cucumis sativus]
Length=447

 Score =   110 bits (275),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 54/109 (50%), Positives = 75/109 (69%), Gaps = 4/109 (4%)
 Frame = +3

Query  93   PPTKVNAAPAVDD-DGHNAAVPGIGS---GLRKKASGVRSWLLLDSTGQAQVVEAGKHAI  260
            P + +N   A+++    +  VP  G    GL+K+  G+RSW+ +DS+G +Q++E  K  +
Sbjct  13   PASAINLREAINNRPSASGRVPFQGVDVLGLKKRGQGLRSWIRVDSSGNSQIIEVDKFTM  72

Query  261  MRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            MRR  LP RDLR+LDPL  YPST+LGRE+AIV+NLE I+ IITA  VLL
Sbjct  73   MRRCDLPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITADEVLL  121



>ref|XP_004137654.1| PREDICTED: magnesium transporter MRS2-1-like [Cucumis sativus]
 gb|KGN58653.1| hypothetical protein Csa_3G710800 [Cucumis sativus]
Length=447

 Score =   110 bits (275),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 54/109 (50%), Positives = 75/109 (69%), Gaps = 4/109 (4%)
 Frame = +3

Query  93   PPTKVNAAPAVDD-DGHNAAVPGIGS---GLRKKASGVRSWLLLDSTGQAQVVEAGKHAI  260
            P + +N   A+++    +  VP  G    GL+K+  G+RSW+ +DS+G +Q++E  K  +
Sbjct  13   PASAINLREAINNRPSASGRVPFQGVDVLGLKKRGQGLRSWIRVDSSGNSQIIEVDKFTM  72

Query  261  MRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            MRR  LP RDLR+LDPL  YPST+LGRE+AIV+NLE I+ IITA  VLL
Sbjct  73   MRRCDLPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITADEVLL  121



>emb|CDO99157.1| unnamed protein product [Coffea canephora]
Length=395

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL KKA+G  SW+L++++GQ  V++  K++IM R  +  RDLRILDPLLSYPST+LGRE+
Sbjct  21   GLIKKAAGSWSWMLINASGQEMVLDVDKYSIMHRVQIHARDLRILDPLLSYPSTILGREK  80

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLEHIKAIITA+ +LL
Sbjct  81   AIVLNLEHIKAIITAEEILL  100



>emb|CDX88569.1| BnaC06g40130D [Brassica napus]
Length=410

 Score =   110 bits (274),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 52/106 (49%), Positives = 70/106 (66%), Gaps = 0/106 (0%)
 Frame = +3

Query  90   PPPTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRR  269
            PPP + ++       G    +    SGL+K+  G++SW+ +D+    QV+E  K ++MRR
Sbjct  10   PPPLRGDSFSRPSSSGRQPLLGLDVSGLKKRGQGLKSWIRVDAFANTQVIEVDKFSMMRR  69

Query  270  TGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
              LP RDLR+LDPL  YPST+LGRERAIV+NLE I+ IITA  VLL
Sbjct  70   CDLPARDLRLLDPLFVYPSTILGRERAIVVNLEQIRCIITADEVLL  115



>ref|XP_009348287.1| PREDICTED: magnesium transporter MRS2-2-like [Pyrus x bretschneideri]
Length=392

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 2/85 (2%)
 Frame = +3

Query  153  PGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTV  332
            P     ++KK+S  RSW+LLD TG+A V++  K+AIM R  +  RDLRI+DPLLSYPST+
Sbjct  12   PQSAVAVKKKSS--RSWVLLDCTGKATVLDVDKYAIMHRVHIHARDLRIVDPLLSYPSTI  69

Query  333  LGRERAIVINLEHIKAIITAQXVLL  407
            LGR+RAIV+NLEHIKAIITA+ VLL
Sbjct  70   LGRDRAIVLNLEHIKAIITAEEVLL  94



>ref|XP_010069167.1| PREDICTED: magnesium transporter MRS2-I-like [Eucalyptus grandis]
 gb|KCW57431.1| hypothetical protein EUGRSUZ_H00212 [Eucalyptus grandis]
Length=413

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +3

Query  174  RKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAI  353
            +KK    RSW+LLD+ GQ  V++  K+AIM R  +  RDLRILDPLLSYPST+LGRERAI
Sbjct  39   KKKGQPPRSWILLDTAGQGTVLDVDKYAIMHRVQIHARDLRILDPLLSYPSTILGRERAI  98

Query  354  VINLEHIKAIITAQXVLL  407
            V+NLEHIKAIITA+ VLL
Sbjct  99   VLNLEHIKAIITAEEVLL  116



>ref|XP_004981821.1| PREDICTED: magnesium transporter MRS2-I-like [Setaria italica]
Length=386

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  KKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIV  356
            KK    RSW+L D+ G+ +V++A K+AIM R  +  RDLRILDPLLSYPST+LGRERAIV
Sbjct  15   KKRGASRSWILFDAAGEERVLDADKYAIMHRVDINARDLRILDPLLSYPSTILGRERAIV  74

Query  357  INLEHIKAIITAQXVLL  407
            +NLEHIKAIIT++ VLL
Sbjct  75   LNLEHIKAIITSEEVLL  91



>ref|NP_001142108.1| hypothetical protein [Zea mays]
 gb|ACF87654.1| unknown [Zea mays]
 gb|ACN35773.1| unknown [Zea mays]
 gb|AFW84240.1| hypothetical protein ZEAMMB73_119664 [Zea mays]
Length=443

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  195  RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHI  374
            R WL++ ++G A+V EAGKHA+M RTGLP RDLR+LDPLLSYPST+LGRERAIV+NLE +
Sbjct  27   REWLVVPASGPARVEEAGKHAVMARTGLPARDLRVLDPLLSYPSTILGRERAIVVNLERV  86

Query  375  KAIITAQXVLL  407
            KA+ITA  VLL
Sbjct  87   KALITAAEVLL  97



>ref|XP_006368496.1| magnesium transporter CorA-like family protein [Populus trichocarpa]
 gb|ERP65065.1| magnesium transporter CorA-like family protein [Populus trichocarpa]
Length=443

 Score =   110 bits (274),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +DS+G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGLRSWIRVDSSGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  101  AIVVNLEQIRCIITADEVLL  120



>ref|XP_004513485.1| PREDICTED: magnesium transporter MRS2-2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004513486.1| PREDICTED: magnesium transporter MRS2-2-like isoform X2 [Cicer 
arietinum]
 ref|XP_004513487.1| PREDICTED: magnesium transporter MRS2-2-like isoform X3 [Cicer 
arietinum]
Length=393

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERA  350
            ++KK    RSW+L+D+ GQ  +++  K+AIM R  +  RDLRILDPLLSYPST+LGRE+A
Sbjct  18   VKKKTQTSRSWILIDAMGQGSMLDVDKYAIMHRVQINARDLRILDPLLSYPSTILGREKA  77

Query  351  IVINLEHIKAIITAQXVLL  407
            IV+NLEHIKAIITA+ VLL
Sbjct  78   IVLNLEHIKAIITAEEVLL  96



>ref|XP_010674588.1| PREDICTED: magnesium transporter MRS2-F-like [Beta vulgaris subsp. 
vulgaris]
Length=452

 Score =   110 bits (274),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/99 (56%), Positives = 65/99 (66%), Gaps = 7/99 (7%)
 Frame = +3

Query  111  AAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRD  290
             AP      HN A        R++  G R WL++  TG   + E  KH IMRRTGLP RD
Sbjct  8    GAPKTTPYHHNQA-------RRRQGIGTRVWLVVTDTGDCHLNEVPKHQIMRRTGLPARD  60

Query  291  LRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
            LR LDP+LSYPS++ GRERAIV+NLEHIKAIITA  VL+
Sbjct  61   LRALDPVLSYPSSIFGRERAIVVNLEHIKAIITATEVLM  99



>ref|XP_011034561.1| PREDICTED: magnesium transporter MRS2-1 isoform X2 [Populus euphratica]
 ref|XP_011034562.1| PREDICTED: magnesium transporter MRS2-1 isoform X2 [Populus euphratica]
Length=443

 Score =   110 bits (274),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +DS+G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGLRSWIRVDSSGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  101  AIVVNLEQIRCIITADEVLL  120



>ref|XP_004514761.1| PREDICTED: magnesium transporter MRS2-2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004514762.1| PREDICTED: magnesium transporter MRS2-2-like isoform X2 [Cicer 
arietinum]
 ref|XP_004514763.1| PREDICTED: magnesium transporter MRS2-2-like isoform X3 [Cicer 
arietinum]
 ref|XP_004514764.1| PREDICTED: magnesium transporter MRS2-2-like isoform X4 [Cicer 
arietinum]
Length=393

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERA  350
            ++KK    RSW+L+D+ GQ  +++  K+AIM R  +  RDLRILDPLLSYPST+LGRE+A
Sbjct  18   VKKKTQTSRSWILIDAMGQGSMLDVDKYAIMHRVQINARDLRILDPLLSYPSTILGREKA  77

Query  351  IVINLEHIKAIITAQXVLL  407
            IV+NLEHIKAIITA+ VLL
Sbjct  78   IVLNLEHIKAIITAEEVLL  96



>ref|XP_004495389.1| PREDICTED: magnesium transporter MRS2-2-like isoform X4 [Cicer 
arietinum]
Length=390

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERA  350
            ++KK    RSW+L+D+ GQ  +++  K+AIM R  +  RDLRILDPLLSYPST+LGRE+A
Sbjct  18   VKKKTQTSRSWILIDAMGQGSMLDVDKYAIMHRVQINARDLRILDPLLSYPSTILGREKA  77

Query  351  IVINLEHIKAIITAQXVLL  407
            IV+NLEHIKAIITA+ VLL
Sbjct  78   IVLNLEHIKAIITAEEVLL  96



>gb|EYU21742.1| hypothetical protein MIMGU_mgv1a006408mg [Erythranthe guttata]
Length=445

 Score =   110 bits (274),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            SGL+K+  G+RSW+ +D +G +QV+E  K  +MRR  LP RDLR+LDPL  YPST+LGRE
Sbjct  40   SGLKKRGQGLRSWIRVDVSGNSQVIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGRE  99

Query  345  RAIVINLEHIKAIITAQXVLL  407
            +AIV+NLE I+ IITA  VLL
Sbjct  100  KAIVVNLEQIRCIITADEVLL  120



>ref|XP_010539542.1| PREDICTED: magnesium transporter MRS2-1 [Tarenaya hassleriana]
Length=442

 Score =   110 bits (274),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +D++G  QV+E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGLRSWIRVDTSGNTQVIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  101  AIVVNLEQIRCIITADEVLL  120



>ref|XP_008224183.1| PREDICTED: LOW QUALITY PROTEIN: magnesium transporter MRS2-2-like 
[Prunus mume]
Length=382

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
             ++KK+S  RSW+LLD TG+A V++  K+AIM R  +  RDLRI+DPLLSYPST+LGR+R
Sbjct  17   AVKKKSS--RSWVLLDCTGKATVLDVDKYAIMHRVHIHARDLRIVDPLLSYPSTILGRDR  74

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLEHIKAIITA+ VLL
Sbjct  75   AIVLNLEHIKAIITAEEVLL  94



>ref|XP_011034560.1| PREDICTED: magnesium transporter MRS2-1 isoform X1 [Populus euphratica]
Length=452

 Score =   110 bits (274),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +DS+G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  50   GLKKRGQGLRSWIRVDSSGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  109

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  110  AIVVNLEQIRCIITADEVLL  129



>gb|KHN22419.1| Magnesium transporter MRS2-F [Glycine soja]
Length=400

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 67/82 (82%), Gaps = 3/82 (4%)
 Frame = +3

Query  171  LRKKASG---VRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGR  341
            +R+K  G   V+SW+++  TG +++ + GKH+IMRRTGLP RD R+LDP+LSYPS++LGR
Sbjct  1    MRRKGVGTTAVKSWMVVSETGHSRLEDVGKHSIMRRTGLPARDPRVLDPVLSYPSSILGR  60

Query  342  ERAIVINLEHIKAIITAQXVLL  407
            ERAIV+N EH+KAIITA  +LL
Sbjct  61   ERAIVVNFEHVKAIITASELLL  82



>emb|CDY22292.1| BnaC02g25960D [Brassica napus]
Length=405

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            SGL+K+  G++SW+ +D+    QV+E  K ++MRR  LP RDLR+LDPL  YPST+LGRE
Sbjct  41   SGLKKRGQGLKSWIRVDTFANTQVIEVDKFSMMRRCDLPARDLRLLDPLFVYPSTILGRE  100

Query  345  RAIVINLEHIKAIITAQXVLL  407
            RAIV+NLE I+ IITA  VLL
Sbjct  101  RAIVVNLEQIRCIITADEVLL  121



>ref|XP_004970981.1| PREDICTED: magnesium transporter MRS2-F-like [Setaria italica]
Length=442

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  195  RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHI  374
            R W+++ ++G A+V EAGKHA+M RTGLP RDLR+LDPLLSYPST++GRERAIV+NLE +
Sbjct  26   REWMVVPASGPARVEEAGKHAVMARTGLPARDLRVLDPLLSYPSTIMGRERAIVVNLERV  85

Query  375  KAIITAQXVLL  407
            KA+ITA  VLL
Sbjct  86   KAVITAAEVLL  96



>ref|XP_010273633.1| PREDICTED: magnesium transporter MRS2-1-like [Nelumbo nucifera]
Length=443

 Score =   109 bits (273),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +D++G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGLRSWIRVDTSGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  101  AIVVNLEQIRCIITADEVLL  120



>ref|XP_007023461.1| Magnesium transporter isoform 1 [Theobroma cacao]
 gb|EOY26083.1| Magnesium transporter isoform 1 [Theobroma cacao]
Length=442

 Score =   109 bits (273),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 53/111 (48%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = +3

Query  96   PTKVNAAPAVDDDGHNAAVPGIGS-------GLRKKASGVRSWLLLDSTGQAQVVEAGKH  254
            P K  +A  + D  + A+  G          GL+K+  G+RSW+ +D++G +Q++E  K 
Sbjct  10   PPKPQSAVNLRDASYRASASGRQPFQGMDLLGLKKRGQGLRSWIRVDTSGNSQIIEVDKF  69

Query  255  AIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
             +MRR  LP RDLR+LDPL  YPST+LGRE+AIV+NLE I+ IITA  VLL
Sbjct  70   TMMRRCDLPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITADEVLL  120



>ref|XP_009106708.1| PREDICTED: magnesium transporter MRS2-10-like [Brassica rapa]
 ref|XP_009106709.1| PREDICTED: magnesium transporter MRS2-10-like [Brassica rapa]
Length=410

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 52/106 (49%), Positives = 69/106 (65%), Gaps = 0/106 (0%)
 Frame = +3

Query  90   PPPTKVNAAPAVDDDGHNAAVPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRR  269
            PPP + ++       G    +    SGL K+  G++SW+ +D+    QV+E  K ++MRR
Sbjct  10   PPPLRGDSFSRPSSSGRQPLLGLDVSGLTKRGQGLKSWIRVDAFANTQVIEVDKFSMMRR  69

Query  270  TGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQXVLL  407
              LP RDLR+LDPL  YPST+LGRERAIV+NLE I+ IITA  VLL
Sbjct  70   CDLPARDLRLLDPLFVYPSTILGRERAIVVNLEQIRCIITADEVLL  115



>ref|XP_007034964.1| Magnesium transporter MRS2-2 isoform 2 [Theobroma cacao]
 gb|EOY05890.1| Magnesium transporter MRS2-2 isoform 2 [Theobroma cacao]
Length=387

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERA  350
            ++KK    RSW+LLDSTG+  V+E  K+AIM R  +  RDLRILDPLLSYPST+LGR+ A
Sbjct  15   VKKKVQPSRSWVLLDSTGETTVLEVDKYAIMHRVNIHARDLRILDPLLSYPSTILGRDGA  74

Query  351  IVINLEHIKAIITAQXVLL  407
            IV+NLEHIKAIIT++ VLL
Sbjct  75   IVLNLEHIKAIITSEEVLL  93



>ref|XP_004486600.1| PREDICTED: magnesium transporter MRS2-1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004486601.1| PREDICTED: magnesium transporter MRS2-1-like isoform X2 [Cicer 
arietinum]
Length=442

 Score =   109 bits (273),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  165  SGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRE  344
            +GL+K+  G+RSW+ +D++G +QV+E  K  +MRR  LP RDLR+LDPL  YPST+LGRE
Sbjct  40   TGLKKRGQGLRSWIRVDTSGNSQVLEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGRE  99

Query  345  RAIVINLEHIKAIITAQXVLL  407
            +AIV+NLE I+ IITA  VLL
Sbjct  100  KAIVVNLEQIRCIITADEVLL  120



>ref|XP_008674680.1| PREDICTED: magnesium transporter MRS2-F isoform X2 [Zea mays]
Length=360

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  195  RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHI  374
            R W+++ ++G A+V EAGKHA+M RTGLP RDLR+LDPLLSYPST+LGRERAIV+NLE +
Sbjct  27   REWMVVPASGPARVEEAGKHAVMARTGLPARDLRVLDPLLSYPSTILGRERAIVVNLERV  86

Query  375  KAIITAQXVLL  407
            KA+ITA  VLL
Sbjct  87   KALITATEVLL  97



>ref|XP_007223020.1| hypothetical protein PRUPE_ppa006863mg [Prunus persica]
 gb|EMJ24219.1| hypothetical protein PRUPE_ppa006863mg [Prunus persica]
Length=392

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
             ++KK+S  RSW+LLD TG+A V++  K+AIM R  +  RDLRI+DPLLSYPST+LGR+R
Sbjct  17   AVKKKSS--RSWVLLDCTGKATVLDVDKYAIMHRVHIHARDLRIVDPLLSYPSTILGRDR  74

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLEHIKAIITA+ VLL
Sbjct  75   AIVLNLEHIKAIITAEEVLL  94



>ref|XP_010651941.1| PREDICTED: magnesium transporter MRS2-2-like isoform X3 [Vitis 
vinifera]
Length=371

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +3

Query  150  VPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPST  329
            VPG      KK + V SW+L++  G++ +++  K+ IMRR  +  RDLRILDPLLSYPST
Sbjct  8    VPGDIQLASKKKTAVSSWVLMNDNGESTILDVDKYVIMRRVHIHARDLRILDPLLSYPST  67

Query  330  VLGRERAIVINLEHIKAIITAQXVLL  407
            +LGRERAIV+NLEHIKAIITA  VLL
Sbjct  68   ILGRERAIVLNLEHIKAIITADEVLL  93



>ref|XP_007034963.1| Magnesium transporter MRS2-2 isoform 1 [Theobroma cacao]
 gb|EOY05889.1| Magnesium transporter MRS2-2 isoform 1 [Theobroma cacao]
Length=386

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  LRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERA  350
            ++KK    RSW+LLDSTG+  V+E  K+AIM R  +  RDLRILDPLLSYPST+LGR+ A
Sbjct  15   VKKKVQPSRSWVLLDSTGETTVLEVDKYAIMHRVNIHARDLRILDPLLSYPSTILGRDGA  74

Query  351  IVINLEHIKAIITAQXVLL  407
            IV+NLEHIKAIIT++ VLL
Sbjct  75   IVLNLEHIKAIITSEEVLL  93



>ref|XP_001784777.1| predicted protein [Physcomitrella patens]
 gb|EDQ50405.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   109 bits (273),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  162  GSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGR  341
            G  L+K+  GVRSW+ +D +G  Q++E  K ++MRR  LP RDLR+LDPL  YPST+LGR
Sbjct  40   GVSLKKRGHGVRSWIRIDPSGNTQILEVDKASLMRRCDLPARDLRLLDPLFVYPSTILGR  99

Query  342  ERAIVINLEHIKAIITAQXVLL  407
            ERAIV+NLE I+ IITA  +LL
Sbjct  100  ERAIVVNLEQIRCIITADEILL  121



>ref|XP_003543708.1| PREDICTED: magnesium transporter MRS2-1-like isoform X1 [Glycine 
max]
 ref|XP_006595189.1| PREDICTED: magnesium transporter MRS2-1-like isoform X2 [Glycine 
max]
 ref|XP_006595190.1| PREDICTED: magnesium transporter MRS2-1-like isoform X3 [Glycine 
max]
 gb|KHN31874.1| Magnesium transporter MRS2-1 [Glycine soja]
Length=443

 Score =   109 bits (272),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +D++G +Q +E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGLRSWIRVDTSGNSQAIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  101  AIVVNLEQIRCIITADEVLL  120



>ref|XP_010094052.1| Magnesium transporter MRS2-1 [Morus notabilis]
 gb|EXB55142.1| Magnesium transporter MRS2-1 [Morus notabilis]
Length=443

 Score =   109 bits (272),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +D++G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  41   GLKKRGQGIRSWIRVDASGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  100

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VL+
Sbjct  101  AIVVNLEQIRCIITADEVLI  120



>ref|XP_008381115.1| PREDICTED: magnesium transporter MRS2-1-like isoform X1 [Malus 
domestica]
 ref|XP_008381117.1| PREDICTED: magnesium transporter MRS2-1-like isoform X1 [Malus 
domestica]
 ref|XP_008381118.1| PREDICTED: magnesium transporter MRS2-1-like isoform X1 [Malus 
domestica]
 ref|XP_008381119.1| PREDICTED: magnesium transporter MRS2-1-like isoform X1 [Malus 
domestica]
Length=458

 Score =   109 bits (272),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +D++G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  44   GLKKRGQGLRSWIRVDTSGNSQIIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREK  103

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  104  AIVVNLEQIRCIITADEVLL  123



>ref|XP_002282145.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Vitis 
vinifera]
Length=389

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +3

Query  150  VPGIGSGLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPST  329
            VPG      KK + V SW+L++  G++ +++  K+ IMRR  +  RDLRILDPLLSYPST
Sbjct  8    VPGDIQLASKKKTAVSSWVLMNDNGESTILDVDKYVIMRRVHIHARDLRILDPLLSYPST  67

Query  330  VLGRERAIVINLEHIKAIITAQXVLL  407
            +LGRERAIV+NLEHIKAIITA  VLL
Sbjct  68   ILGRERAIVLNLEHIKAIITADEVLL  93



>ref|XP_006416855.1| hypothetical protein EUTSA_v10007638mg [Eutrema salsugineum]
 gb|ESQ35208.1| hypothetical protein EUTSA_v10007638mg [Eutrema salsugineum]
Length=444

 Score =   109 bits (272),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +3

Query  150  VPGIGS-GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPS  326
            +PG+   GL+K+  G+RSW+ +D++G  QV+E  K  +MRR  LP RDLR+LDPL  YPS
Sbjct  35   LPGVDVLGLKKRGQGLRSWIRVDTSGNTQVMEVDKFTMMRRCDLPARDLRLLDPLFVYPS  94

Query  327  TVLGRERAIVINLEHIKAIITAQXVLL  407
            T+LGRE+AIV+NLE I+ IITA  VLL
Sbjct  95   TILGREKAIVVNLEQIRCIITADEVLL  121



>ref|XP_008674679.1| PREDICTED: magnesium transporter MRS2-F isoform X1 [Zea mays]
 tpg|DAA56243.1| TPA: hypothetical protein ZEAMMB73_736343 [Zea mays]
Length=443

 Score =   109 bits (272),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  195  RSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRERAIVINLEHI  374
            R W+++ ++G A+V EAGKHA+M RTGLP RDLR+LDPLLSYPST+LGRERAIV+NLE +
Sbjct  27   REWMVVPASGPARVEEAGKHAVMARTGLPARDLRVLDPLLSYPSTILGRERAIVVNLERV  86

Query  375  KAIITAQXVLL  407
            KA+ITA  VLL
Sbjct  87   KALITATEVLL  97



>ref|XP_008342817.1| PREDICTED: magnesium transporter MRS2-1 [Malus domestica]
Length=446

 Score =   109 bits (272),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  168  GLRKKASGVRSWLLLDSTGQAQVVEAGKHAIMRRTGLPGRDLRILDPLLSYPSTVLGRER  347
            GL+K+  G+RSW+ +D++G +Q++E  K  +MRR  LP RDLR+LDPL  YPST+LGRE+
Sbjct  44   GLKKRGQGLRSWIRVDTSGNSQIIEVDKFXMMRRCDLPARDLRLLDPLFVYPSTILGREK  103

Query  348  AIVINLEHIKAIITAQXVLL  407
            AIV+NLE I+ IITA  VLL
Sbjct  104  AIVVNLEQIRCIITADEVLL  123



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566707135225