BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF007P14

Length=234
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO97194.1|  unnamed protein product                                104   4e-26   Coffea canephora [robusta coffee]
ref|XP_011092558.1|  PREDICTED: 40S ribosomal protein S16-like          103   7e-26   Sesamum indicum [beniseed]
ref|XP_004229156.1|  PREDICTED: 40S ribosomal protein S16-like          102   2e-25   Solanum lycopersicum
ref|XP_009792138.1|  PREDICTED: 40S ribosomal protein S16-like          102   3e-25   Nicotiana sylvestris
ref|XP_004238675.1|  PREDICTED: 40S ribosomal protein S16               101   5e-25   Solanum lycopersicum
ref|XP_009612267.1|  PREDICTED: 40S ribosomal protein S16 isoform X1    101   6e-25   Nicotiana tomentosiformis
ref|XP_011089620.1|  PREDICTED: 40S ribosomal protein S16               101   7e-25   Sesamum indicum [beniseed]
gb|EPS67947.1|  hypothetical protein M569_06824                         100   1e-24   Genlisea aurea
ref|XP_009612269.1|  PREDICTED: 40S ribosomal protein S16             99.8    2e-24   Nicotiana tomentosiformis
ref|XP_004237264.1|  PREDICTED: 40S ribosomal protein S16             99.0    5e-24   Solanum lycopersicum
ref|XP_010105611.1|  40S ribosomal protein S16                        99.0    5e-24   Morus notabilis
gb|KDP42492.1|  hypothetical protein JCGZ_00289                       98.6    6e-24   Jatropha curcas
ref|XP_009602130.1|  PREDICTED: 40S ribosomal protein S16-like        98.2    1e-23   Nicotiana tomentosiformis
gb|EPS63821.1|  hypothetical protein M569_10962                       98.2    1e-23   Genlisea aurea
ref|XP_009409231.1|  PREDICTED: 40S ribosomal protein S16-like        97.8    1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010916936.1|  PREDICTED: 40S ribosomal protein S16-like        97.4    2e-23   Elaeis guineensis
ref|XP_010066008.1|  PREDICTED: 40S ribosomal protein S16             97.1    2e-23   Eucalyptus grandis [rose gum]
ref|XP_010102433.1|  40S ribosomal protein S16                        95.5    3e-23   
ref|XP_009390916.1|  PREDICTED: 40S ribosomal protein S16-like        97.1    3e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002300225.1|  ribosomal protein S16                            97.1    3e-23   
ref|XP_007034683.1|  Ribosomal protein S5 domain 2-like superfami...  96.7    3e-23   Theobroma cacao [chocolate]
ref|XP_002312518.1|  40S ribosomal protein S16                        96.7    4e-23   Populus trichocarpa [western balsam poplar]
gb|AAF34799.1|AF227979_1  40S ribosomal protein S16                   96.3    6e-23   Euphorbia esula [wolf's milk]
ref|XP_010255966.1|  PREDICTED: 40S ribosomal protein S16-like        95.9    6e-23   Nelumbo nucifera [Indian lotus]
ref|XP_002314714.1|  40S ribosomal protein S16                        95.9    8e-23   Populus trichocarpa [western balsam poplar]
sp|O22647.1|RS16_FRIAG  RecName: Full=40S ribosomal protein S16       95.5    9e-23   Fritillaria agrestis
ref|XP_008375886.1|  PREDICTED: 40S ribosomal protein S16-like        97.4    1e-22   
gb|ADR71284.1|  40S ribosomal protein S16B                            95.5    1e-22   Hevea brasiliensis [jebe]
gb|EPS69719.1|  hypothetical protein M569_05046                       95.5    1e-22   Genlisea aurea
ref|XP_009623909.1|  PREDICTED: 40S ribosomal protein S16-like        95.5    1e-22   Nicotiana tomentosiformis
gb|KCW63756.1|  hypothetical protein EUGRSUZ_G01416                   97.1    1e-22   Eucalyptus grandis [rose gum]
ref|XP_002281350.1|  PREDICTED: 40S ribosomal protein S16             95.1    2e-22   Vitis vinifera
emb|CBI26215.3|  unnamed protein product                              95.5    2e-22   Vitis vinifera
ref|XP_004136973.1|  PREDICTED: 40S ribosomal protein S16-like        94.7    2e-22   Cucumis sativus [cucumbers]
gb|ADR71283.1|  40S ribosomal protein S16A                            94.7    2e-22   Hevea brasiliensis [jebe]
ref|XP_001755340.1|  predicted protein                                94.4    3e-22   
gb|ADR71285.1|  40S ribosomal protein S16C                            94.0    3e-22   Hevea brasiliensis [jebe]
ref|XP_002285101.1|  PREDICTED: 40S ribosomal protein S16             94.0    4e-22   Vitis vinifera
gb|KJB79354.1|  hypothetical protein B456_013G045400                  94.0    4e-22   Gossypium raimondii
ref|XP_006422982.1|  hypothetical protein CICLE_v10029508mg           94.0    4e-22   Citrus clementina [clementine]
gb|AEW43294.1|  putative ribosomal protein S9                         93.6    5e-22   Hevea brasiliensis [jebe]
gb|ABK22408.1|  unknown                                               94.0    5e-22   Picea sitchensis
ref|XP_008390856.1|  PREDICTED: 40S ribosomal protein S16-like        93.6    5e-22   Malus domestica [apple tree]
ref|XP_008383171.1|  PREDICTED: 40S ribosomal protein S16             93.6    6e-22   Malus domestica [apple tree]
gb|ABK23888.1|  unknown                                               93.6    6e-22   Picea sitchensis
ref|XP_007201870.1|  hypothetical protein PRUPE_ppa012998mg           93.6    6e-22   Prunus persica
ref|XP_008236476.1|  PREDICTED: 40S ribosomal protein S16-like        93.6    7e-22   Prunus mume [ume]
ref|XP_009390299.1|  PREDICTED: 40S ribosomal protein S16             93.6    7e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010926242.1|  PREDICTED: 40S ribosomal protein S16-like        93.2    7e-22   Elaeis guineensis
gb|ABK20993.1|  unknown                                               93.2    7e-22   Picea sitchensis
gb|KJB12247.1|  hypothetical protein B456_002G008400                  93.2    7e-22   Gossypium raimondii
ref|XP_009804322.1|  PREDICTED: 40S ribosomal protein S16-like        93.2    8e-22   Nicotiana sylvestris
ref|XP_010277830.1|  PREDICTED: 40S ribosomal protein S16-like        92.8    1e-21   Nelumbo nucifera [Indian lotus]
ref|XP_004296911.1|  PREDICTED: 40S ribosomal protein S16             92.8    1e-21   Fragaria vesca subsp. vesca
ref|XP_008780865.1|  PREDICTED: 40S ribosomal protein S16-like        92.8    1e-21   Phoenix dactylifera
ref|XP_010270291.1|  PREDICTED: 40S ribosomal protein S16             92.8    1e-21   Nelumbo nucifera [Indian lotus]
gb|KJB31216.1|  hypothetical protein B456_005G236900                  92.4    1e-21   Gossypium raimondii
sp|P46293.1|RS16_GOSHI  RecName: Full=40S ribosomal protein S16       92.4    1e-21   Gossypium hirsutum [American cotton]
ref|XP_010263487.1|  PREDICTED: 40S ribosomal protein S16-like        92.4    1e-21   Nelumbo nucifera [Indian lotus]
ref|XP_009393541.1|  PREDICTED: 40S ribosomal protein S16-like        92.4    1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010524961.1|  PREDICTED: 40S ribosomal protein S16-1-like      92.4    2e-21   Tarenaya hassleriana [spider flower]
ref|XP_010551554.1|  PREDICTED: 40S ribosomal protein S16-1-like      92.0    2e-21   Tarenaya hassleriana [spider flower]
ref|XP_010528603.1|  PREDICTED: 40S ribosomal protein S16-1-like      92.0    2e-21   Tarenaya hassleriana [spider flower]
ref|XP_008373839.1|  PREDICTED: 40S ribosomal protein S16-like        92.0    2e-21   Malus domestica [apple tree]
ref|XP_007226006.1|  hypothetical protein PRUPE_ppa012996mg           92.0    2e-21   Prunus persica
ref|XP_001777696.1|  predicted protein                                91.7    3e-21   
gb|KHG18721.1|  40S ribosomal S16                                     91.7    3e-21   Gossypium arboreum [tree cotton]
ref|XP_006419873.1|  hypothetical protein CICLE_v10006162mg           91.3    4e-21   Citrus clementina [clementine]
ref|XP_001780940.1|  predicted protein                                91.3    4e-21   
ref|XP_010694150.1|  PREDICTED: 40S ribosomal protein S16-like        91.3    5e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002518738.1|  ribosomal protein S9, putative                   90.9    6e-21   
ref|XP_010420587.1|  PREDICTED: 40S ribosomal protein S16-3-like      90.9    7e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010549634.1|  PREDICTED: 40S ribosomal protein S16-1           90.5    8e-21   Tarenaya hassleriana [spider flower]
ref|XP_006400383.1|  hypothetical protein EUTSA_v10014948mg           90.5    8e-21   Eutrema salsugineum [saltwater cress]
ref|XP_006408213.1|  hypothetical protein EUTSA_v10021712mg           90.5    1e-20   Eutrema salsugineum [saltwater cress]
ref|XP_008795884.1|  PREDICTED: 40S ribosomal protein S16             90.1    1e-20   Phoenix dactylifera
ref|XP_010449924.1|  PREDICTED: 40S ribosomal protein S16-3           90.5    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010928344.1|  PREDICTED: 40S ribosomal protein S16             90.1    1e-20   Elaeis guineensis
ref|XP_002527855.1|  ribosomal protein S9, putative                   90.5    1e-20   Ricinus communis
ref|XP_004290594.1|  PREDICTED: 40S ribosomal protein S16-like        90.1    1e-20   Fragaria vesca subsp. vesca
ref|XP_007160464.1|  hypothetical protein PHAVU_002G324300g           90.1    1e-20   Phaseolus vulgaris [French bean]
ref|XP_006284710.1|  hypothetical protein CARUB_v10005968mg           90.1    1e-20   Capsella rubella
ref|XP_001775963.1|  predicted protein                                89.7    1e-20   
ref|XP_006840429.1|  hypothetical protein AMTR_s00045p00161540        90.1    1e-20   
gb|KFK37850.1|  hypothetical protein AALP_AA3G037300                  89.7    2e-20   Arabis alpina [alpine rockcress]
ref|XP_008788842.1|  PREDICTED: 40S ribosomal protein S16-like        89.4    2e-20   Phoenix dactylifera
ref|NP_001190330.1|  40S ribosomal protein S16-3                      89.4    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003518703.1|  PREDICTED: 40S ribosomal protein S16-like        89.4    3e-20   Glycine max [soybeans]
ref|NP_001078601.1|  40S ribosomal protein S16-3                      89.0    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197339.1|  40S ribosomal protein S16-3                         89.0    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010558732.1|  PREDICTED: 40S ribosomal protein S16-1-like      89.0    4e-20   Tarenaya hassleriana [spider flower]
ref|NP_178826.1|  40S ribosomal protein S16-1                         89.0    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007042464.1|  Ribosomal protein S5 domain 2-like superfami...  89.0    4e-20   
ref|XP_006298754.1|  hypothetical protein CARUB_v10014854mg           88.6    5e-20   Capsella rubella
ref|XP_002873890.1|  40S ribosomal protein S16                        88.6    5e-20   
ref|XP_004505243.1|  PREDICTED: 40S ribosomal protein S16-like        87.0    5e-20   Cicer arietinum [garbanzo]
ref|XP_010689120.1|  PREDICTED: 40S ribosomal protein S16-like        88.2    6e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010695861.1|  PREDICTED: 40S ribosomal protein S16             88.2    6e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003530932.1|  PREDICTED: 40S ribosomal protein S16-like        88.2    7e-20   Glycine max [soybeans]
ref|XP_007153584.1|  hypothetical protein PHAVU_003G047800g           88.2    8e-20   Phaseolus vulgaris [French bean]
ref|XP_004505244.1|  PREDICTED: 40S ribosomal protein S16-like        87.8    9e-20   
ref|XP_002994222.1|  hypothetical protein SELMODRAFT_138369           87.8    9e-20   Selaginella moellendorffii
ref|XP_010413003.1|  PREDICTED: 40S ribosomal protein S16-1-like ...  87.8    1e-19   
gb|KFK26075.1|  hypothetical protein AALP_AA8G199800                  87.4    1e-19   Arabis alpina [alpine rockcress]
ref|XP_003616020.1|  40S ribosomal protein S16                        87.4    1e-19   Medicago truncatula
gb|ACJ86025.1|  unknown                                               87.4    1e-19   Medicago truncatula
gb|ACJ85555.1|  unknown                                               87.4    1e-19   Medicago truncatula
ref|XP_006856488.1|  hypothetical protein AMTR_s00046p00076360        87.4    1e-19   Amborella trichopoda
ref|XP_003631001.1|  40S ribosomal protein S16                        87.4    1e-19   Medicago truncatula
ref|NP_001235533.1|  uncharacterized protein LOC100527911             87.4    1e-19   Glycine max [soybeans]
ref|XP_004489247.1|  PREDICTED: 40S ribosomal protein S16-like is...  88.2    2e-19   
ref|XP_004489248.1|  PREDICTED: 40S ribosomal protein S16-like is...  87.0    2e-19   Cicer arietinum [garbanzo]
gb|KHN21629.1|  40S ribosomal protein S16                             87.4    2e-19   Glycine soja [wild soybean]
ref|XP_003607926.1|  40S ribosomal protein S16-1                      87.0    2e-19   Medicago truncatula
gb|ACJ85531.1|  unknown                                               87.0    2e-19   Medicago truncatula
ref|XP_004503325.1|  PREDICTED: 40S ribosomal protein S16-like        86.7    2e-19   Cicer arietinum [garbanzo]
gb|ABW89384.1|  40S ribosomal protein S16                             86.7    2e-19   Helianthus annuus
emb|CDY29988.1|  BnaC01g40200D                                        86.7    3e-19   Brassica napus [oilseed rape]
ref|XP_009404058.1|  PREDICTED: 40S ribosomal protein S16-like is...  86.3    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK46930.1|  unknown                                               85.9    4e-19   Medicago truncatula
ref|XP_002884433.1|  40S ribosomal protein S16                        85.9    5e-19   Arabidopsis lyrata subsp. lyrata
gb|AFK36270.1|  unknown                                               85.5    5e-19   Lotus japonicus
emb|CDY24915.1|  BnaC03g22570D                                        85.5    6e-19   Brassica napus [oilseed rape]
ref|XP_009107873.1|  PREDICTED: 40S ribosomal protein S16-3-like      85.9    9e-19   Brassica rapa
ref|XP_006392218.1|  hypothetical protein EUTSA_v10023899mg           84.3    1e-18   
ref|NP_187073.1|  40S ribosomal protein S16-2                         84.3    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002515268.1|  hypothetical protein RCOM_1346810                82.8    2e-18   
sp|Q9XEK7.1|RS16_TORRU  RecName: Full=40S ribosomal protein S16       83.6    3e-18   Syntrichia ruralis
ref|NP_001065632.1|  Os11g0127900                                     83.6    4e-18   
emb|CCX13673.1|  Similar to 40S ribosomal protein S16; acc. no. Q...  83.2    5e-18   Pyronema omphalodes CBS 100304
tpe|CBF70472.1|  TPA: 40S ribosomal protein S16 (Broad)               83.2    5e-18   Aspergillus nidulans FGSC A4
ref|XP_001244905.1|  40S ribosomal protein S16                        83.2    5e-18   Coccidioides immitis RS
ref|XP_006662696.1|  PREDICTED: 40S ribosomal protein S16-like        83.2    6e-18   
emb|CDY21134.1|  BnaA01g33650D                                        83.2    6e-18   Brassica napus [oilseed rape]
emb|CDY25423.1|  BnaC09g39380D                                        83.2    6e-18   Brassica napus [oilseed rape]
emb|CDY61186.1|  BnaAnng17430D                                        82.4    6e-18   Brassica napus [oilseed rape]
ref|XP_002835431.1|  40S ribosomal protein S16                        82.8    9e-18   Tuber melanosporum Mel28
emb|CDX92061.1|  BnaC03g33630D                                        82.4    1e-17   
ref|XP_009125004.1|  PREDICTED: 40S ribosomal protein S16-3           82.4    1e-17   Brassica rapa
ref|XP_002542077.1|  40S ribosomal protein S16                        82.0    1e-17   Uncinocarpus reesii 1704
gb|EFW13750.1|  40S ribosomal protein S9                              83.6    1e-17   Coccidioides posadasii str. Silveira
gb|AAA33916.1|  ribosomal protein S16                                 81.6    2e-17   Oryza sativa Indica Group [Indian rice]
gb|KHJ31540.1|  putative 40s ribosomal protein s16                    81.3    3e-17   Erysiphe necator
gb|KIW85180.1|  40S ribosomal protein S16                             80.9    3e-17   Fonsecaea pedrosoi CBS 271.37
emb|CDY49352.1|  BnaA05g33140D                                        81.3    3e-17   Brassica napus [oilseed rape]
ref|XP_007746508.1|  40S ribosomal protein S16                        80.5    5e-17   Cladophialophora psammophila CBS 110553
ref|XP_009120979.1|  PREDICTED: 40S ribosomal protein S16-3-like      80.5    5e-17   Brassica rapa
ref|XP_001208887.1|  40S ribosomal protein S16                        80.5    5e-17   Aspergillus terreus NIH2624
gb|KIY00823.1|  40S ribosomal protein S16                             80.5    5e-17   Fonsecaea multimorphosa CBS 102226
gb|KIW57063.1|  40S ribosomal protein S16                             80.5    5e-17   Exophiala xenobiotica
gb|KIW32566.1|  40S ribosomal protein S16                             80.5    5e-17   Cladophialophora immunda
ref|XP_001275347.1|  40S ribosomal protein S16                        80.5    5e-17   Aspergillus clavatus NRRL 1
ref|XP_755383.1|  40S ribosomal protein Rps16                         80.5    6e-17   Aspergillus fumigatus Af293
ref|XP_007832090.1|  40S ribosomal protein S16                        80.1    6e-17   Pestalotiopsis fici W106-1
ref|XP_009124006.1|  PREDICTED: 40S ribosomal protein S16-3-like      80.1    7e-17   Brassica rapa
ref|XP_002565995.1|  Pc22g20980                                       80.1    8e-17   Penicillium rubens Wisconsin 54-1255
ref|XP_004341583.1|  ribosomal protein S9, putative                   80.1    8e-17   Acanthamoeba castellanii str. Neff
gb|EKV09594.1|  40S ribosomal protein Rps16, putative                 80.1    8e-17   Penicillium digitatum Pd1
gb|EYE97512.1|  ribosomal protein S9                                  79.7    9e-17   Aspergillus ruber CBS 135680
ref|XP_007804760.1|  40S ribosomal protein S16                        79.7    9e-17   Endocarpon pusillum Z07020
ref|XP_007729768.1|  40S ribosomal protein S16                        79.7    1e-16   Capronia epimyces CBS 606.96
ref|XP_003045227.1|  40S ribosomal protein S16                        79.7    1e-16   [Nectria] haematococca mpVI 77-13-4
dbj|GAD93775.1|  40S ribosomal protein S16                            79.7    1e-16   Byssochlamys spectabilis No. 5
gb|KEQ80503.1|  ribosomal protein S9                                  79.3    1e-16   Aureobasidium pullulans EXF-150
ref|XP_001260529.1|  40S ribosomal protein S16                        79.3    1e-16   Aspergillus fischeri NRRL 181
gb|KIV84862.1|  40S ribosomal protein S16-B                           79.3    1e-16   Exophiala sideris
gb|KEQ75559.1|  ribosomal protein S9                                  79.3    1e-16   Aureobasidium namibiae CBS 147.97
gb|KEQ63880.1|  ribosomal protein S9                                  79.3    1e-16   Aureobasidium melanogenum CBS 110374
ref|XP_009251551.1|  hypothetical protein FPSE_00156                  80.1    1e-16   Fusarium pseudograminearum CS3096
ref|XP_006677977.1|  hypothetical protein BATDEDRAFT_33120            79.3    2e-16   Batrachochytrium dendrobatidis JAM81
emb|CCE27535.1|  probable RPS16B-ribosomal protein S16.e              79.3    2e-16   Claviceps purpurea 20.1
emb|CDH52735.1|  40s ribosomal protein s16                            79.3    2e-16   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_009131657.1|  PREDICTED: 40S ribosomal protein S16-3-like ...  79.0    2e-16   Brassica rapa
dbj|GAM90516.1|  hypothetical protein ANO11243_085600                 79.0    2e-16   fungal sp. No.11243
gb|KIW47833.1|  40S ribosomal protein S16                             79.0    2e-16   Exophiala oligosperma
gb|KIM94888.1|  hypothetical protein OIDMADRAFT_21207                 79.0    2e-16   Oidiodendron maius Zn
dbj|BAK02829.1|  predicted protein                                    79.0    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EWY85270.1|  40S ribosomal protein S16                             78.6    2e-16   Fusarium oxysporum FOSC 3-a
dbj|BAJ85048.1|  predicted protein                                    79.0    3e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009134755.1|  PREDICTED: 40S ribosomal protein S16-3-like      79.0    3e-16   Brassica rapa
ref|XP_006963581.1|  hypothetical protein TRIREDRAFT_46490            78.6    3e-16   Trichoderma reesei QM6a
gb|KIW17179.1|  40S ribosomal protein S16                             78.6    3e-16   Exophiala spinifera
ref|XP_007818672.1|  hypothetical protein MAA_02483                   78.6    3e-16   Metarhizium robertsii ARSEF 23
emb|CDY70652.1|  BnaA03g57330D                                        78.6    3e-16   Brassica napus [oilseed rape]
ref|XP_003577865.1|  PREDICTED: 40S ribosomal protein S16             79.0    3e-16   Brachypodium distachyon [annual false brome]
ref|XP_007807991.1|  30S ribosomal protein S9                         78.6    3e-16   Metarhizium acridum CQMa 102
gb|KIL86733.1|  30s ribosomal protein s9                              78.6    3e-16   Fusarium avenaceum
gb|EPS28897.1|  hypothetical protein PDE_03843                        78.6    3e-16   Penicillium oxalicum 114-2
gb|KIX02816.1|  40S ribosomal protein S16                             78.6    3e-16   Rhinocladiella mackenziei CBS 650.93
ref|XP_001399741.1|  40S ribosomal protein S16                        78.6    3e-16   Aspergillus niger CBS 513.88
gb|KIW66708.1|  40S ribosomal protein S16                             78.6    3e-16   Phialophora americana
emb|CCT73613.1|  probable RPS16B-ribosomal protein S16.e              78.6    3e-16   Fusarium fujikuroi IMI 58289
gb|KID78369.1|  Ribosomal protein S9                                  78.6    3e-16   Metarhizium brunneum ARSEF 3297
gb|ELR06410.1|  40S ribosomal protein S16                             78.6    3e-16   Pseudogymnoascus destructans 20631-21
emb|CEF98090.1|  Ribosomal protein S9, conserved site                 78.6    3e-16   Ostreococcus tauri
ref|XP_009161029.1|  40S ribosomal protein S16                        78.6    3e-16   Exophiala dermatitidis NIH/UT8656
gb|EMT65947.1|  40S ribosomal protein S16                             78.2    4e-16   Fusarium oxysporum f. sp. cubense race 4
gb|KFY16535.1|  hypothetical protein V492_01253                       79.0    4e-16   Pseudogymnoascus sp. VKM F-4246
ref|XP_001798536.1|  hypothetical protein SNOG_08214                  79.0    4e-16   Parastagonospora nodorum SN15
gb|EWG51312.1|  40S ribosomal protein S16                             78.2    4e-16   Fusarium verticillioides 7600
gb|EXX61063.1|  ribosomal 40S subunit protein S16A                    78.2    4e-16   Rhizophagus irregularis DAOM 197198w
ref|XP_007932485.1|  hypothetical protein MYCFIDRAFT_60541            78.2    4e-16   Pseudocercospora fijiensis CIRAD86
gb|ESA22278.1|  hypothetical protein GLOINDRAFT_342744                78.2    4e-16   
ref|XP_008729424.1|  40S ribosomal protein S16                        78.2    4e-16   Cladophialophora carrionii CBS 160.54
gb|EIE79686.1|  40S ribosomal protein S16                             77.8    5e-16   Rhizopus delemar RA 99-880
ref|XP_007757836.1|  40S ribosomal protein S16                        78.2    5e-16   Cladophialophora yegresii CBS 114405
gb|EQL03131.1|  Ribosomal protein S9                                  78.2    5e-16   Ophiocordyceps sinensis CO18
ref|XP_007294963.1|  40S ribosomal protein S16                        77.8    5e-16   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|EHK46585.1|  hypothetical protein TRIATDRAFT_256508                77.8    5e-16   Trichoderma atroviride IMI 206040
gb|EIE78170.1|  40S ribosomal protein S16                             77.8    5e-16   Rhizopus delemar RA 99-880
gb|EHK19908.1|  hypothetical protein TRIVIDRAFT_83253                 77.8    5e-16   Trichoderma virens Gv29-8
gb|KFY72802.1|  hypothetical protein V499_07066                       78.6    5e-16   Pseudogymnoascus sp. VKM F-103
gb|KDB16501.1|  30S ribosomal protein S9                              77.8    5e-16   Ustilaginoidea virens
gb|KFZ07922.1|  hypothetical protein V502_09659                       79.0    5e-16   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
ref|XP_001598002.1|  40S ribosomal protein S16                        77.8    6e-16   Sclerotinia sclerotiorum 1980 UF-70
gb|ABX44789.1|  putative 40S ribosomal protein RPS16                  77.8    6e-16   Flustra foliacea
emb|CDH54149.1|  40s ribosomal protein s16                            77.8    6e-16   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_011321495.1|  40S ribosomal protein S16                        77.8    6e-16   Fusarium graminearum PH-1
ref|XP_011124562.1|  hypothetical protein AOL_s00097g427              77.8    6e-16   Arthrobotrys oligospora ATCC 24927
ref|XP_002126231.1|  PREDICTED: 40S ribosomal protein S16-like        77.8    6e-16   Ciona intestinalis [sea vase]
ref|XP_009039660.1|  hypothetical protein AURANDRAFT_30567            77.8    7e-16   Aureococcus anophagefferens
ref|XP_002796427.1|  40S ribosomal protein S16                        77.8    7e-16   Paracoccidioides lutzii Pb01
gb|KIE01576.1|  Ribosomal protein S9                                  77.8    7e-16   Metarhizium majus ARSEF 297
gb|AFM90848.1|  40S ribosomal protein S16-like protein                78.2    7e-16   Callorhinchus milii [Australian ghost shark]
gb|EEH04485.1|  40S ribosomal protein S16                             77.4    7e-16   Histoplasma capsulatum G186AR
ref|XP_001536964.1|  40S ribosomal protein S16                        77.4    7e-16   Histoplasma capsulatum NAm1
gb|EME41332.1|  ribosomal protein-like protein                        77.4    7e-16   Dothistroma septosporum NZE10
ref|XP_007232866.1|  PREDICTED: 40S ribosomal protein S16-like is...  77.4    7e-16   
ref|XP_006674637.1|  40S ribosomal protein S16                        77.4    8e-16   Cordyceps militaris CM01
ref|XP_002441754.1|  hypothetical protein SORBIDRAFT_08g001870        77.4    8e-16   Sorghum bicolor [broomcorn]
ref|XP_008597075.1|  ribosomal protein S9/S16                         77.4    8e-16   Beauveria bassiana ARSEF 2860
gb|AFK11567.1|  Rps16 protein                                         77.8    9e-16   Callorhinchus milii [Australian ghost shark]
gb|ADG23112.1|  40S ribosomal protein Rps16                           77.4    9e-16   Rhizoplaca chrysoleuca [orange rock-posy lichen]
ref|XP_008079047.1|  Ribosomal protein S5 2-like protein              77.4    9e-16   Glarea lozoyensis ATCC 20868
gb|ACG26490.1|  40S ribosomal protein S16                             77.4    1e-15   Zea mays [maize]
emb|CEG74905.1|  Putative 40S ribosomal protein S16                   77.8    1e-15   Rhizopus microsporus
ref|XP_002450189.1|  hypothetical protein SORBIDRAFT_05g001680        77.4    1e-15   Sorghum bicolor [broomcorn]
ref|XP_007686327.1|  hypothetical protein COCMIDRAFT_35302            77.0    1e-15   Bipolaris oryzae ATCC 44560
ref|XP_004254022.1|  40S ribosomal protein S16, putative              76.6    1e-15   Entamoeba invadens IP1
ref|XP_003579002.1|  PREDICTED: 40S ribosomal protein S16-like        77.0    1e-15   Brachypodium distachyon [annual false brome]
ref|XP_008029776.1|  hypothetical protein SETTUDRAFT_165152           77.0    1e-15   Exserohilum turcica Et28A
gb|ESZ99352.1|  40S ribosomal protein S16                             77.0    1e-15   Sclerotinia borealis F-4128
ref|XP_001555512.1|  40S ribosomal protein S16                        77.0    1e-15   
ref|XP_002622587.1|  40S ribosomal protein S16                        77.0    1e-15   Blastomyces gilchristii SLH14081
ref|XP_002500989.1|  predicted protein                                77.0    1e-15   Micromonas commoda
gb|EPB82886.1|  40S ribosomal protein                                 77.0    1e-15   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_008714363.1|  40S ribosomal protein S16                        77.0    1e-15   Cyphellophora europaea CBS 101466
gb|KIV89975.1|  40S ribosomal protein S16                             76.6    1e-15   Exophiala mesophila
ref|XP_007723453.1|  40S ribosomal protein S16                        76.6    1e-15   Capronia coronata CBS 617.96
gb|EGU88635.1|  hypothetical protein FOXB_00884                       76.3    1e-15   Fusarium oxysporum Fo5176
ref|XP_007781496.1|  40S ribosomal protein S16                        76.6    1e-15   Coniosporium apollinis CBS 100218
gb|ESW98678.1|  40S ribosomal protein S16                             76.6    2e-15   Ogataea parapolymorpha DL-1
ref|XP_008608456.1|  40S ribosomal protein S16                        76.6    2e-15   Saprolegnia diclina VS20
emb|CBJ30363.1|  conserved unknown protein                            76.6    2e-15   Ectocarpus siliculosus
ref|XP_011386670.1|  ribosomal 40S subunit protein S16                76.3    2e-15   Ustilago maydis 521
ref|XP_003056886.1|  predicted protein                                76.3    2e-15   Micromonas pusilla CCMP1545
ref|XP_007416339.1|  hypothetical protein MELLADRAFT_45448            76.3    2e-15   Melampsora larici-populina 98AG31
gb|ETS63682.1|  hypothetical protein PaG_01988                        76.3    2e-15   Moesziomyces aphidis DSM 70725
ref|XP_001938684.1|  40S ribosomal protein S16                        76.3    2e-15   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_004714191.1|  PREDICTED: 40S ribosomal protein S16-like is...  76.3    2e-15   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003855745.1|  40S ribosomal protein S16                        76.3    2e-15   Zymoseptoria tritici IPO323
ref|XP_009531521.1|  hypothetical protein PHYSODRAFT_355047           76.3    3e-15   Phytophthora sojae
gb|EWC44421.1|  40S ribosomal protein S16                             76.3    3e-15   Drechslerella stenobrocha 248
emb|CCF54184.1|  probable 40S ribosomal protein S16                   75.9    3e-15   Ustilago hordei
dbj|BAK02478.1|  predicted protein                                    76.3    3e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFO64775.1|  40S ribosomal protein S16                             76.3    3e-15   Corvus brachyrhynchos
gb|KIM75431.1|  hypothetical protein PILCRDRAFT_827354                75.9    3e-15   Piloderma croceum F 1598
ref|XP_002850095.1|  40S ribosomal protein S16                        75.9    3e-15   Microsporum canis CBS 113480
gb|ACO08300.1|  40S ribosomal protein S16                             75.9    3e-15   Oncorhynchus mykiss
ref|XP_008893682.1|  40S ribosomal protein S16                        76.3    3e-15   Phytophthora parasitica INRA-310
gb|KDN39552.1|  hypothetical protein RSAG8_08708                      75.9    3e-15   Rhizoctonia solani AG-8 WAC10335
ref|XP_002899087.1|  40S ribosomal protein S16                        76.3    3e-15   Phytophthora infestans T30-4
gb|EMT04029.1|  40S ribosomal protein S16                             75.9    3e-15   
gb|KEF59434.1|  40S ribosomal protein S16                             75.9    4e-15   Exophiala aquamarina CBS 119918
ref|NP_001134097.1|  40S ribosomal protein S16                        75.9    4e-15   Salmo salar
ref|XP_006633603.1|  PREDICTED: 40S ribosomal protein S16-like        75.9    4e-15   Lepisosteus oculatus
ref|XP_003221173.1|  PREDICTED: 40S ribosomal protein S16             75.9    4e-15   Anolis carolinensis [Carolina anole]
dbj|BAF45905.1|  ribosomal protein S16                                75.9    4e-15   Solea senegalensis
ref|NP_001011146.1|  ribosomal protein S16                            75.9    4e-15   Xenopus tropicalis [western clawed frog]
gb|ACM08397.1|  40S ribosomal protein S16                             75.9    4e-15   
ref|XP_008313605.1|  PREDICTED: 40S ribosomal protein S16             75.5    4e-15   
ref|XP_010885525.1|  PREDICTED: 40S ribosomal protein S16             75.5    4e-15   
gb|ACM08724.1|  40S ribosomal protein S16                             75.5    4e-15   
gb|ACO13777.1|  40S ribosomal protein S16                             74.7    4e-15   
ref|NP_001278474.1|  40S ribosomal protein S16                        75.5    4e-15   
dbj|GAK62228.1|  conserved hypothetical protein                       76.6    4e-15   
gb|KFX87860.1|  hypothetical protein O988_09259                       75.5    4e-15   
gb|ETL91183.1|  40S ribosomal protein S16                             75.9    4e-15   
gb|KFV62939.1|  40S ribosomal protein S16                             75.5    4e-15   
ref|NP_001232350.1|  putative ribosomal protein S16                   75.5    4e-15   
ref|XP_005369791.1|  PREDICTED: 40S ribosomal protein S16-like        75.5    4e-15   
ref|XP_007583861.1|  putative 40s ribosomal protein s16 protein       75.5    5e-15   
ref|XP_007390557.1|  hypothetical protein PHACADRAFT_204276           75.5    5e-15   
ref|XP_004083248.1|  PREDICTED: 40S ribosomal protein S16             75.5    5e-15   
gb|ACO51844.1|  40S ribosomal protein S16                             75.1    5e-15   
ref|XP_002608479.1|  hypothetical protein BRAFLDRAFT_128027           74.7    6e-15   
ref|XP_004978481.1|  PREDICTED: 40S ribosomal protein S16-like        75.1    6e-15   
ref|XP_001417833.1|  Ribosomal protein S16, component of cytosoli...  75.1    6e-15   
ref|XP_004595240.1|  PREDICTED: 40S ribosomal protein S16             73.9    6e-15   
ref|XP_004605794.1|  PREDICTED: 40S ribosomal protein S16-like        75.5    6e-15   
ref|XP_004548484.1|  PREDICTED: 40S ribosomal protein S16-like        75.1    7e-15   
gb|ACR24967.1|  ribosomal protein S16                                 75.1    7e-15   
ref|XP_008398658.1|  PREDICTED: 40S ribosomal protein S16             75.1    7e-15   
gb|KIP11397.1|  hypothetical protein PHLGIDRAFT_114531                75.1    7e-15   
ref|XP_007555348.1|  PREDICTED: 40S ribosomal protein S16             75.1    7e-15   
ref|XP_003452097.1|  PREDICTED: 40S ribosomal protein S16-like is...  75.1    7e-15   
gb|EPY85984.1|  ribosomal protein S16                                 74.7    7e-15   
ref|XP_004319946.1|  PREDICTED: 40S ribosomal protein S16 isoform 1   75.1    7e-15   
gb|KFQ38885.1|  40S ribosomal protein S16                             75.1    7e-15   
ref|XP_005908688.1|  PREDICTED: 40S ribosomal protein S16-like is...  74.7    8e-15   
ref|XP_003326144.1|  40S ribosomal protein S16                        74.7    8e-15   
gb|AAX29081.1|  ribosomal protein S16                                 74.7    8e-15   
ref|XP_010379207.1|  PREDICTED: 40S ribosomal protein S16             74.7    9e-15   
ref|XP_006178002.1|  PREDICTED: 40S ribosomal protein S16             74.7    9e-15   
gb|KFH72737.1|  40S ribosomal protein S16                             74.7    9e-15   
gb|KHN82434.1|  40S ribosomal protein S16                             74.7    9e-15   
ref|NP_001011.1|  40S ribosomal protein S16                           74.7    9e-15   
gb|KFH62734.1|  40S ribosomal protein S16                             74.7    9e-15   
ref|XP_003915560.1|  PREDICTED: 40S ribosomal protein S16             74.7    9e-15   
ref|XP_004260943.1|  40S ribosomal protein S16, putative              75.1    9e-15   
ref|XP_004670475.1|  PREDICTED: 40S ribosomal protein S16 isoform X1  74.7    9e-15   
gb|ERG80845.1|  40s ribosomal protein s16                             74.7    9e-15   
ref|XP_010756302.1|  40S ribosomal protein S16                        74.7    9e-15   
ref|XP_007276780.1|  40s ribosomal protein s16                        74.7    9e-15   
ref|XP_006215095.1|  PREDICTED: 40S ribosomal protein S16 isoform X1  74.7    1e-14   
gb|EPQ64664.1|  Protein component of the small (40S) ribosomal su...  74.3    1e-14   
gb|AAH82286.1|  Rps16 protein                                         74.7    1e-14   
gb|AFR11277.1|  ribosomal protein S16                                 74.3    1e-14   
gb|EMF11109.1|  40S ribosomal protein Rps16                           74.3    1e-14   
gb|KIK05473.1|  hypothetical protein K443DRAFT_3744                   74.3    1e-14   
ref|XP_003003065.1|  40S ribosomal protein S16                        74.3    1e-14   
gb|AAI59439.1|  Rps16 protein                                         74.7    1e-14   
ref|XP_001873167.1|  40S ribosomal protein S16                        74.3    1e-14   
gb|ERE41892.1|  40S ribosomal protein S16-like protein                74.3    1e-14   
emb|CCE40560.1|  hypothetical protein CPAR2_105960                    74.3    1e-14   
ref|XP_010945533.1|  PREDICTED: 40S ribosomal protein S16 isoform X2  74.7    1e-14   
gb|AAH84715.1|  Rps16 protein                                         74.7    1e-14   
ref|XP_003972741.1|  PREDICTED: 40S ribosomal protein S16-like is...  74.3    1e-14   
gb|KEY65597.1|  hypothetical protein S7711_08785                      74.3    1e-14   
ref|XP_009433846.1|  PREDICTED: 40S ribosomal protein S16 isoform X1  74.3    1e-14   
ref|XP_003420822.1|  PREDICTED: 40S ribosomal protein S16             74.3    1e-14   
ref|XP_001526670.1|  40S ribosomal protein S16                        74.3    1e-14   
ref|XP_005995898.1|  PREDICTED: 40S ribosomal protein S16-like is...  75.1    1e-14   
ref|XP_007860949.1|  40S ribosomal protein S16                        74.3    1e-14   
gb|AAH64030.1|  Rps16 protein                                         74.7    1e-14   
emb|CCO26706.1|  small subunit ribosomal protein S16e                 74.3    1e-14   
ref|XP_005259194.1|  PREDICTED: 40S ribosomal protein S16 isoform X1  74.3    1e-14   
gb|ENH86473.1|  40s ribosomal protein s16                             74.3    1e-14   
gb|KFD50978.1|  hypothetical protein M513_08161                       75.1    1e-14   
dbj|GAC95442.1|  40S ribosomal protein S16                            75.1    1e-14   
ref|XP_004366701.1|  40S ribosomal protein S16                        74.7    1e-14   
sp|Q90YQ7.1|RS16_ICTPU  RecName: Full=40S ribosomal protein S16       74.3    1e-14   
ref|NP_001187219.1|  40S ribosomal protein S16                        74.3    1e-14   
ref|XP_006064132.1|  PREDICTED: 40S ribosomal protein S16-like        74.7    1e-14   
sp|Q98TR7.1|RS16_HETFO  RecName: Full=40S ribosomal protein S16       74.3    1e-14   
gb|AFM86626.1|  40S ribosomal protein S16-like protein                73.9    1e-14   
ref|XP_006228674.1|  PREDICTED: 40S ribosomal protein S16 isoform X1  74.3    1e-14   
ref|XP_001385427.1|  40S ribosomal protein S16                        73.9    1e-14   
gb|ACO09841.1|  40S ribosomal protein S16                             73.9    2e-14   
ref|XP_010735560.1|  PREDICTED: 40S ribosomal protein S16             73.6    2e-14   
gb|EKG20079.1|  Ribosomal protein S9                                  73.9    2e-14   
gb|AAH90618.1|  Rps16 protein                                         74.3    2e-14   
emb|CDI51367.1|  probable 40S ribosomal protein S16                   73.9    2e-14   
ref|XP_007451843.1|  PREDICTED: 40S ribosomal protein S16 isoform X1  74.3    2e-14   
gb|ABW89401.1|  40S ribosomal protein S16                             73.6    2e-14   
ref|XP_007180040.1|  PREDICTED: 40S ribosomal protein S16 isoform X1  73.9    2e-14   
ref|XP_002949171.1|  component of cytosolic 80S ribosome and 40S ...  73.9    2e-14   
ref|XP_009028241.1|  hypothetical protein HELRODRAFT_115475           73.9    2e-14   
ref|XP_002493842.1|  40S ribosomal protein S16                        73.9    2e-14   
ref|XP_003834453.1|  similar to 40S ribosomal protein S16             73.9    2e-14   
ref|XP_004977429.1|  PREDICTED: 40S ribosomal protein S16-like        73.9    2e-14   
ref|XP_011450742.1|  PREDICTED: 40S ribosomal protein S16             73.9    2e-14   
ref|XP_004441577.1|  PREDICTED: 40S ribosomal protein S16 isoform 1   74.3    2e-14   
gb|ACM09220.1|  40S ribosomal protein S16                             73.9    2e-14   
ref|XP_004481507.1|  PREDICTED: 40S ribosomal protein S16 isoform 1   74.3    2e-14   
gb|KHO01173.1|  30S ribosomal protein S9                              74.3    2e-14   
gb|EPX71321.1|  40S ribosomal protein S16                             73.6    2e-14   
ref|XP_007874994.1|  30S ribosomal protein S9                         73.6    2e-14   
ref|XP_007372203.1|  40S ribosomal protein rps16                      73.6    2e-14   
ref|XP_002416955.1|  40S ribosomal protein S16                        73.6    2e-14   
gb|EPY52929.1|  40S ribosomal protein S16                             73.6    2e-14   
ref|XP_001693495.1|  ribosomal protein S16, component of cytosoli...  73.6    2e-14   
ref|XP_007114548.1|  PREDICTED: 40S ribosomal protein S16 isoform X1  73.9    2e-14   
gb|KGU33682.1|  40S ribosomal protein S16                             73.6    2e-14   
gb|KII93922.1|  hypothetical protein PLICRDRAFT_171624                73.6    2e-14   
ref|XP_011110711.1|  hypothetical protein H072_4821                   73.6    2e-14   
ref|XP_007679998.1|  hypothetical protein BAUCODRAFT_125558           73.6    3e-14   
ref|XP_004347857.1|  ribosomal protein S16                            73.6    3e-14   
emb|CCK70468.1|  hypothetical protein KNAG_0E02060                    73.6    3e-14   
gb|KDQ12872.1|  hypothetical protein BOTBODRAFT_34020                 73.6    3e-14   
ref|XP_005660372.1|  PREDICTED: 40S ribosomal protein S16-like        73.6    3e-14   
gb|EFQ25244.1|  ribosomal protein S9/S16                              73.2    3e-14   
sp|Q876B4.3|RS16_SACEX  RecName: Full=40S ribosomal protein S16       73.2    3e-14   
ref|XP_002107880.1|  conserved hypothetical protein                   73.2    3e-14   
ref|XP_003867862.1|  Rps16a 40S ribosomal subunit S16                 73.2    3e-14   
gb|EDL15855.1|  mCG3370                                               73.2    3e-14   
ref|XP_008875223.1|  40S ribosomal protein S16                        73.2    3e-14   
ref|XP_011274624.1|  40S ribosomal protein S16                        73.2    3e-14   
gb|AGH70201.1|  40S ribosomal protein S16                             73.2    3e-14   
ref|XP_005868880.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...  74.3    3e-14   
gb|ELK24038.1|  40S ribosomal protein S16                             72.8    3e-14   
ref|XP_005572789.1|  PREDICTED: 40S ribosomal protein S16-like        73.2    3e-14   
ref|NP_001150980.1|  40S ribosomal protein S16                        73.2    4e-14   
ref|NP_001070200.1|  40S ribosomal protein S16                        73.2    4e-14   
gb|ACD65104.1|  putative 40S ribosomal protein RPS16                  73.2    4e-14   
ref|NP_595738.1|  40S ribosomal protein S16                           72.8    4e-14   
ref|XP_003647271.1|  hypothetical protein Ecym_6051                   73.2    4e-14   
ref|XP_004639481.1|  PREDICTED: 40S ribosomal protein S16-like        73.2    4e-14   
gb|AFM87781.1|  40S ribosomal protein S16-like protein                73.2    4e-14   
ref|XP_003686476.1|  40S ribosomal protein S16                        72.8    4e-14   
ref|XP_003369908.1|  40S ribosomal protein S16                        71.6    4e-14   
ref|XP_003682894.1|  40S ribosomal protein S16                        72.8    4e-14   
gb|KJA29436.1|  hypothetical protein HYPSUDRAFT_211302                72.8    4e-14   
gb|KIH56374.1|  ribosomal protein S9                                  73.9    4e-14   
ref|XP_006772017.1|  PREDICTED: 40S ribosomal protein S16             72.8    4e-14   
ref|XP_007298926.1|  ribosomal protein S9                             72.8    4e-14   
ref|XP_005362618.1|  PREDICTED: 40S ribosomal protein S16-like        73.2    4e-14   
gb|AFM86674.1|  40S ribosomal protein S16-like protein                72.8    4e-14   
ref|NP_001279691.1|  ribosomal protein S16                            72.8    4e-14   
dbj|GAM36975.1|  40S ribosomal protein                                72.8    4e-14   
ref|XP_010773777.1|  PREDICTED: 40S ribosomal protein S16 isoform X1  72.8    4e-14   
ref|XP_001096607.2|  PREDICTED: 40S ribosomal protein S16-like        73.6    4e-14   
ref|XP_002480961.1|  40S ribosomal protein S16                        72.8    4e-14   
gb|ETN83423.1|  ribosomal protein S9                                  72.8    4e-14   
ref|XP_002151957.1|  40S ribosomal protein S16                        72.8    4e-14   
ref|NP_984354.1|  40S ribosomal protein S16                           72.8    5e-14   
tpg|DAA30928.1|  TPA: ribosomal protein S16-like                      72.8    5e-14   
gb|AAN52388.1|  ribosomal protein S16                                 72.8    5e-14   
ref|XP_001828668.2|  40S ribosomal protein S16                        72.8    5e-14   
ref|XP_458833.1|  40S ribosomal protein S16                           72.8    5e-14   
ref|XP_004388276.1|  PREDICTED: 40S ribosomal protein S16             73.2    5e-14   
ref|XP_003688797.1|  PREDICTED: 40S ribosomal protein S16 isoform X1  72.8    5e-14   
gb|KIY50526.1|  ribosomal protein S9                                  72.4    6e-14   
gb|KIM48259.1|  hypothetical protein M413DRAFT_22783                  72.4    6e-14   
ref|XP_003037186.1|  40S ribosomal protein S16                        72.4    6e-14   
ref|XP_002174569.1|  40S ribosomal protein S16                        72.4    6e-14   
gb|EFX86712.1|  hypothetical protein DAPPUDRAFT_307788                72.8    6e-14   
gb|ELU16265.1|  hypothetical protein CAPTEDRAFT_153161                72.4    6e-14   
gb|KIK47860.1|  hypothetical protein CY34DRAFT_798942                 72.4    6e-14   
gb|KDR84925.1|  hypothetical protein GALMADRAFT_233393                72.4    6e-14   
gb|EYC19805.1|  hypothetical protein Y032_0023g728                    72.4    6e-14   
gb|EYC19804.1|  hypothetical protein Y032_0023g728                    72.4    7e-14   
ref|XP_005871817.1|  PREDICTED: 40S ribosomal protein S16-like        72.4    7e-14   
gb|KIL70897.1|  hypothetical protein M378DRAFT_155838                 72.4    7e-14   
ref|XP_007763476.1|  ribosomal protein S9                             72.4    7e-14   
ref|XP_007798148.1|  putative 40s ribosomal protein s16 protein       72.0    7e-14   
dbj|GAC73668.1|  hypothetical protein PANT_9d00209                    73.6    7e-14   
ref|XP_002637724.1|  C. briggsae CBR-RPS-16 protein                   72.4    7e-14   
gb|KIW08229.1|  40S ribosomal protein S16                             72.0    7e-14   
ref|XP_005109349.1|  PREDICTED: 40S ribosomal protein S16             72.4    7e-14   
ref|XP_006021181.1|  PREDICTED: 40S ribosomal protein S16-like        72.8    8e-14   
ref|XP_007597205.1|  ribosomal protein S9/S16                         72.0    8e-14   
emb|CCK68250.1|  hypothetical protein KNAG_0A05870                    72.0    8e-14   
ref|XP_002682153.1|  40S ribosomal protein S16                        72.0    8e-14   
ref|XP_007265681.1|  ribosomal protein S9                             72.0    8e-14   
ref|XP_003373139.1|  40S ribosomal protein S16                        72.0    8e-14   
ref|XP_009540857.1|  hypothetical protein HETIRDRAFT_377528           72.0    9e-14   
emb|CCA24817.1|  40S ribosomal protein S16 putative                   72.0    9e-14   
ref|XP_010664959.1|  PREDICTED: 40S ribosomal protein S16             72.4    9e-14   
gb|KGG53001.1|  40S ribosomal protein S16                             72.0    9e-14   
emb|CCI50246.1|  unnamed protein product                              72.0    9e-14   
ref|XP_006996257.1|  PREDICTED: 40S ribosomal protein S16-like        72.0    9e-14   
gb|KFH43951.1|  40S ribosomal protein-like protein                    72.0    9e-14   
ref|XP_007842764.1|  40s ribosomal protein s16                        72.0    9e-14   
ref|XP_007880663.1|  hypothetical protein PFL1_04942                  72.0    9e-14   
emb|CDR45396.1|  CYFA0S18e00892g1_1                                   72.0    9e-14   
ref|XP_002470869.1|  40S ribosomal protein S16                        71.6    1e-13   
ref|XP_002176729.1|  predicted protein                                71.6    1e-13   
gb|EIF46651.1|  40s ribosomal protein s16                             71.6    1e-13   
gb|KIK70920.1|  hypothetical protein GYMLUDRAFT_185072                71.6    1e-13   
dbj|BAA33368.1|  ribosomal protein S16 homolog                        71.6    1e-13   
emb|CCF34752.1|  40S ribosomal protein S16                            70.1    1e-13   
gb|KIM66247.1|  hypothetical protein SCLCIDRAFT_1211484               71.6    1e-13   
gb|KEP54256.1|  40S ribosomal protein S16                             72.4    1e-13   
ref|XP_007312334.1|  hypothetical protein SERLADRAFT_454788           71.6    1e-13   
gb|EUC53799.1|  40S ribosomal protein rps16                           72.4    1e-13   
ref|XP_004179221.1|  hypothetical protein TBLA_0B08860                71.6    1e-13   
ref|XP_007378726.1|  ribosomal protein L4/L1                          71.6    1e-13   
gb|AJS65059.1|  Rps16ap                                               71.6    1e-13   
dbj|BAO38322.1|  40S ribosomal protein S16                            71.6    1e-13   
ref|XP_002494729.1|  40S ribosomal protein S16                        71.6    1e-13   
gb|AAX62440.1|  ribosomal protein S16                                 71.6    1e-13   
ref|NP_010200.1|  ribosomal 40S subunit protein S16B                  71.6    1e-13   
gb|EMD42124.1|  hypothetical protein CERSUDRAFT_79730                 71.6    1e-13   
gb|AAO32578.1|  RPS16                                                 71.2    1e-13   
ref|XP_454946.1|  40S ribosomal protein S16                           71.2    1e-13   
ref|XP_003673342.1|  hypothetical protein NCAS_0A03970                71.2    1e-13   
gb|AFM90796.1|  40S ribosomal protein S16-like protein                71.2    2e-13   
gb|KIY71015.1|  ribosomal protein S9                                  71.2    2e-13   
ref|XP_002172859.1|  40S ribosomal protein S16                        71.2    2e-13   
gb|KDQ30854.1|  hypothetical protein PLEOSDRAFT_1062835               71.2    2e-13   
ref|XP_004060441.1|  PREDICTED: 40S ribosomal protein S16-like is...  71.2    2e-13   
ref|XP_003958027.1|  hypothetical protein KAFR_0F02960                71.2    2e-13   
emb|CDF88471.1|  BN860_11034g1_1                                      70.9    2e-13   
ref|XP_007360278.1|  ribosomal protein S9                             70.9    2e-13   
emb|CEJ92107.1|  Putative 30S ribosomal protein S9                    70.9    2e-13   
gb|KIK82309.1|  hypothetical protein PAXRUDRAFT_832289                70.9    2e-13   
gb|KIJ21808.1|  hypothetical protein PAXINDRAFT_165191                70.9    2e-13   
ref|XP_005646504.1|  40S ribosomal protein S16                        70.9    2e-13   
ref|XP_004204337.1|  Piso0_000177                                     70.9    2e-13   



>emb|CDO97194.1| unnamed protein product [Coffea canephora]
Length=144

 Score =   104 bits (259),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFE
Sbjct  2    AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFE  51



>ref|XP_011092558.1| PREDICTED: 40S ribosomal protein S16-like [Sesamum indicum]
Length=145

 Score =   103 bits (257),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAAA  ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFE
Sbjct  1    MAAATTESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFE  52



>ref|XP_004229156.1| PREDICTED: 40S ribosomal protein S16-like [Solanum lycopersicum]
 ref|XP_006365442.1| PREDICTED: 40S ribosomal protein S16-like [Solanum tuberosum]
Length=150

 Score =   102 bits (255),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/51 (96%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  80   AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAA VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFE
Sbjct  7    AAATVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFE  57



>ref|XP_009792138.1| PREDICTED: 40S ribosomal protein S16-like [Nicotiana sylvestris]
Length=148

 Score =   102 bits (254),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A+P+ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFE
Sbjct  6    ASPMESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFE  55



>ref|XP_004238675.1| PREDICTED: 40S ribosomal protein S16 [Solanum lycopersicum]
 ref|XP_006355978.1| PREDICTED: 40S ribosomal protein S16-like [Solanum tuberosum]
Length=147

 Score =   101 bits (252),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 51/54 (94%), Gaps = 2/54 (4%)
 Frame = +2

Query  77   MAAAP--VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            M AAP  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFE
Sbjct  1    MQAAPATVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFE  54



>ref|XP_009612267.1| PREDICTED: 40S ribosomal protein S16 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009612268.1| PREDICTED: 40S ribosomal protein S16 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009759825.1| PREDICTED: 40S ribosomal protein S16 [Nicotiana sylvestris]
Length=147

 Score =   101 bits (251),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 51/54 (94%), Gaps = 2/54 (4%)
 Frame = +2

Query  77   MAAAP--VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            M AAP  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFE
Sbjct  1    MNAAPAAVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFE  54



>ref|XP_011089620.1| PREDICTED: 40S ribosomal protein S16 [Sesamum indicum]
Length=144

 Score =   101 bits (251),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A P ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFE
Sbjct  2    ATPTESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFE  51



>gb|EPS67947.1| hypothetical protein M569_06824 [Genlisea aurea]
Length=144

 Score =   100 bits (249),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAP ESVQCFGRKKTAVAVT+CKRGRGLIKINGVPIEL+QPEILRYKAFE
Sbjct  2    AAPAESVQCFGRKKTAVAVTYCKRGRGLIKINGVPIELVQPEILRYKAFE  51



>ref|XP_009612269.1| PREDICTED: 40S ribosomal protein S16 [Nicotiana tomentosiformis]
Length=147

 Score = 99.8 bits (247),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 50/54 (93%), Gaps = 2/54 (4%)
 Frame = +2

Query  77   MAAAPV--ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            M AAP   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFE
Sbjct  1    MNAAPAAAESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFE  54



>ref|XP_004237264.1| PREDICTED: 40S ribosomal protein S16 [Solanum lycopersicum]
 ref|XP_006341850.1| PREDICTED: 40S ribosomal protein S16-like [Solanum tuberosum]
Length=147

 Score = 99.0 bits (245),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  80   AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAA  ESVQCFGRKKTAVAVTHCKRG+GLIKINGVPIEL+QPEILRYKA+E
Sbjct  4    AAATAESVQCFGRKKTAVAVTHCKRGKGLIKINGVPIELVQPEILRYKAYE  54



>ref|XP_010105611.1| 40S ribosomal protein S16 [Morus notabilis]
 gb|EXC51104.1| 40S ribosomal protein S16 [Morus notabilis]
Length=145

 Score = 99.0 bits (245),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAAAP ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFE
Sbjct  1    MAAAPTESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFE  52



>gb|KDP42492.1| hypothetical protein JCGZ_00289 [Jatropha curcas]
 gb|KDP42493.1| hypothetical protein JCGZ_00290 [Jatropha curcas]
Length=145

 Score = 98.6 bits (244),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAAAP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MAAAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  52



>ref|XP_009602130.1| PREDICTED: 40S ribosomal protein S16-like [Nicotiana tomentosiformis]
 ref|XP_009764504.1| PREDICTED: 40S ribosomal protein S16-like [Nicotiana sylvestris]
Length=147

 Score = 98.2 bits (243),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFE
Sbjct  6    ATAESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFE  54



>gb|EPS63821.1| hypothetical protein M569_10962, partial [Genlisea aurea]
Length=145

 Score = 98.2 bits (243),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  80   AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAA  ESVQCFGRKKTAVAVT+CKRGRGLIKINGVPIEL+QPEILRYKAFE
Sbjct  2    AAAAKESVQCFGRKKTAVAVTYCKRGRGLIKINGVPIELVQPEILRYKAFE  52



>ref|XP_009409231.1| PREDICTED: 40S ribosomal protein S16-like [Musa acuminata subsp. 
malaccensis]
Length=145

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAAA VESVQCFGRKKTAVAV HCKRGRGLIK+NGVPIEL++PEILR KAFE
Sbjct  1    MAAATVESVQCFGRKKTAVAVAHCKRGRGLIKVNGVPIELVKPEILRLKAFE  52



>ref|XP_010916936.1| PREDICTED: 40S ribosomal protein S16-like [Elaeis guineensis]
 ref|XP_010916937.1| PREDICTED: 40S ribosomal protein S16-like [Elaeis guineensis]
Length=145

 Score = 97.4 bits (241),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAAA  ESVQCFGRKKTAVAVT+CKRGRGLIK+NG PIEL++PEILRYKAFE
Sbjct  1    MAAAATESVQCFGRKKTAVAVTYCKRGRGLIKVNGSPIELVKPEILRYKAFE  52



>ref|XP_010066008.1| PREDICTED: 40S ribosomal protein S16 [Eucalyptus grandis]
 ref|XP_010028435.1| PREDICTED: 40S ribosomal protein S16 [Eucalyptus grandis]
 gb|KCW55181.1| hypothetical protein EUGRSUZ_I01133 [Eucalyptus grandis]
 gb|KCW55182.1| hypothetical protein EUGRSUZ_I01133 [Eucalyptus grandis]
Length=144

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAP+ESVQCFGRKKTAVAVT+CKRGRGLIKINGVPIEL++PEILR+KA+E
Sbjct  2    AAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGVPIELVEPEILRFKAYE  51



>ref|XP_010102433.1| 40S ribosomal protein S16 [Morus notabilis]
 gb|EXB93442.1| 40S ribosomal protein S16 [Morus notabilis]
Length=85

 Score = 95.5 bits (236),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKA  226
            MAAAP ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA
Sbjct  1    MAAAPTESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKA  50



>ref|XP_009390916.1| PREDICTED: 40S ribosomal protein S16-like [Musa acuminata subsp. 
malaccensis]
Length=149

 Score = 97.1 bits (240),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  80   AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A APVESVQCFGRKKTAVAV HCKRGRGLIK+NGVPIEL++PEILR KAFE
Sbjct  6    ATAPVESVQCFGRKKTAVAVAHCKRGRGLIKVNGVPIELVKPEILRLKAFE  56



>ref|XP_002300225.1| ribosomal protein S16 [Populus trichocarpa]
 ref|XP_011000124.1| PREDICTED: 40S ribosomal protein S16 [Populus euphratica]
 gb|ABK92774.1| unknown [Populus trichocarpa]
 gb|ABK93739.1| unknown [Populus trichocarpa]
 gb|ABK95393.1| unknown [Populus trichocarpa]
 gb|EEE85030.1| ribosomal protein S16 [Populus trichocarpa]
Length=146

 Score = 97.1 bits (240),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAP ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  4    AAPTESVQCFGRKKTAVAVTHCKRGRGLIKINGSPIELVEPEILRFKAYE  53



>ref|XP_007034683.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma 
cacao]
 gb|EOY05609.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma 
cacao]
Length=144

 Score = 96.7 bits (239),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAPVESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILRYKA+E
Sbjct  2    AAPVESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRYKAYE  51



>ref|XP_002312518.1| 40S ribosomal protein S16 [Populus trichocarpa]
 ref|XP_011026141.1| PREDICTED: 40S ribosomal protein S16 [Populus euphratica]
 gb|ABK92953.1| unknown [Populus trichocarpa]
 gb|ABK94067.1| unknown [Populus trichocarpa]
 gb|EEE89885.1| 40S ribosomal protein S16 [Populus trichocarpa]
Length=144

 Score = 96.7 bits (239),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAP ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  2    AAPTESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYE  51



>gb|AAF34799.1|AF227979_1 40S ribosomal protein S16 [Euphorbia esula]
Length=144

 Score = 96.3 bits (238),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  80   AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AA P ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    AATPTESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYE  51



>ref|XP_010255966.1| PREDICTED: 40S ribosomal protein S16-like [Nelumbo nucifera]
Length=144

 Score = 95.9 bits (237),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A P+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILRYKAFE
Sbjct  2    ATPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRYKAFE  51



>ref|XP_002314714.1| 40S ribosomal protein S16 [Populus trichocarpa]
 ref|XP_011021570.1| PREDICTED: 40S ribosomal protein S16 [Populus euphratica]
 gb|ABK92685.1| unknown [Populus trichocarpa]
 gb|EEF00885.1| 40S ribosomal protein S16 [Populus trichocarpa]
Length=144

 Score = 95.9 bits (237),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAP ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  2    AAPKESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYE  51



>sp|O22647.1|RS16_FRIAG RecName: Full=40S ribosomal protein S16 [Fritillaria agrestis]
 gb|AAB86856.1| ribosomal protein S16 [Fritillaria agrestis]
Length=145

 Score = 95.5 bits (236),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA    ESVQCFGRKKTAVAVTHCKRGRGLIK+NG PIEL++PEILRYKAFE
Sbjct  1    MATPATESVQCFGRKKTAVAVTHCKRGRGLIKVNGSPIELVKPEILRYKAFE  52



>ref|XP_008375886.1| PREDICTED: 40S ribosomal protein S16-like [Malus domestica]
Length=222

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  41   FLYSPRQRRTTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRY  220
            F YS +  +T  MA   +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+
Sbjct  66   FHYSIQSNQTLAMATPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRF  125

Query  221  KAFE  232
            KA+E
Sbjct  126  KAYE  129



>gb|ADR71284.1| 40S ribosomal protein S16B [Hevea brasiliensis]
Length=146

 Score = 95.5 bits (236),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  80   AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A+AP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  3    ASAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  53



>gb|EPS69719.1| hypothetical protein M569_05046, partial [Genlisea aurea]
Length=145

 Score = 95.5 bits (236),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 2/52 (4%)
 Frame = +2

Query  83   AAPV--ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAP   ESVQCFGRKKTAVAVT+CKRGRGLIKINGVPIEL+QPEILRYKAFE
Sbjct  1    AAPTATESVQCFGRKKTAVAVTYCKRGRGLIKINGVPIELVQPEILRYKAFE  52



>ref|XP_009623909.1| PREDICTED: 40S ribosomal protein S16-like [Nicotiana tomentosiformis]
Length=150

 Score = 95.5 bits (236),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ESVQCFGRKKTAVAVTHCKRG+GLIKINGVPIEL+QPEILRYKAFE
Sbjct  12   ESVQCFGRKKTAVAVTHCKRGKGLIKINGVPIELVQPEILRYKAFE  57



>gb|KCW63756.1| hypothetical protein EUGRSUZ_G01416 [Eucalyptus grandis]
Length=215

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAP+ESVQCFGRKKTAVAVT+CKRGRGLIKINGVPIEL++PEILR+KA+E
Sbjct  2    AAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGVPIELVEPEILRFKAYE  51



>ref|XP_002281350.1| PREDICTED: 40S ribosomal protein S16 [Vitis vinifera]
 emb|CAN75982.1| hypothetical protein VITISV_012186 [Vitis vinifera]
Length=144

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIELI+PEILR+KA+E
Sbjct  2    AAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELIEPEILRHKAYE  51



>emb|CBI26215.3| unnamed protein product [Vitis vinifera]
Length=161

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIELI+PEILR+KA+E
Sbjct  2    AAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELIEPEILRHKAYE  51



>ref|XP_004136973.1| PREDICTED: 40S ribosomal protein S16-like [Cucumis sativus]
 ref|XP_004140706.1| PREDICTED: 40S ribosomal protein S16-like [Cucumis sativus]
 ref|XP_004149967.1| PREDICTED: 40S ribosomal protein S16-like [Cucumis sativus]
 ref|XP_004159897.1| PREDICTED: 40S ribosomal protein S16-like [Cucumis sativus]
 ref|XP_004160469.1| PREDICTED: 40S ribosomal protein S16-like [Cucumis sativus]
 ref|XP_004161434.1| PREDICTED: 40S ribosomal protein S16-like [Cucumis sativus]
 ref|XP_008454961.1| PREDICTED: 40S ribosomal protein S16 [Cucumis melo]
 ref|XP_008456099.1| PREDICTED: 40S ribosomal protein S16 [Cucumis melo]
 ref|XP_008456141.1| PREDICTED: 40S ribosomal protein S16 [Cucumis melo]
 gb|KGN43920.1| hypothetical protein Csa_7G073560 [Cucumis sativus]
 gb|KGN57515.1| hypothetical protein Csa_3G202730 [Cucumis sativus]
 gb|KGN57574.1| hypothetical protein Csa_3G215620 [Cucumis sativus]
Length=144

 Score = 94.7 bits (234),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  2    AAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  51



>gb|ADR71283.1| 40S ribosomal protein S16A [Hevea brasiliensis]
Length=147

 Score = 94.7 bits (234),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  5    AAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  54



>ref|XP_001755340.1| predicted protein [Physcomitrella patens]
 ref|XP_001777866.1| predicted protein [Physcomitrella patens]
 gb|EDQ57294.1| predicted protein [Physcomitrella patens]
 gb|EDQ79820.1| predicted protein [Physcomitrella patens]
Length=144

 Score = 94.4 bits (233),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A P ESVQCFGRKKTAVAVT+CK+GRGLIKING PIEL++PEILRYKAFE
Sbjct  2    ATPTESVQCFGRKKTAVAVTYCKKGRGLIKINGCPIELVEPEILRYKAFE  51



>gb|ADR71285.1| 40S ribosomal protein S16C [Hevea brasiliensis]
Length=146

 Score = 94.0 bits (232),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  80   AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A+AP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEI R+KA+E
Sbjct  3    ASAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEIFRFKAYE  53



>ref|XP_002285101.1| PREDICTED: 40S ribosomal protein S16 [Vitis vinifera]
 emb|CAN72805.1| hypothetical protein VITISV_035308 [Vitis vinifera]
Length=144

 Score = 94.0 bits (232),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A+PVESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILRYKA E
Sbjct  2    ASPVESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRYKAVE  51



>gb|KJB79354.1| hypothetical protein B456_013G045400 [Gossypium raimondii]
Length=146

 Score = 94.0 bits (232),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AP+ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA E
Sbjct  5    APIESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAVE  53



>ref|XP_006422982.1| hypothetical protein CICLE_v10029508mg [Citrus clementina]
 ref|XP_006487042.1| PREDICTED: 40S ribosomal protein S16-like [Citrus sinensis]
 ref|XP_006487044.1| PREDICTED: 40S ribosomal protein S16-like [Citrus sinensis]
 gb|ESR36222.1| hypothetical protein CICLE_v10029508mg [Citrus clementina]
 gb|KDO35909.1| hypothetical protein CISIN_1g032049mg [Citrus sinensis]
Length=148

 Score = 94.0 bits (232),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A PVESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  6    AGPVESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  55



>gb|AEW43294.1| putative ribosomal protein S9, partial [Hevea brasiliensis]
Length=143

 Score = 93.6 bits (231),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    SAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  50



>gb|ABK22408.1| unknown [Picea sitchensis]
Length=151

 Score = 94.0 bits (232),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A V+SVQCFGRKKTAVAVT+CKRGRGLIKING PIELI+PEILRYKAFE
Sbjct  2    AAVDSVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELIEPEILRYKAFE  50



>ref|XP_008390856.1| PREDICTED: 40S ribosomal protein S16-like [Malus domestica]
 ref|XP_009364210.1| PREDICTED: 40S ribosomal protein S16-like [Pyrus x bretschneideri]
Length=145

 Score = 93.6 bits (231),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAA  +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MAAPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  52



>ref|XP_008383171.1| PREDICTED: 40S ribosomal protein S16 [Malus domestica]
 ref|XP_009338447.1| PREDICTED: 40S ribosomal protein S16 [Pyrus x bretschneideri]
Length=145

 Score = 93.6 bits (231),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAA  +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MAAPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  52



>gb|ABK23888.1| unknown [Picea sitchensis]
 gb|AFJ04416.1| putative ribosomal S16 [Picea wilsonii]
Length=143

 Score = 93.6 bits (231),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A V+SVQCFGRKKTAVAVT+CKRGRGLIKING PIELI+PEILRYKAFE
Sbjct  2    AAVDSVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELIEPEILRYKAFE  50



>ref|XP_007201870.1| hypothetical protein PRUPE_ppa012998mg [Prunus persica]
 ref|XP_010107915.1| 40S ribosomal protein S16 [Morus notabilis]
 gb|EMJ03069.1| hypothetical protein PRUPE_ppa012998mg [Prunus persica]
 gb|EXC17315.1| 40S ribosomal protein S16 [Morus notabilis]
Length=145

 Score = 93.6 bits (231),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAA  +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MAAPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  52



>ref|XP_008236476.1| PREDICTED: 40S ribosomal protein S16-like [Prunus mume]
Length=145

 Score = 93.6 bits (231),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAA  +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MAAPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  52



>ref|XP_009390299.1| PREDICTED: 40S ribosomal protein S16 [Musa acuminata subsp. malaccensis]
Length=145

 Score = 93.6 bits (231),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA A VESVQCFGRKKTAVAV HCK GRGLIK+NGVPIEL++PEILR KAFE
Sbjct  1    MATAAVESVQCFGRKKTAVAVAHCKGGRGLIKVNGVPIELVKPEILRLKAFE  52



>ref|XP_010926242.1| PREDICTED: 40S ribosomal protein S16-like [Elaeis guineensis]
Length=144

 Score = 93.2 bits (230),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AA  ESVQCFGRKKTAVAVT+CKRGRGLIK+NG PIEL++PEILRYKAFE
Sbjct  2    AAATESVQCFGRKKTAVAVTYCKRGRGLIKVNGSPIELVKPEILRYKAFE  51



>gb|ABK20993.1| unknown [Picea sitchensis]
 gb|ABK22272.1| unknown [Picea sitchensis]
 gb|ACN40265.1| unknown [Picea sitchensis]
Length=143

 Score = 93.2 bits (230),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A V+SVQCFGRKKTAVAVT+CKRGRGLIKING PIELI+PEILRYKAFE
Sbjct  2    AAVDSVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELIEPEILRYKAFE  50



>gb|KJB12247.1| hypothetical protein B456_002G008400 [Gossypium raimondii]
Length=145

 Score = 93.2 bits (230),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA   VESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA E
Sbjct  1    MAEKAVESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAVE  52



>ref|XP_009804322.1| PREDICTED: 40S ribosomal protein S16-like [Nicotiana sylvestris]
Length=154

 Score = 93.2 bits (230),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ESVQCFGRKKTAVAV+HCKRG+GL+KINGVPIEL+QPEILRYKAFE
Sbjct  16   ESVQCFGRKKTAVAVSHCKRGKGLMKINGVPIELVQPEILRYKAFE  61



>ref|XP_010277830.1| PREDICTED: 40S ribosomal protein S16-like [Nelumbo nucifera]
Length=144

 Score = 92.8 bits (229),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ++P+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  2    SSPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  51



>ref|XP_004296911.1| PREDICTED: 40S ribosomal protein S16 [Fragaria vesca subsp. vesca]
Length=145

 Score = 92.8 bits (229),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAA P++SVQCFGRKKTAVAVT+CK GRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MAAPPIKSVQCFGRKKTAVAVTYCKEGRGLIKINGCPIELVEPEILRFKAYE  52



>ref|XP_008780865.1| PREDICTED: 40S ribosomal protein S16-like [Phoenix dactylifera]
Length=144

 Score = 92.8 bits (229),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AA  ESVQCFGRKKTAVAVT+CKRGRGLIK+NG PIEL++PEILRYKAFE
Sbjct  2    AAASESVQCFGRKKTAVAVTYCKRGRGLIKVNGSPIELVKPEILRYKAFE  51



>ref|XP_010270291.1| PREDICTED: 40S ribosomal protein S16 [Nelumbo nucifera]
Length=143

 Score = 92.8 bits (229),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A VESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILRYKA+E
Sbjct  2    AAVESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRYKAYE  50



>gb|KJB31216.1| hypothetical protein B456_005G236900 [Gossypium raimondii]
Length=145

 Score = 92.4 bits (228),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA   +ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA E
Sbjct  1    MAEKAIESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAVE  52



>sp|P46293.1|RS16_GOSHI RecName: Full=40S ribosomal protein S16 [Gossypium hirsutum]
 emb|CAA53567.1| RS16 protein, 40S subunit [Gossypium hirsutum]
Length=145

 Score = 92.4 bits (228),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA   +ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA E
Sbjct  1    MAEKAIESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAVE  52



>ref|XP_010263487.1| PREDICTED: 40S ribosomal protein S16-like [Nelumbo nucifera]
Length=143

 Score = 92.4 bits (228),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A VESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILRYKA+E
Sbjct  2    AAVESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRYKAYE  50



>ref|XP_009393541.1| PREDICTED: 40S ribosomal protein S16-like [Musa acuminata subsp. 
malaccensis]
Length=145

 Score = 92.4 bits (228),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA A V+SVQCFGRKKTAVAV HCKRGRGLIK+NGVPIEL++PEIL  KAFE
Sbjct  1    MATAAVDSVQCFGRKKTAVAVAHCKRGRGLIKVNGVPIELVKPEILGLKAFE  52



>ref|XP_010524961.1| PREDICTED: 40S ribosomal protein S16-1-like [Tarenaya hassleriana]
Length=146

 Score = 92.4 bits (228),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 48/53 (91%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P VESVQCFGRKKTAVAVT+CKRG GLIKING PIELIQPEILR+KAFE
Sbjct  1    MATQPAVESVQCFGRKKTAVAVTYCKRGSGLIKINGCPIELIQPEILRFKAFE  53



>ref|XP_010551554.1| PREDICTED: 40S ribosomal protein S16-1-like [Tarenaya hassleriana]
 ref|XP_010553878.1| PREDICTED: 40S ribosomal protein S16-1-like [Tarenaya hassleriana]
Length=146

 Score = 92.0 bits (227),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 48/53 (91%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAA P VESVQCFGRKKTAVAVT+CKRG GLIKING PIELIQPEILR+K FE
Sbjct  1    MAAQPAVESVQCFGRKKTAVAVTYCKRGSGLIKINGCPIELIQPEILRFKVFE  53



>ref|XP_010528603.1| PREDICTED: 40S ribosomal protein S16-1-like [Tarenaya hassleriana]
Length=146

 Score = 92.0 bits (227),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 48/53 (91%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAA P VESVQCFGRKKTAVAVT+CKRG GLIKING PIELIQPEILR+K FE
Sbjct  1    MAAQPAVESVQCFGRKKTAVAVTYCKRGSGLIKINGCPIELIQPEILRFKVFE  53



>ref|XP_008373839.1| PREDICTED: 40S ribosomal protein S16-like [Malus domestica]
 ref|XP_008364534.1| PREDICTED: 40S ribosomal protein S16 [Malus domestica]
Length=145

 Score = 92.0 bits (227),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA   +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MATPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  52



>ref|XP_007226006.1| hypothetical protein PRUPE_ppa012996mg [Prunus persica]
 ref|XP_008222957.1| PREDICTED: 40S ribosomal protein S16 [Prunus mume]
 gb|EMJ27205.1| hypothetical protein PRUPE_ppa012996mg [Prunus persica]
Length=145

 Score = 92.0 bits (227),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA   +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MATPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  52



>ref|XP_001777696.1| predicted protein [Physcomitrella patens]
 gb|EDQ57476.1| predicted protein [Physcomitrella patens]
Length=144

 Score = 91.7 bits (226),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A+  ESVQCFGRKKTAVAVT+CK+GRGLIKING PIEL++PEILRYKAFE
Sbjct  2    ASTTESVQCFGRKKTAVAVTYCKKGRGLIKINGCPIELVEPEILRYKAFE  51



>gb|KHG18721.1| 40S ribosomal S16 [Gossypium arboreum]
 gb|KJB77662.1| hypothetical protein B456_012G149700 [Gossypium raimondii]
Length=146

 Score = 91.7 bits (226),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA E
Sbjct  5    APIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAVE  53



>ref|XP_006419873.1| hypothetical protein CICLE_v10006162mg [Citrus clementina]
 ref|XP_006489340.1| PREDICTED: 40S ribosomal protein S16-like [Citrus sinensis]
 gb|ESR33113.1| hypothetical protein CICLE_v10006162mg [Citrus clementina]
 gb|KDO74722.1| hypothetical protein CISIN_1g032125mg [Citrus sinensis]
Length=147

 Score = 91.3 bits (225),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  80   AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AA   ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFE
Sbjct  4    AAPKTESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFE  54



>ref|XP_001780940.1| predicted protein [Physcomitrella patens]
 gb|EDQ54278.1| predicted protein [Physcomitrella patens]
Length=144

 Score = 91.3 bits (225),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A   ESVQCFGRKKTAVAVT+CK+GRGLIKING PIEL++PEILRYKAFE
Sbjct  2    ATATESVQCFGRKKTAVAVTYCKKGRGLIKINGCPIELVEPEILRYKAFE  51



>ref|XP_010694150.1| PREDICTED: 40S ribosomal protein S16-like [Beta vulgaris subsp. 
vulgaris]
Length=147

 Score = 91.3 bits (225),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 2/54 (4%)
 Frame = +2

Query  77   MAAAP--VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAA P  + SVQCFGRKKTAVAVT+CK GRGLIKING PIEL+QPEILRYK FE
Sbjct  1    MAATPPPIHSVQCFGRKKTAVAVTYCKTGRGLIKINGTPIELVQPEILRYKVFE  54



>ref|XP_002518738.1| ribosomal protein S9, putative [Ricinus communis]
 gb|EEF43663.1| ribosomal protein S9, putative [Ricinus communis]
Length=151

 Score = 90.9 bits (224),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 7/57 (12%)
 Frame = +2

Query  83   AAPV-------ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAPV       ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  2    AAPVATTPSQTESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYE  58



>ref|XP_010420587.1| PREDICTED: 40S ribosomal protein S16-3-like [Camelina sativa]
 ref|XP_010434945.1| PREDICTED: 40S ribosomal protein S16-3-like [Camelina sativa]
 ref|XP_010440282.1| PREDICTED: 40S ribosomal protein S16-3-like [Camelina sativa]
 ref|XP_010454073.1| PREDICTED: 40S ribosomal protein S16-3-like [Camelina sativa]
Length=146

 Score = 90.9 bits (224),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P VESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FE
Sbjct  1    MATQPAVESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKVFE  53



>ref|XP_010549634.1| PREDICTED: 40S ribosomal protein S16-1 [Tarenaya hassleriana]
Length=146

 Score = 90.5 bits (223),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 47/53 (89%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P VESVQCFGRKKTAVAVT+CKRG GLIKING PIELIQPEILR+K FE
Sbjct  1    MATQPAVESVQCFGRKKTAVAVTYCKRGSGLIKINGCPIELIQPEILRFKVFE  53



>ref|XP_006400383.1| hypothetical protein EUTSA_v10014948mg [Eutrema salsugineum]
 gb|ESQ41836.1| hypothetical protein EUTSA_v10014948mg [Eutrema salsugineum]
Length=146

 Score = 90.5 bits (223),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P VESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FE
Sbjct  1    MATQPAVESVQCFGRKKTAVAVTHCKRGSGLIKLNGSPIELFQPEILRFKIFE  53



>ref|XP_006408213.1| hypothetical protein EUTSA_v10021712mg [Eutrema salsugineum]
 gb|ESQ49666.1| hypothetical protein EUTSA_v10021712mg [Eutrema salsugineum]
Length=146

 Score = 90.5 bits (223),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 47/53 (89%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA+ P VESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FE
Sbjct  1    MASKPAVESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELYQPEILRFKIFE  53



>ref|XP_008795884.1| PREDICTED: 40S ribosomal protein S16 [Phoenix dactylifera]
 ref|XP_010906569.1| PREDICTED: 40S ribosomal protein S16 [Elaeis guineensis]
Length=142

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
             ESVQCFGRKKTAVAVT+CKRGRGLIK+NG PIEL++PEILRYKAFE
Sbjct  3    TESVQCFGRKKTAVAVTYCKRGRGLIKVNGSPIELVKPEILRYKAFE  49



>ref|XP_010449924.1| PREDICTED: 40S ribosomal protein S16-3 [Camelina sativa]
 ref|XP_010492838.1| PREDICTED: 40S ribosomal protein S16-3 [Camelina sativa]
Length=146

 Score = 90.5 bits (223),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P VESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FE
Sbjct  1    MATQPAVESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFE  53



>ref|XP_010928344.1| PREDICTED: 40S ribosomal protein S16 [Elaeis guineensis]
Length=142

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
             ESVQCFGRKKTAVAVT+CKRGRGLIK+NG PIEL++PEILRYKAFE
Sbjct  3    TESVQCFGRKKTAVAVTYCKRGRGLIKVNGSPIELVKPEILRYKAFE  49



>ref|XP_002527855.1| ribosomal protein S9, putative [Ricinus communis]
 gb|EEF34558.1| ribosomal protein S9, putative [Ricinus communis]
Length=152

 Score = 90.5 bits (223),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
             ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  13   TESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYE  59



>ref|XP_004290594.1| PREDICTED: 40S ribosomal protein S16-like [Fragaria vesca subsp. 
vesca]
Length=148

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 3/55 (5%)
 Frame = +2

Query  77   MAAAPV---ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAAA V   ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MAAAVVPSKESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYE  55



>ref|XP_007160464.1| hypothetical protein PHAVU_002G324300g [Phaseolus vulgaris]
 gb|ESW32458.1| hypothetical protein PHAVU_002G324300g [Phaseolus vulgaris]
Length=147

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  80   AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AA  +E VQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFE
Sbjct  4    AAPALEQVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFE  54



>ref|XP_006284710.1| hypothetical protein CARUB_v10005968mg [Capsella rubella]
 ref|XP_006288853.1| hypothetical protein CARUB_v10002207mg [Capsella rubella]
 gb|EOA17608.1| hypothetical protein CARUB_v10005968mg [Capsella rubella]
 gb|EOA21751.1| hypothetical protein CARUB_v10002207mg [Capsella rubella]
Length=146

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P VESVQCFGRKKTAVAVTHCKRG G+IK+NG PIEL QPEILR+K FE
Sbjct  1    MATQPAVESVQCFGRKKTAVAVTHCKRGSGMIKLNGCPIELFQPEILRFKVFE  53



>ref|XP_001775963.1| predicted protein [Physcomitrella patens]
 gb|EDQ59155.1| predicted protein [Physcomitrella patens]
Length=143

 Score = 89.7 bits (221),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A VESVQCFGRKKTAVAVT+CK+G GLIKING PIEL++PEILRYKAFE
Sbjct  2    AAVESVQCFGRKKTAVAVTYCKKGLGLIKINGCPIELVEPEILRYKAFE  50



>ref|XP_006840429.1| hypothetical protein AMTR_s00045p00161540 [Amborella trichopoda]
 gb|ERN02104.1| hypothetical protein AMTR_s00045p00161540 [Amborella trichopoda]
Length=151

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  68   TTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
             + MA   +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL+  +ILRYKA+E
Sbjct  4    ASSMATEAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELMSSDILRYKAYE  58



>gb|KFK37850.1| hypothetical protein AALP_AA3G037300 [Arabis alpina]
Length=145

 Score = 89.7 bits (221),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA A  ESVQCFGRKKTAVAVTHCKRG G+IK+NG PIEL QPEILR+K FE
Sbjct  1    MATAAKESVQCFGRKKTAVAVTHCKRGSGMIKLNGSPIELHQPEILRFKIFE  52



>ref|XP_008788842.1| PREDICTED: 40S ribosomal protein S16-like [Phoenix dactylifera]
Length=142

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
             +SVQCFGRKKTAVAVT+CKRGRGLIK+NG PIEL++PEILRYKAFE
Sbjct  3    TDSVQCFGRKKTAVAVTYCKRGRGLIKVNGSPIELVKPEILRYKAFE  49



>ref|NP_001190330.1| 40S ribosomal protein S16-3 [Arabidopsis thaliana]
 gb|AED92548.1| 40S ribosomal protein S16-3 [Arabidopsis thaliana]
Length=139

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FE
Sbjct  1    MATQPATESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFE  53



>ref|XP_003518703.1| PREDICTED: 40S ribosomal protein S16-like [Glycine max]
Length=156

 Score = 89.4 bits (220),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A +E VQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFE
Sbjct  15   AALEQVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFE  63



>ref|NP_001078601.1| 40S ribosomal protein S16-3 [Arabidopsis thaliana]
 gb|AED92547.1| 40S ribosomal protein S16-3 [Arabidopsis thaliana]
Length=144

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FE
Sbjct  1    MATQPATESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFE  53



>ref|NP_197339.1| 40S ribosomal protein S16-3 [Arabidopsis thaliana]
 sp|Q42340.1|RS163_ARATH RecName: Full=40S ribosomal protein S16-3 [Arabidopsis thaliana]
 gb|AAK43993.1|AF370178_1 putative 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AAL15244.1| putative 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AED92546.1| 40S ribosomal protein S16-3 [Arabidopsis thaliana]
Length=146

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FE
Sbjct  1    MATQPATESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFE  53



>ref|XP_010558732.1| PREDICTED: 40S ribosomal protein S16-1-like [Tarenaya hassleriana]
Length=146

 Score = 89.0 bits (219),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            VESVQCFGRKKTAVAVT+CKRG GLIKING PIELIQPEILR+K FE
Sbjct  7    VESVQCFGRKKTAVAVTYCKRGSGLIKINGCPIELIQPEILRFKVFE  53



>ref|NP_178826.1| 40S ribosomal protein S16-1 [Arabidopsis thaliana]
 sp|Q9SK22.1|RS161_ARATH RecName: Full=40S ribosomal protein S16-1 [Arabidopsis thaliana]
 gb|AAK49582.1|AF370576_1 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AAD22696.1| 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AAM63947.1| 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AEC06138.1| 40S ribosomal protein S16-1 [Arabidopsis thaliana]
Length=146

 Score = 89.0 bits (219),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FE
Sbjct  1    MATQPATESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFE  53



>ref|XP_007042464.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma 
cacao]
 gb|EOX98295.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma 
cacao]
Length=146

 Score = 89.0 bits (219),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA E
Sbjct  5    ASIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAVE  53



>ref|XP_006298754.1| hypothetical protein CARUB_v10014854mg [Capsella rubella]
 gb|EOA31652.1| hypothetical protein CARUB_v10014854mg [Capsella rubella]
Length=146

 Score = 88.6 bits (218),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  ESVQCFGRKKTAVAVTHCKRG G+IK+NG PIEL QPEILRYK FE
Sbjct  1    MATQPAKESVQCFGRKKTAVAVTHCKRGTGMIKLNGSPIELHQPEILRYKIFE  53



>ref|XP_002873890.1| 40S ribosomal protein S16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50149.1| 40S ribosomal protein S16 [Arabidopsis lyrata subsp. lyrata]
Length=146

 Score = 88.6 bits (218),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FE
Sbjct  5    AAAESVQCFGRKKTAVAVTHCKRGSGLIKLNGSPIELFQPEILRFKIFE  53



>ref|XP_004505243.1| PREDICTED: 40S ribosomal protein S16-like [Cicer arietinum]
Length=99

 Score = 87.0 bits (214),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRKK AVAVT+CKRGRGLIKING PIELI+PEILR+KAFE
Sbjct  4    LEQVQCFGRKKNAVAVTYCKRGRGLIKINGAPIELIEPEILRFKAFE  50



>ref|XP_010689120.1| PREDICTED: 40S ribosomal protein S16-like [Beta vulgaris subsp. 
vulgaris]
Length=149

 Score = 88.2 bits (217),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            V SVQCFGRKKTAVAVT+CK GRGLIKING PIEL+QPEILRYK FE
Sbjct  10   VHSVQCFGRKKTAVAVTYCKTGRGLIKINGTPIELVQPEILRYKVFE  56



>ref|XP_010695861.1| PREDICTED: 40S ribosomal protein S16 [Beta vulgaris subsp. vulgaris]
Length=149

 Score = 88.2 bits (217),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            V SVQCFGRKKTAVAVT+CK GRGLIKING PIEL+QPEILRYK FE
Sbjct  10   VHSVQCFGRKKTAVAVTYCKTGRGLIKINGTPIELVQPEILRYKVFE  56



>ref|XP_003530932.1| PREDICTED: 40S ribosomal protein S16-like [Glycine max]
Length=155

 Score = 88.2 bits (217),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFE
Sbjct  16   IEQVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFE  62



>ref|XP_007153584.1| hypothetical protein PHAVU_003G047800g [Phaseolus vulgaris]
 gb|ESW25578.1| hypothetical protein PHAVU_003G047800g [Phaseolus vulgaris]
Length=146

 Score = 88.2 bits (217),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFE
Sbjct  7    LEQVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFE  53



>ref|XP_004505244.1| PREDICTED: 40S ribosomal protein S16-like [Cicer arietinum]
Length=143

 Score = 87.8 bits (216),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRKK AVAVT+CKRGRGLIKING PIELI+PEILR+KAFE
Sbjct  4    LEQVQCFGRKKNAVAVTYCKRGRGLIKINGAPIELIEPEILRFKAFE  50



>ref|XP_002994222.1| hypothetical protein SELMODRAFT_138369 [Selaginella moellendorffii]
 gb|EFJ04727.1| hypothetical protein SELMODRAFT_138369 [Selaginella moellendorffii]
Length=144

 Score = 87.8 bits (216),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AA ++SVQCFGRKKTAVAVT+CK+GRGLIKING PIEL++PEILR+KA E
Sbjct  2    AAAIQSVQCFGRKKTAVAVTYCKKGRGLIKINGCPIELVEPEILRFKAVE  51



>ref|XP_010413003.1| PREDICTED: 40S ribosomal protein S16-1-like isoform X1 [Camelina 
sativa]
 ref|XP_010413060.1| PREDICTED: 40S ribosomal protein S16-1-like isoform X2 [Camelina 
sativa]
 ref|XP_010463899.1| PREDICTED: 40S ribosomal protein S16-1 [Camelina sativa]
 ref|XP_010485793.1| PREDICTED: 40S ribosomal protein S16-1-like isoform X1 [Camelina 
sativa]
 ref|XP_010485794.1| PREDICTED: 40S ribosomal protein S16-1-like isoform X2 [Camelina 
sativa]
Length=146

 Score = 87.8 bits (216),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FE
Sbjct  1    MATQPAKESVQCFGRKKTAVAVTHCKRGTGLIKLNGSPIELHQPEILRFKIFE  53



>gb|KFK26075.1| hypothetical protein AALP_AA8G199800 [Arabis alpina]
Length=146

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ESVQCFGRKKTAVAVTHCKRG G+IK+NG PIEL+QPEILR+K FE
Sbjct  8    ESVQCFGRKKTAVAVTHCKRGTGMIKLNGSPIELLQPEILRFKVFE  53



>ref|XP_003616020.1| 40S ribosomal protein S16 [Medicago truncatula]
 gb|AES98978.1| 30S ribosomal protein S9P [Medicago truncatula]
Length=140

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRKK AVAVTHCKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MEQVQCFGRKKNAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYE  47



>gb|ACJ86025.1| unknown [Medicago truncatula]
Length=140

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRKK AVAVTHCKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MEQVQCFGRKKNAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYE  47



>gb|ACJ85555.1| unknown [Medicago truncatula]
Length=140

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRKK AVAVTHCKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MEQVQCFGRKKNAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYE  47



>ref|XP_006856488.1| hypothetical protein AMTR_s00046p00076360 [Amborella trichopoda]
 gb|ERN17955.1| hypothetical protein AMTR_s00046p00076360 [Amborella trichopoda]
Length=148

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  80   AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A   VESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL+  +ILRYKA+E
Sbjct  5    AVQAVESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELMSSDILRYKAYE  55



>ref|XP_003631001.1| 40S ribosomal protein S16 [Medicago truncatula]
 ref|XP_003631007.1| 40S ribosomal protein S16 [Medicago truncatula]
 gb|AET05477.1| 30S ribosomal protein S9P [Medicago truncatula]
 gb|AET05483.1| 30S ribosomal protein S9P [Medicago truncatula]
 gb|AFK47743.1| unknown [Medicago truncatula]
Length=140

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRKK AVAVTHCKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MEQVQCFGRKKNAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYE  47



>ref|NP_001235533.1| uncharacterized protein LOC100527911 [Glycine max]
 gb|ACU17122.1| unknown [Glycine max]
Length=157

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            E VQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFE
Sbjct  19   EQVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFE  64



>ref|XP_004489247.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Cicer arietinum]
Length=181

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
             + +E VQCFGRKK AVAVTHCK+GRGLIKING PIELI+PEILR+KA+E
Sbjct  39   GSKMEQVQCFGRKKNAVAVTHCKKGRGLIKINGSPIELIEPEILRFKAYE  88



>ref|XP_004489248.1| PREDICTED: 40S ribosomal protein S16-like isoform X2 [Cicer arietinum]
 ref|XP_004489249.1| PREDICTED: 40S ribosomal protein S16-like isoform X3 [Cicer arietinum]
Length=140

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRKK AVAVTHCK+GRGLIKING PIELI+PEILR+KA+E
Sbjct  1    MEQVQCFGRKKNAVAVTHCKKGRGLIKINGSPIELIEPEILRFKAYE  47



>gb|KHN21629.1| 40S ribosomal protein S16 [Glycine soja]
Length=157

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            E VQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFE
Sbjct  19   EQVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFE  64



>ref|XP_003607926.1| 40S ribosomal protein S16-1 [Medicago truncatula]
 gb|AES90123.1| 30S ribosomal protein S9P [Medicago truncatula]
 gb|AFK45246.1| unknown [Medicago truncatula]
 gb|AFK48830.1| unknown [Medicago truncatula]
Length=143

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRKK AVAVT+CKRGRGLIKING PIEL++PEILR+KAFE
Sbjct  4    LEQVQCFGRKKNAVAVTYCKRGRGLIKINGAPIELVEPEILRFKAFE  50



>gb|ACJ85531.1| unknown [Medicago truncatula]
Length=143

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRKK AVAVT+CKRGRGLIKING PIEL++PEILR+KAFE
Sbjct  4    LEQVQCFGRKKNAVAVTYCKRGRGLIKINGAPIELVEPEILRFKAFE  50



>ref|XP_004503325.1| PREDICTED: 40S ribosomal protein S16-like [Cicer arietinum]
 ref|XP_004503326.1| PREDICTED: 40S ribosomal protein S16-like [Cicer arietinum]
Length=140

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRKK AVAVTHCK+GRGLIKING PIELI+PEILR+KA+E
Sbjct  1    MEQVQCFGRKKNAVAVTHCKKGRGLIKINGCPIELIEPEILRFKAYE  47



>gb|ABW89384.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89385.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89386.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89387.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89388.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89389.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89390.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89391.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89392.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89393.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89394.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89395.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89396.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89397.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89398.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89399.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89400.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89402.1| 40S ribosomal protein S16, partial [Helianthus annuus]
Length=135

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  107  CFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            CFGRKKTAVAVTHCK GRGLIKINGVPIEL+QPEILRYKAFE
Sbjct  1    CFGRKKTAVAVTHCKAGRGLIKINGVPIELVQPEILRYKAFE  42



>emb|CDY29988.1| BnaC01g40200D [Brassica napus]
Length=146

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  ESVQCFGRKKTAVAVTHCKRG G+IK+NG PIEL QPEILR+K FE
Sbjct  1    MATKPANESVQCFGRKKTAVAVTHCKRGCGMIKLNGSPIELFQPEILRFKIFE  53



>ref|XP_009404058.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=146

 Score = 86.3 bits (212),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  +SVQCFGRKKTAVAV HCKRGRGLIK+NGVPIEL++PEIL  KAFE
Sbjct  5    AATDSVQCFGRKKTAVAVAHCKRGRGLIKVNGVPIELVKPEILCLKAFE  53



>gb|AFK46930.1| unknown [Medicago truncatula]
Length=140

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRK+ AVAVTHCKRGRGLIKING PIEL++PEILR+KA+E
Sbjct  1    MEQVQCFGRKRNAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYE  47



>ref|XP_002884433.1| 40S ribosomal protein S16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60692.1| 40S ribosomal protein S16 [Arabidopsis lyrata subsp. lyrata]
Length=146

 Score = 85.9 bits (211),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA+ P  ESVQCFGRKKTAVAVTHCKRG G+IK+NG PIEL QPEILR+K  E
Sbjct  1    MASQPAKESVQCFGRKKTAVAVTHCKRGSGMIKLNGSPIELHQPEILRFKILE  53



>gb|AFK36270.1| unknown [Lotus japonicus]
Length=140

 Score = 85.5 bits (210),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E VQCFGRKK AVAVT+CKRGRGLIKI+G PIELI+PEILR+KAFE
Sbjct  1    MEQVQCFGRKKNAVAVTYCKRGRGLIKIDGSPIELIEPEILRFKAFE  47



>emb|CDY24915.1| BnaC03g22570D [Brassica napus]
Length=147

 Score = 85.5 bits (210),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL  PEILR+K FE
Sbjct  1    MATKPAAESVQCFGRKKTAVAVTHCKRGCGLIKLNGCPIELFNPEILRFKIFE  53



>ref|XP_009107873.1| PREDICTED: 40S ribosomal protein S16-3-like [Brassica rapa]
Length=176

 Score = 85.9 bits (211),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL  PEILR+K FE
Sbjct  30   MATKPAAESVQCFGRKKTAVAVTHCKRGCGLIKLNGCPIELFNPEILRFKIFE  82



>ref|XP_006392218.1| hypothetical protein EUTSA_v10023899mg, partial [Eutrema salsugineum]
 gb|ESQ29504.1| hypothetical protein EUTSA_v10023899mg, partial [Eutrema salsugineum]
Length=132

 Score = 84.3 bits (207),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +ESVQC GRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FE
Sbjct  3    IESVQCLGRKKTAVAVTHCKRGPGLIKLNGSPIELFQPEILRFKIFE  49



>ref|NP_187073.1| 40S ribosomal protein S16-2 [Arabidopsis thaliana]
 sp|Q9M8X9.1|RS162_ARATH RecName: Full=40S ribosomal protein S16-2 [Arabidopsis thaliana]
 gb|AAF26790.1|AC016829_14 putative 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AAO44026.1| At3g04230 [Arabidopsis thaliana]
 dbj|BAF00141.1| putative 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AEE74055.1| 40S ribosomal protein S16-2 [Arabidopsis thaliana]
Length=146

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  ESVQCFGRKKTA AVT+CKRG G+IK+NG PIEL QPEILR+K FE
Sbjct  1    MATQPAKESVQCFGRKKTATAVTYCKRGSGMIKLNGSPIELYQPEILRFKIFE  53



>ref|XP_002515268.1| hypothetical protein RCOM_1346810 [Ricinus communis]
 gb|EEF47252.1| hypothetical protein RCOM_1346810 [Ricinus communis]
Length=91

 Score = 82.8 bits (203),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKA  226
            ESVQCF RKKTAV VTHCKRGRGLIKING PIEL++PEILR+KA
Sbjct  20   ESVQCFVRKKTAVVVTHCKRGRGLIKINGCPIELVEPEILRFKA  63



>sp|Q9XEK7.1|RS16_TORRU RecName: Full=40S ribosomal protein S16 [Syntrichia ruralis]
 gb|AAD23965.1|AF108725_1 ribosomal protein S16 [Syntrichia ruralis]
Length=142

 Score = 83.6 bits (205),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 1/49 (2%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A VESVQCFGRKKTAVAVT+C+RGRGLI++  VPIEL++PEILRYKAFE
Sbjct  2    AAVESVQCFGRKKTAVAVTYCRRGRGLIRLT-VPIELVEPEILRYKAFE  49



>ref|NP_001065632.1| Os11g0127900 [Oryza sativa Japonica Group]
 ref|NP_001066039.1| Os12g0124200 [Oryza sativa Japonica Group]
 sp|Q0IQF7.1|RS16_ORYSJ RecName: Full=40S ribosomal protein S16 [Oryza sativa Japonica 
Group]
 sp|A2ZB00.1|RS16_ORYSI RecName: Full=40S ribosomal protein S16 [Oryza sativa Indica 
Group]
 pdb|3J60|Q Chain Q, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|ABA91285.1| 40S ribosomal protein S16, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABA95713.1| 40S ribosomal protein S16, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27477.1| Os11g0127900 [Oryza sativa Japonica Group]
 dbj|BAF29058.1| Os12g0124200 [Oryza sativa Japonica Group]
 gb|EAY79784.1| hypothetical protein OsI_34940 [Oryza sativa Indica Group]
 gb|EAY82113.1| hypothetical protein OsI_37311 [Oryza sativa Indica Group]
 gb|EAZ17271.1| hypothetical protein OsJ_32790 [Oryza sativa Japonica Group]
 dbj|BAG86780.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87028.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00522.1| unnamed protein product [Oryza sativa Japonica Group]
Length=149

 Score = 83.6 bits (205),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 4/56 (7%)
 Frame = +2

Query  77   MAAA----PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAAA    P  +VQCFGRKKTAVAV++CK GRGLIK+NGVPIELI+PE+LR KAFE
Sbjct  1    MAAALTRPPPGTVQCFGRKKTAVAVSYCKPGRGLIKVNGVPIELIRPEMLRLKAFE  56



>emb|CCX13673.1| Similar to 40S ribosomal protein S16; acc. no. Q759L8 [Pyronema 
omphalodes CBS 100304]
Length=146

 Score = 83.2 bits (204),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            APV+SVQCFG+KKTA AV HCK G+GL+K+NG PI L++PEILR+KA+E
Sbjct  5    APVQSVQCFGKKKTATAVAHCKAGKGLLKVNGQPIHLVKPEILRFKAYE  53



>tpe|CBF70472.1| TPA: 40S ribosomal protein S16 (Broad) [Aspergillus nidulans 
FGSC A4]
Length=143

 Score = 83.2 bits (204),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A V SVQCFG+KKTA AV HCK+G+GLIK+NG P++L+QPEILR+KA+E
Sbjct  2    ASVPSVQCFGKKKTATAVAHCKQGKGLIKVNGQPLQLVQPEILRFKAYE  50



>ref|XP_001244905.1| 40S ribosomal protein S16 [Coccidioides immitis RS]
 ref|XP_003071847.1| 40S ribosomal protein S16 [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EER29702.1| 40S ribosomal protein S16, putative [Coccidioides posadasii C735 
delta SOWgp]
 gb|EAS33322.3| 40S ribosomal protein S16 [Coccidioides immitis RS]
Length=143

 Score = 83.2 bits (204),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 2/52 (4%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAA P  SVQCFG+KKTA AV HCK+GRGLIK+NG PI L+QPEILR+K +E
Sbjct  1    MAAVP--SVQCFGKKKTATAVAHCKQGRGLIKVNGQPISLVQPEILRFKVYE  50



>ref|XP_006662696.1| PREDICTED: 40S ribosomal protein S16-like, partial [Oryza brachyantha]
Length=141

 Score = 83.2 bits (204),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  89   PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            P  +VQCFGRKKTAVAV++CK GRGLIK+NGVPIELI+PE+LR KAFE
Sbjct  1    PAGTVQCFGRKKTAVAVSYCKPGRGLIKVNGVPIELIRPEMLRLKAFE  48



>emb|CDY21134.1| BnaA01g33650D [Brassica napus]
Length=146

 Score = 83.2 bits (204),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  +SVQCFGRKKTAVAVTHCK G GLIK+NG PIEL QPEILR+K FE
Sbjct  1    MATKPAKQSVQCFGRKKTAVAVTHCKPGCGLIKLNGSPIELFQPEILRFKIFE  53



>emb|CDY25423.1| BnaC09g39380D [Brassica napus]
Length=146

 Score = 83.2 bits (204),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  ESVQCFGRKKTAVAVTHCKRG G IK+NG PIEL  PEILR+K FE
Sbjct  1    MATKPAAESVQCFGRKKTAVAVTHCKRGCGQIKLNGCPIELFNPEILRFKIFE  53



>emb|CDY61186.1| BnaAnng17430D [Brassica napus]
Length=120

 Score = 82.4 bits (202),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  ESVQCFGRKKTAVAVTHCKRG G IK+NG PIEL  PEILR+K FE
Sbjct  1    MATKPAAESVQCFGRKKTAVAVTHCKRGCGQIKLNGCPIELFNPEILRFKIFE  53



>ref|XP_002835431.1| 40S ribosomal protein S16 [Tuber melanosporum Mel28]
 emb|CAZ79588.1| unnamed protein product [Tuber melanosporum]
Length=144

 Score = 82.8 bits (203),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A P +SVQCFG+KKTA AV HCK+GRGL+K+NG P+ L++PEILR+K +E
Sbjct  2    ATPTQSVQCFGKKKTATAVAHCKKGRGLVKVNGSPLNLVKPEILRFKVYE  51



>emb|CDX92061.1| BnaC03g33630D [Brassica napus]
Length=146

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ESVQCFGRKKTAVAVTHC+RG GLIK+NG PIEL  PEILR+K FE
Sbjct  8    ESVQCFGRKKTAVAVTHCRRGCGLIKLNGCPIELFNPEILRFKIFE  53



>ref|XP_009125004.1| PREDICTED: 40S ribosomal protein S16-3 [Brassica rapa]
 emb|CDY42912.1| BnaC05g47390D [Brassica napus]
Length=146

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  +SVQCFGRKKTAVAVTHCK G G+IK+NG PIEL QPEILR+K FE
Sbjct  1    MATKPAKQSVQCFGRKKTAVAVTHCKPGCGMIKLNGSPIELFQPEILRFKIFE  53



>ref|XP_002542077.1| 40S ribosomal protein S16 [Uncinocarpus reesii 1704]
 gb|EEP76744.1| 40S ribosomal protein S16 [Uncinocarpus reesii 1704]
Length=143

 Score = 82.0 bits (201),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 2/52 (4%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAA P  SVQCFG+KKTA AV HCK+G+GLIK+NG PI L+QPEILR+K +E
Sbjct  1    MAAVP--SVQCFGKKKTATAVAHCKQGKGLIKVNGQPISLVQPEILRFKVYE  50



>gb|EFW13750.1| 40S ribosomal protein S9 [Coccidioides posadasii str. Silveira]
Length=220

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +2

Query  68   TTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +  MAA P  SVQCFG+KKTA AV HCK+GRGLIK+NG PI L+QPEILR+K +E
Sbjct  75   SANMAAVP--SVQCFGKKKTATAVAHCKQGRGLIKVNGQPISLVQPEILRFKVYE  127



>gb|AAA33916.1| ribosomal protein S16 [Oryza sativa Indica Group]
 prf||2111468A ribosomal protein S16
Length=149

 Score = 81.6 bits (200),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 4/56 (7%)
 Frame = +2

Query  77   MAAA----PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MAAA    P  +VQCFGRKK AVAV++CK GRGLIK+NGVPIELI+PE+LR KAFE
Sbjct  1    MAAALTRPPPGTVQCFGRKKAAVAVSYCKPGRGLIKVNGVPIELIRPEMLRLKAFE  56



>gb|KHJ31540.1| putative 40s ribosomal protein s16 [Erysiphe necator]
Length=143

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AP +SVQCFG+KKTA AV HCK G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    APSQSVQCFGKKKTATAVAHCKAGKGLIKVNGKPLHLVQPEILRFKVYE  50



>gb|KIW85180.1| 40S ribosomal protein S16 [Fonsecaea pedrosoi CBS 271.37]
Length=143

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILRYK +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLIKVNGKPLSLVQPEILRYKVYE  50



>emb|CDY49352.1| BnaA05g33140D [Brassica napus]
Length=146

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  +SVQCFGRKKTAVAVTHCK G G+IK+NG PIEL QPEILR+K +E
Sbjct  1    MATKPAKQSVQCFGRKKTAVAVTHCKPGCGMIKLNGSPIELFQPEILRFKIYE  53



>ref|XP_007746508.1| 40S ribosomal protein S16 [Cladophialophora psammophila CBS 110553]
 gb|EXJ68798.1| 40S ribosomal protein S16 [Cladophialophora psammophila CBS 110553]
Length=143

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +  +SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILRYK +E
Sbjct  2    SATQSVQCFGKKKTATAVAHCKKGKGLIKVNGRPLSLVQPEILRYKVYE  50



>ref|XP_009120979.1| PREDICTED: 40S ribosomal protein S16-3-like [Brassica rapa]
Length=146

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  ESVQCFGRKKTAVAVTHCKRG G I +NG PIEL  PEILR+K FE
Sbjct  1    MATKPAAESVQCFGRKKTAVAVTHCKRGCGQIMLNGCPIELFNPEILRFKIFE  53



>ref|XP_001208887.1| 40S ribosomal protein S16 [Aspergillus terreus NIH2624]
 ref|XP_001826200.1| 40S ribosomal protein S16 [Aspergillus oryzae RIB40]
 ref|XP_002377873.1| 40S ribosomal protein S16 [Aspergillus flavus NRRL3357]
 dbj|BAE65067.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EAU38279.1| 40S ribosomal protein S16 [Aspergillus terreus NIH2624]
 gb|EED52709.1| 40S ribosomal protein Rps16, putative [Aspergillus flavus NRRL3357]
 gb|EIT74199.1| 40S ribosomal protein [Aspergillus oryzae 3.042]
 gb|KDE75828.1| 40S ribosomal protein [Aspergillus oryzae 100-8]
Length=143

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A V SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    ASVPSVQCFGKKKTATAVAHCKQGKGLIKVNGQPLSLVQPEILRFKVYE  50



>gb|KIY00823.1| 40S ribosomal protein S16 [Fonsecaea multimorphosa CBS 102226]
Length=143

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILRYK +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLIKVNGRPLSLVQPEILRYKVYE  50



>gb|KIW57063.1| 40S ribosomal protein S16 [Exophiala xenobiotica]
Length=143

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILRYK +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLIKVNGRPLSLVQPEILRYKVYE  50



>gb|KIW32566.1| 40S ribosomal protein S16 [Cladophialophora immunda]
Length=143

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILRYK +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLIKVNGRPLSLVQPEILRYKVYE  50



>ref|XP_001275347.1| 40S ribosomal protein S16 [Aspergillus clavatus NRRL 1]
 gb|EAW13921.1| 40S ribosomal protein S9 [Aspergillus clavatus NRRL 1]
Length=143

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A V SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    ASVPSVQCFGKKKTATAVAHCKQGKGLIKVNGQPLSLVQPEILRFKVYE  50



>ref|XP_755383.1| 40S ribosomal protein Rps16 [Aspergillus fumigatus Af293]
 gb|EAL93345.1| 40S ribosomal protein Rps16, putative [Aspergillus fumigatus 
Af293]
 gb|EDP54570.1| 40S ribosomal protein S9 [Aspergillus fumigatus A1163]
 gb|KEY81471.1| 40S ribosomal protein Rps16 [Aspergillus fumigatus var. RP-2014]
Length=143

 Score = 80.5 bits (197),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A V SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    ASVPSVQCFGKKKTATAVAHCKQGKGLIKVNGQPLSLVQPEILRFKVYE  50



>ref|XP_007832090.1| 40S ribosomal protein S16 [Pestalotiopsis fici W106-1]
 gb|ETS83442.1| 40S ribosomal protein S16 [Pestalotiopsis fici W106-1]
Length=143

 Score = 80.1 bits (196),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AP +SVQCFG+KKTA AV HCK G GLIK+NG P+ L+QP+ILR+K +E
Sbjct  2    APTQSVQCFGKKKTATAVAHCKSGSGLIKVNGQPLSLVQPQILRFKVYE  50



>ref|XP_009124006.1| PREDICTED: 40S ribosomal protein S16-3-like [Brassica rapa]
Length=146

 Score = 80.1 bits (196),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = +2

Query  77   MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA  P  +SVQCFGRKKTAVAVTHCK G G+IK+NG PIEL QPEILR+K +E
Sbjct  1    MATKPAKQSVQCFGRKKTAVAVTHCKPGCGMIKLNGSPIELSQPEILRFKIYE  53



>ref|XP_002565995.1| Pc22g20980 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP99386.1| Pc22g20980 [Penicillium rubens Wisconsin 54-1255]
Length=143

 Score = 80.1 bits (196),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A V SVQCFG+KKTA AV HCK+G+GL+K+NG P+ L+QPEILR+K +E
Sbjct  2    ASVPSVQCFGKKKTATAVAHCKQGKGLVKVNGQPLSLVQPEILRFKVYE  50



>ref|XP_004341583.1| ribosomal protein S9, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR19497.1| ribosomal protein S9, putative [Acanthamoeba castellanii str. 
Neff]
Length=150

 Score = 80.1 bits (196),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  80   AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A AP +SVQ FGRKKTAVAV   K GRGLIKING PIEL++PE+LRYK FE
Sbjct  7    ATAPKKSVQTFGRKKTAVAVAFVKAGRGLIKINGSPIELVEPEVLRYKVFE  57



>gb|EKV09594.1| 40S ribosomal protein Rps16, putative [Penicillium digitatum 
Pd1]
 gb|EKV14873.1| 40S ribosomal protein Rps16, putative [Penicillium digitatum 
PHI26]
 emb|CDM27610.1| Ribosomal protein S9 [Penicillium roqueforti FM164]
 gb|KGO41464.1| Ribosomal protein S9 [Penicillium expansum]
 gb|KGO59719.1| Ribosomal protein S9 [Penicillium expansum]
 gb|KGO62278.1| Ribosomal protein S9 [Penicillium expansum]
 gb|KGO77020.1| Ribosomal protein S5 domain 2-type fold, subgroup [Penicillium 
italicum]
Length=143

 Score = 80.1 bits (196),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A V SVQCFG+KKTA AV HCK+G+GL+K+NG P+ L+QPEILR+K +E
Sbjct  2    ASVPSVQCFGKKKTATAVAHCKQGKGLVKVNGQPLSLVQPEILRFKVYE  50



>gb|EYE97512.1| ribosomal protein S9 [Aspergillus ruber CBS 135680]
Length=143

 Score = 79.7 bits (195),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A V SVQCFG+KKTA AV HCK+G+GL+K+NG P+ L+QPEILR+K +E
Sbjct  2    ASVPSVQCFGKKKTATAVAHCKQGKGLVKVNGQPLSLVQPEILRFKVYE  50



>ref|XP_007804760.1| 40S ribosomal protein S16 [Endocarpon pusillum Z07020]
 gb|ERF69503.1| 40S ribosomal protein S16 [Endocarpon pusillum Z07020]
Length=143

 Score = 79.7 bits (195),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 2/52 (4%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            MA+ P  SVQCFG+KKTA AV HCK+G+GL+K+NG P+ L+QPEILR+K +E
Sbjct  1    MASTP--SVQCFGKKKTATAVAHCKKGKGLVKVNGKPLSLVQPEILRFKVYE  50



>ref|XP_007729768.1| 40S ribosomal protein S16 [Capronia epimyces CBS 606.96]
 gb|EXJ92878.1| 40S ribosomal protein S16 [Capronia epimyces CBS 606.96]
Length=143

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLIKVNGKPLSLVQPEILRFKVYE  50



>ref|XP_003045227.1| 40S ribosomal protein S16 [Nectria haematococca mpVI 77-13-4]
 gb|EEU39514.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=143

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +  +SVQCFG+KKTA AV HCK GRGLIK+NG P++L+QPEILR+K +E
Sbjct  2    STTQSVQCFGKKKTATAVAHCKTGRGLIKVNGRPLQLVQPEILRFKVYE  50



>dbj|GAD93775.1| 40S ribosomal protein S16 [Byssochlamys spectabilis No. 5]
Length=143

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  +SVQCFG+KKTA AV HCK G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    ASTQSVQCFGKKKTATAVAHCKAGKGLIKVNGQPLSLVQPEILRFKVYE  50



>gb|KEQ80503.1| ribosomal protein S9 [Aureobasidium pullulans EXF-150]
Length=143

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +SVQCFG+KKTA AV HCK+G+GLIK+NG PI L+QPEILR+K +E
Sbjct  5    QSVQCFGKKKTATAVAHCKQGQGLIKVNGQPISLVQPEILRFKVYE  50



>ref|XP_001260529.1| 40S ribosomal protein S16 [Neosartorya fischeri NRRL 181]
 gb|EAW18632.1| 40S ribosomal protein S9 [Neosartorya fischeri NRRL 181]
Length=143

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A V SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    ASVPSVQCFGKKKTATAVAHCKQGKGLIKVNGQPLGLVQPEILRFKVYE  50



>gb|KIV84862.1| 40S ribosomal protein S16-B [Exophiala sideris]
Length=143

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLIKVNGQPLSLVQPEILRFKVYE  50



>gb|KEQ75559.1| ribosomal protein S9 [Aureobasidium pullulans var. namibiae CBS 
147.97]
 gb|KEQ96121.1| hypothetical protein AUEXF2481DRAFT_97105 [Aureobasidium subglaciale 
EXF-2481]
Length=143

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +SVQCFG+KKTA AV HCK+G+GLIK+NG PI L+QPEILR+K +E
Sbjct  5    QSVQCFGKKKTATAVAHCKQGQGLIKVNGQPISLVQPEILRFKVYE  50



>gb|KEQ63880.1| ribosomal protein S9 [Aureobasidium melanogenum CBS 110374]
Length=143

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +SVQCFG+KKTA AV HCK+G+GLIK+NG PI L+QPEILR+K +E
Sbjct  5    QSVQCFGKKKTATAVAHCKQGQGLIKVNGQPISLVQPEILRFKVYE  50



>ref|XP_009251551.1| hypothetical protein FPSE_00156 [Fusarium pseudograminearum CS3096]
 gb|EKJ79702.1| hypothetical protein FPSE_00156 [Fusarium pseudograminearum CS3096]
Length=189

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  68   TTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            TT    +   SVQCFG+KKTA AV HCK G+GLIK+NG P++L+QPEILR+K +E
Sbjct  42   TTTAIMSSTNSVQCFGKKKTATAVAHCKAGKGLIKVNGRPLQLVQPEILRFKVYE  96



>ref|XP_006677977.1| hypothetical protein BATDEDRAFT_33120 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF81289.1| hypothetical protein BATDEDRAFT_33120 [Batrachochytrium dendrobatidis 
JAM81]
Length=144

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A   E+VQCFGRKKTA AV HCKRG GLIKING P+EL++PEILR K +E
Sbjct  2    ANMTEAVQCFGRKKTATAVAHCKRGTGLIKINGSPLELVEPEILRAKVYE  51



>emb|CCE27535.1| probable RPS16B-ribosomal protein S16.e [Claviceps purpurea 20.1]
Length=144

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ++  +SVQCFG+KKTA AV HCK GRGLIK+NG P+ L+QPEILR+K +E
Sbjct  2    SSTTQSVQCFGKKKTATAVAHCKAGRGLIKVNGRPLSLVQPEILRFKVYE  51



>emb|CDH52735.1| 40s ribosomal protein s16 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=157

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A +E+VQ FGRKKTA AV HCKRGRGLI++NG P+EL++PEIL++K +E
Sbjct  16   ANMEAVQTFGRKKTATAVAHCKRGRGLIRVNGSPLELLEPEILKFKVYE  64



>ref|XP_009131657.1| PREDICTED: 40S ribosomal protein S16-3-like isoform X1 [Brassica 
rapa]
 ref|XP_009131658.1| PREDICTED: 40S ribosomal protein S16-3-like isoform X2 [Brassica 
rapa]
 emb|CDY51232.1| BnaA03g07060D [Brassica napus]
 emb|CDX70812.1| BnaC03g08960D [Brassica napus]
Length=146

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  +SVQCFGRKKTAVAVTHCK G G+IK+NG PIEL  PEILR+K FE
Sbjct  5    AAKQSVQCFGRKKTAVAVTHCKPGCGMIKLNGSPIELFNPEILRFKIFE  53



>dbj|GAM90516.1| hypothetical protein ANO11243_085600 [fungal sp. No.11243]
Length=144

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            AAP +SVQCFG+KKTA AV HCK G+GL+K+NG P+ L++P++LR+K +E
Sbjct  2    AAPTQSVQCFGKKKTATAVAHCKAGKGLVKVNGRPLSLVEPQVLRFKVYE  51



>gb|KIW47833.1| 40S ribosomal protein S16 [Exophiala oligosperma]
Length=143

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLIKVNGRPLSLVQPEILRFKVYE  50



>gb|KIM94888.1| hypothetical protein OIDMADRAFT_21207 [Oidiodendron maius Zn]
Length=144

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A+  +SVQCFG+KKTA AV HCK G+GL+K+NG P+ L+QPEILR+K +E
Sbjct  2    ASTTQSVQCFGKKKTATAVAHCKAGKGLVKVNGKPLNLVQPEILRFKVYE  51



>dbj|BAK02829.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89526.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS51991.1| 40S ribosomal protein S16 [Triticum urartu]
 gb|EMT17257.1| 40S ribosomal protein S16 [Aegilops tauschii]
Length=149

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  98   SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +VQCFGRKKTAVAV +CK GRGLIK+NG PIELI+PE+LR KAFE
Sbjct  12   TVQCFGRKKTAVAVAYCKPGRGLIKVNGAPIELIRPEMLRLKAFE  56



>gb|EWY85270.1| 40S ribosomal protein S16 [Fusarium oxysporum FOSC 3-a]
Length=127

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +SVQCFG+KKTA AV HCK GRGLIK+NG P+ L+QPEILR+K +E
Sbjct  4    QSVQCFGKKKTATAVAHCKAGRGLIKVNGRPLSLVQPEILRFKVYE  49



>dbj|BAJ85048.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=149

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  98   SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +VQCFGRKKTAVAV +CK GRGLIK+NG PIELI+PE+LR KAFE
Sbjct  12   TVQCFGRKKTAVAVAYCKPGRGLIKVNGAPIELIRPEMLRLKAFE  56



>ref|XP_009134755.1| PREDICTED: 40S ribosomal protein S16-3-like [Brassica rapa]
Length=146

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  98   SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            SVQCFGRKKTAVAVTHCK G GLIK+NG PIEL  PEILR+K FE
Sbjct  9    SVQCFGRKKTAVAVTHCKPGCGLIKLNGSPIELFNPEILRFKIFE  53



>ref|XP_006963581.1| hypothetical protein TRIREDRAFT_46490 [Trichoderma reesei QM6a]
 gb|EGR50154.1| hypothetical protein TRIREDRAFT_46490 [Trichoderma reesei QM6a]
 gb|ETS03792.1| ribosomal protein S9 [Trichoderma reesei RUT C-30]
Length=143

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +  +SVQCFG+KKTA AV HCK GRGLIK+NG P+ L+QPEILR+K +E
Sbjct  2    SSTQSVQCFGKKKTATAVAHCKAGRGLIKVNGRPLSLVQPEILRFKVYE  50



>gb|KIW17179.1| 40S ribosomal protein S16 [Exophiala spinifera]
Length=143

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLIKVNGRPLSLVQPEILRFKVYE  50



>ref|XP_007818672.1| hypothetical protein MAA_02483 [Metarhizium robertsii ARSEF 23]
 gb|EFZ02901.1| hypothetical protein MAA_02483 [Metarhizium robertsii ARSEF 23]
 gb|EXV06156.1| 40S ribosomal protein S9/S16 [Metarhizium robertsii]
Length=144

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ++  +SVQCFG+KKTA AV HCK GRGL+K+NG P+ L+QPEILR+K +E
Sbjct  2    SSTTQSVQCFGKKKTATAVAHCKAGRGLVKVNGRPLSLVQPEILRFKVYE  51



>emb|CDY70652.1| BnaA03g57330D [Brassica napus]
Length=146

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  98   SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            SVQCFGRKKTAVAVTHCK G GLIK+NG PIEL  PEILR+K FE
Sbjct  9    SVQCFGRKKTAVAVTHCKPGCGLIKLNGCPIELFNPEILRFKIFE  53



>ref|XP_003577865.1| PREDICTED: 40S ribosomal protein S16 [Brachypodium distachyon]
Length=149

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  98   SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +VQCFGRKKTAVAV +CK GRGLIK+NG PIELI+PE+LR KAFE
Sbjct  12   TVQCFGRKKTAVAVAYCKPGRGLIKVNGAPIELIRPEMLRLKAFE  56



>ref|XP_007807991.1| 30S ribosomal protein S9 [Metarhizium acridum CQMa 102]
 gb|EFY92380.1| 30S ribosomal protein S9 [Metarhizium acridum CQMa 102]
 gb|KFG82459.1| 30S ribosomal protein S9 [Metarhizium anisopliae]
 gb|KID62299.1| hypothetical protein MAN_08303, partial [Metarhizium anisopliae 
ARSEF 549]
 gb|KID92605.1| hypothetical protein MGU_00194 [Metarhizium guizhouense ARSEF 
977]
Length=144

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ++  +SVQCFG+KKTA AV HCK GRGL+K+NG P+ L+QPEILR+K +E
Sbjct  2    SSTTQSVQCFGKKKTATAVAHCKAGRGLVKVNGRPLSLVQPEILRFKVYE  51



>gb|KIL86733.1| 30s ribosomal protein s9 [Fusarium avenaceum]
Length=143

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
             SVQCFG+KKTA AV HCK GRGLIK+NG P++L+QPEILR+K +E
Sbjct  5    NSVQCFGKKKTATAVAHCKAGRGLIKVNGRPLQLVQPEILRFKVYE  50



>gb|EPS28897.1| hypothetical protein PDE_03843 [Penicillium oxalicum 114-2]
Length=143

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A   SVQCFG+KKTA AV HCK G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    ASTASVQCFGKKKTATAVAHCKAGKGLIKVNGQPLSLVQPEILRFKVYE  50



>gb|KIX02816.1| 40S ribosomal protein S16 [Rhinocladiella mackenziei CBS 650.93]
Length=143

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLIKVNGRPLALVQPEILRFKVYE  50



>ref|XP_001399741.1| 40S ribosomal protein S16 [Aspergillus niger CBS 513.88]
 emb|CAK37653.1| unnamed protein product [Aspergillus niger]
 gb|EHA22962.1| hypothetical protein ASPNIDRAFT_197350 [Aspergillus niger ATCC 
1015]
 dbj|GAA82143.1| 40S ribosomal protein S9 [Aspergillus kawachii IFO 4308]
Length=143

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A V SVQCFG+KKTA AV HCK+G+G+I++NG P+ L+QPEILR+K +E
Sbjct  2    ASVPSVQCFGKKKTATAVAHCKQGKGMIRVNGQPLSLVQPEILRFKVYE  50



>gb|KIW66708.1| 40S ribosomal protein S16 [Capronia semiimmersa]
Length=143

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GL+K+NG P+ L+QPEILR+K +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLVKVNGQPLNLVQPEILRFKVYE  50



>emb|CCT73613.1| probable RPS16B-ribosomal protein S16.e [Fusarium fujikuroi IMI 
58289]
Length=142

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +SVQCFG+KKTA AV HCK GRGLIK+NG P+ L+QPEILR+K +E
Sbjct  4    QSVQCFGKKKTATAVAHCKAGRGLIKVNGRPLSLVQPEILRFKVYE  49



>gb|KID78369.1| Ribosomal protein S9, partial [Metarhizium brunneum ARSEF 3297]
Length=144

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ++  +SVQCFG+KKTA AV HCK GRGL+K+NG P+ L+QPEILR+K +E
Sbjct  2    SSTTQSVQCFGKKKTATAVAHCKAGRGLVKVNGRPLSLVQPEILRFKVYE  51



>gb|ELR06410.1| 40S ribosomal protein S16 [Pseudogymnoascus destructans 20631-21]
 gb|KFY27375.1| hypothetical protein V493_03540 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
 gb|KFY50613.1| hypothetical protein V496_09289 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY85379.1| hypothetical protein V500_08477 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
 gb|KFY97497.1| hypothetical protein V498_02032 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=144

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A+  +SVQCFG+KKTA AV HCK G+GL+K+NG P+ LIQPEILR+K +E
Sbjct  2    ASTSQSVQCFGKKKTATAVAHCKAGKGLVKVNGKPLNLIQPEILRFKLYE  51



>emb|CEF98090.1| Ribosomal protein S9, conserved site [Ostreococcus tauri]
Length=143

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  98   SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            SVQ FGRKKTAVAV HCKRG+GLI++NGVPI+LIQP+ LR KA E
Sbjct  6    SVQTFGRKKTAVAVAHCKRGKGLIRLNGVPIDLIQPDTLRLKAVE  50



>ref|XP_009161029.1| 40S ribosomal protein S16 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY60568.1| 40S ribosomal protein S16 [Exophiala dermatitidis NIH/UT8656]
Length=143

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLIKVNGRPLALVQPEILRFKVYE  50



>gb|EMT65947.1| 40S ribosomal protein S16 [Fusarium oxysporum f. sp. cubense 
race 4]
 gb|ENH75116.1| 40S ribosomal protein S16 [Fusarium oxysporum f. sp. cubense 
race 1]
 gb|EWZ35722.1| 40S ribosomal protein S16 [Fusarium oxysporum Fo47]
 gb|EWZ96282.1| 40S ribosomal protein S16 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA37850.1| 40S ribosomal protein S16 [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK30131.1| 40S ribosomal protein S16 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK90259.1| 40S ribosomal protein S16 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL55260.1| 40S ribosomal protein S16 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL81778.1| 40S ribosomal protein S16 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM05646.1| 40S ribosomal protein S16 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM27202.1| 40S ribosomal protein S16 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=133

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +SVQCFG+KKTA AV HCK GRGLIK+NG P+ L+QPEILR+K +E
Sbjct  4    QSVQCFGKKKTATAVAHCKAGRGLIKVNGRPLSLVQPEILRFKVYE  49



>gb|KFY16535.1| hypothetical protein V492_01253 [Pseudogymnoascus pannorum VKM 
F-4246]
 gb|KFY34215.1| hypothetical protein V494_06969 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=188

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A+  +SVQCFG+KKTA AV HCK G+GL+K+NG P+ LIQPEILR+K +E
Sbjct  46   ASTSQSVQCFGKKKTATAVAHCKAGKGLVKVNGKPLNLIQPEILRFKLYE  95



>ref|XP_001798536.1| hypothetical protein SNOG_08214 [Phaeosphaeria nodorum SN15]
 gb|EAT84490.2| hypothetical protein SNOG_08214 [Phaeosphaeria nodorum SN15]
Length=193

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  53   PRQRRTTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            P  R  T+      +SVQCFG+KKTA AV HCK G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  41   PHARILTQSPIMASQSVQCFGKKKTATAVAHCKAGKGLIKVNGKPLSLVQPEILRFKVYE  100



>gb|EWG51312.1| 40S ribosomal protein S16 [Fusarium verticillioides 7600]
Length=142

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
             +SVQCFG+KKTA AV HCK GRGLIK+NG P+ L+QPEILR+K +E
Sbjct  3    TQSVQCFGKKKTATAVAHCKAGRGLIKVNGRPLSLVQPEILRFKVYE  49



>gb|EXX61063.1| ribosomal 40S subunit protein S16A [Rhizophagus irregularis DAOM 
197198w]
 gb|EXX61064.1| ribosomal 40S subunit protein S16A [Rhizophagus irregularis DAOM 
197198w]
 gb|EXX61065.1| ribosomal 40S subunit protein S16A [Rhizophagus irregularis DAOM 
197198w]
 gb|EXX61066.1| ribosomal 40S subunit protein S16A [Rhizophagus irregularis DAOM 
197198w]
Length=142

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ESVQ +GRKKTA AV HCKRG+GLIKING PI L++PEILR+K +E
Sbjct  4    ESVQTYGRKKTATAVAHCKRGKGLIKINGSPIHLVEPEILRFKVYE  49



>ref|XP_007932485.1| hypothetical protein MYCFIDRAFT_60541 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME76843.1| hypothetical protein MYCFIDRAFT_60541 [Pseudocercospora fijiensis 
CIRAD86]
Length=143

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A V+SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L++P++LR+K +E
Sbjct  2    AAVQSVQCFGKKKTATAVAHCKQGKGLIKVNGKPLSLVEPQVLRFKVYE  50



>gb|ESA22278.1| hypothetical protein GLOINDRAFT_342744, partial [Rhizophagus 
irregularis DAOM 181602]
Length=137

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ESVQ +GRKKTA AV HCKRG+GLIKING PI L++PEILR+K +E
Sbjct  4    ESVQTYGRKKTATAVAHCKRGKGLIKINGSPIHLVEPEILRFKVYE  49



>ref|XP_008729424.1| 40S ribosomal protein S16 [Cladophialophora carrionii CBS 160.54]
 gb|ETI22807.1| 40S ribosomal protein S16 [Cladophialophora carrionii CBS 160.54]
Length=143

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GL+K+NG P+ L+QPEILR+K +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLVKVNGRPLNLVQPEILRFKVYE  50



>gb|EIE79686.1| 40S ribosomal protein S16 [Rhizopus delemar RA 99-880]
 gb|EIE87914.1| 40S ribosomal protein S16 [Rhizopus delemar RA 99-880]
 emb|CEG79844.1| Putative 40S ribosomal protein S16 [Rhizopus microsporus]
 emb|CEG74055.1| Putative 40S ribosomal protein S16 [Rhizopus microsporus]
 emb|CEG63589.1| Putative 40S ribosomal protein S16 [Rhizopus microsporus]
 emb|CEJ02528.1| Putative 40S ribosomal protein S16 [Rhizopus microsporus]
 emb|CEI97109.1| Putative 40S ribosomal protein S16 [Rhizopus microsporus]
 emb|CEI88407.1| Putative 40S ribosomal protein S16 [Rhizopus microsporus]
Length=140

 Score = 77.8 bits (190),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E+VQ FGRKKTA AV HCKRGRGLI+ING P+EL++PEIL++K +E
Sbjct  1    MEAVQTFGRKKTATAVAHCKRGRGLIRINGSPLELLEPEILKFKVYE  47



>ref|XP_007757836.1| 40S ribosomal protein S16 [Cladophialophora yegresii CBS 114405]
 gb|EXJ58213.1| 40S ribosomal protein S16 [Cladophialophora yegresii CBS 114405]
Length=143

 Score = 78.2 bits (191),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GL+K+NG P+ L+QPEILR+K +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLVKVNGRPLNLVQPEILRFKVYE  50



>gb|EQL03131.1| Ribosomal protein S9 [Ophiocordyceps sinensis CO18]
Length=144

 Score = 78.2 bits (191),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ++  +SVQCFG+K+TA AV HCK GRGLIK+NG P++L+QPEILR+K +E
Sbjct  2    SSTTQSVQCFGKKRTATAVAHCKAGRGLIKVNGRPLKLVQPEILRFKVYE  51



>ref|XP_007294963.1| 40S ribosomal protein S16 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD14863.1| 40S ribosomal protein S16 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=143

 Score = 77.8 bits (190),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  +SVQCFG+KKTA AV HCK G+GL+K+NG P+ L+QPEILR+K +E
Sbjct  2    ASSQSVQCFGKKKTATAVAHCKAGKGLVKVNGKPLNLVQPEILRFKVYE  50



>gb|EHK46585.1| hypothetical protein TRIATDRAFT_256508 [Trichoderma atroviride 
IMI 206040]
Length=143

 Score = 77.8 bits (190),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +  +SVQCFG+KKTA AV HCK GRGL+K+NG P+ L+QPEILR+K +E
Sbjct  2    SSTQSVQCFGKKKTATAVAHCKAGRGLVKVNGRPLSLVQPEILRFKVYE  50



>gb|EIE78170.1| 40S ribosomal protein S16 [Rhizopus delemar RA 99-880]
 gb|EIE86999.1| 40S ribosomal protein S16 [Rhizopus delemar RA 99-880]
Length=140

 Score = 77.8 bits (190),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E+VQ FGRKKTA AV HCKRGRGLI+ING P+EL++PEIL++K +E
Sbjct  1    MEAVQTFGRKKTATAVAHCKRGRGLIRINGSPLELLEPEILKFKVYE  47



>gb|EHK19908.1| hypothetical protein TRIVIDRAFT_83253 [Trichoderma virens Gv29-8]
Length=144

 Score = 77.8 bits (190),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +   +SVQCFG+KKTA AV HCK GRGLIK+NG P+ L+QPE+LR+K +E
Sbjct  2    STTTQSVQCFGKKKTATAVAHCKAGRGLIKVNGRPLSLVQPEVLRFKVYE  51



>gb|KFY72802.1| hypothetical protein V499_07066 [Pseudogymnoascus pannorum VKM 
F-103]
 gb|KFZ05774.1| hypothetical protein V501_08049 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=184

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A+  +SVQCFG+KKTA AV HCK G+GL+K+NG P+ LIQPEILR+K +E
Sbjct  42   ASTSQSVQCFGKKKTATAVAHCKAGKGLVKVNGKPLNLIQPEILRFKLYE  91



>gb|KDB16501.1| 30S ribosomal protein S9 [Ustilaginoidea virens]
Length=144

 Score = 77.8 bits (190),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ++  +SVQCFG+KKTA AV HCK G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    SSTTQSVQCFGKKKTATAVAHCKAGKGLIKVNGRPLSLVQPEILRFKVYE  51



>gb|KFZ07922.1| hypothetical protein V502_09659 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=198

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A+  +SVQCFG+KKTA AV HCK G+GL+K+NG P+ LIQPEILR+K +E
Sbjct  56   ASTSQSVQCFGKKKTATAVAHCKAGKGLVKVNGKPLNLIQPEILRFKLYE  105



>ref|XP_001598002.1| 40S ribosomal protein S16 [Sclerotinia sclerotiorum 1980 UF-70]
 gb|EDN90688.1| 40S ribosomal protein S16 [Sclerotinia sclerotiorum 1980 UF-70]
Length=143

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  +SVQCFG+KKTA AV HCK G+GL+K+NG P+ L+QPE+LR+K +E
Sbjct  2    ASTQSVQCFGKKKTATAVAHCKAGKGLVKVNGKPLNLVQPEVLRFKVYE  50



>gb|ABX44789.1| putative 40S ribosomal protein RPS16 [Flustra foliacea]
Length=148

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
             PV+SVQ FGRKKTA AV+HCKRG GL+K+NG P+EL++P  LRYK  E
Sbjct  7    GPVQSVQVFGRKKTATAVSHCKRGNGLMKVNGRPLELVEPATLRYKLLE  55



>emb|CDH54149.1| 40s ribosomal protein s16 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS13198.1| Putative 40S ribosomal protein S16 [Absidia idahoensis var. thermophila]
 emb|CDS09865.1| Putative 40S ribosomal protein S16 [Absidia idahoensis var. thermophila]
Length=140

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E+VQ FGRKKTA AV HCKRGRGLI++NG P+EL++PEIL++K +E
Sbjct  1    MEAVQTFGRKKTATAVAHCKRGRGLIRVNGSPLELLEPEILKFKVYE  47



>ref|XP_011321495.1| 40S ribosomal protein S16 [Fusarium graminearum PH-1]
 gb|ESU08996.1| 40S ribosomal protein S16 [Fusarium graminearum PH-1]
 gb|EYB32385.1| hypothetical protein FG05_04136 [Fusarium graminearum]
 emb|CEF79091.1| unnamed protein product [Fusarium graminearum]
Length=143

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +   SVQCFG+KKTA AV HCK G+GLIK+NG P++L+QPEILR+K +E
Sbjct  2    SSTNSVQCFGKKKTATAVAHCKAGKGLIKVNGRPLQLVQPEILRFKVYE  50



>ref|XP_011124562.1| hypothetical protein AOL_s00097g427 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX46797.1| hypothetical protein AOL_s00097g427 [Arthrobotrys oligospora 
ATCC 24927]
Length=143

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +  +SVQCFG+KKTA AV HCK G+GL+K+NG P+ L+QPEILR+K +E
Sbjct  2    STTQSVQCFGKKKTATAVAHCKAGKGLVKVNGSPLSLVQPEILRFKVYE  50



>ref|XP_002126231.1| PREDICTED: 40S ribosomal protein S16-like [Ciona intestinalis]
Length=145

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            M +   +SVQ +GRKKTA AV HCKRG+GLIK+NG PIEL++PE LRYK  E
Sbjct  1    MTSLKTQSVQVYGRKKTATAVAHCKRGKGLIKVNGRPIELVEPETLRYKMEE  52



>ref|XP_009039660.1| hypothetical protein AURANDRAFT_30567 [Aureococcus anophagefferens]
 gb|EGB05526.1| hypothetical protein AURANDRAFT_30567 [Aureococcus anophagefferens]
Length=143

 Score = 77.8 bits (190),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            + ++SVQ FGRKKTA AV +CK+GRGLIK+NG PIEL++PEILR K FE
Sbjct  2    SAIQSVQVFGRKKTATAVAYCKQGRGLIKVNGCPIELLEPEILRLKTFE  50



>ref|XP_002796427.1| 40S ribosomal protein S16 [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH38973.1| 40S ribosomal protein S16 [Paracoccidioides sp. 'lutzii' Pb01]
Length=143

 Score = 77.8 bits (190),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  +SVQCFG+KKTA AV HCK G+GLIK+NG P+ L QPEILR+K +E
Sbjct  2    ATTQSVQCFGKKKTATAVAHCKAGKGLIKVNGQPLALTQPEILRFKVYE  50



>gb|KIE01576.1| Ribosomal protein S9, partial [Metarhizium majus ARSEF 297]
Length=144

 Score = 77.8 bits (190),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            ++  +SVQCFG+KKTA AV HCK GRGL+K+NG P+ L+QPEILR+K +E
Sbjct  2    SSTTQSVQCFGKKKTATAVAHCKAGRGLVKVNGRPLGLVQPEILRFKVYE  51



>gb|AFM90848.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
Length=165

 Score = 78.2 bits (191),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  41   FLYSPRQRRTTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRY  220
            F    R++R T  A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P++ I+P  L+Y
Sbjct  9    FAVGEREQRRTMPAKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLDQIEPRTLQY  68

Query  221  KAFE  232
            K  E
Sbjct  69   KLLE  72



>gb|EEH04485.1| 40S ribosomal protein S16 [Histoplasma capsulatum G186AR]
 gb|EER40233.1| 40S ribosomal protein S16 [Histoplasma capsulatum H143]
 gb|EGC48555.1| 40S ribosomal protein S9 [Histoplasma capsulatum H88]
Length=143

 Score = 77.4 bits (189),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  +SVQCFG+KKTA AV HCK G+GLIK+NG P+ L QPEILR+K +E
Sbjct  2    ATTQSVQCFGKKKTATAVAHCKAGKGLIKVNGQPLALTQPEILRFKVYE  50



>ref|XP_001536964.1| 40S ribosomal protein S16 [Histoplasma capsulatum NAm1]
 gb|EDN04407.1| ribosomal protein S9 [Histoplasma capsulatum NAm1]
Length=143

 Score = 77.4 bits (189),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  +SVQCFG+KKTA AV HCK G+GLIK+NG P+ L QPEILR+K +E
Sbjct  2    ATTQSVQCFGKKKTATAVAHCKAGKGLIKVNGQPLALTQPEILRFKVYE  50



>gb|EME41332.1| ribosomal protein-like protein [Dothistroma septosporum NZE10]
Length=143

 Score = 77.4 bits (189),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            + V+SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L++P+ILR+K +E
Sbjct  2    STVQSVQCFGKKKTATAVAHCKQGKGLIKVNGKPLSLVEPQILRFKVYE  50



>ref|XP_007232866.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Astyanax 
mexicanus]
 ref|XP_007232867.1| PREDICTED: 40S ribosomal protein S16-like isoform X2 [Astyanax 
mexicanus]
Length=146

 Score = 77.4 bits (189),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  80   AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+IQP  L+YK  E
Sbjct  3    AKGPIQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIQPATLQYKLLE  53



>ref|XP_006674637.1| 40S ribosomal protein S16 [Cordyceps militaris CM01]
 gb|EGX87818.1| 40S ribosomal protein S16 [Cordyceps militaris CM01]
Length=142

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +SVQCFG+KKTA AV HCK G+GLIK+NG P++L+QPE+LR+K +E
Sbjct  4    QSVQCFGKKKTATAVAHCKAGKGLIKVNGRPLQLVQPEVLRFKVYE  49



>ref|XP_002441754.1| hypothetical protein SORBIDRAFT_08g001870 [Sorghum bicolor]
 gb|EES15592.1| hypothetical protein SORBIDRAFT_08g001870 [Sorghum bicolor]
Length=149

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  98   SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +VQCFGRKKTAVAV + K GRGLIK+NGVPIELI+PE+LR KAFE
Sbjct  12   TVQCFGRKKTAVAVAYTKPGRGLIKVNGVPIELIRPEMLRLKAFE  56



>ref|XP_008597075.1| ribosomal protein S9/S16 [Beauveria bassiana ARSEF 2860]
 gb|EJP67182.1| ribosomal protein S9/S16 [Beauveria bassiana ARSEF 2860]
 gb|KGQ04722.1| 40S ribosomal protein S16 [Beauveria bassiana D1-5]
Length=142

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +SVQCFG+KKTA AV HCK G+GLIK+NG P++L+QPE+LR+K +E
Sbjct  4    QSVQCFGKKKTATAVAHCKAGKGLIKVNGRPLQLVQPEVLRFKVYE  49



>gb|AFK11567.1| Rps16 protein [Callorhinchus milii]
Length=165

 Score = 77.8 bits (190),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  41   FLYSPRQRRTTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRY  220
            F    R++R T  A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P++ I+P  L+Y
Sbjct  9    FAVGEREQRRTMPAKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLDQIEPRTLQY  68

Query  221  KAFE  232
            K  E
Sbjct  69   KLLE  72



>gb|ADG23112.1| 40S ribosomal protein Rps16, partial [Rhizoplaca chrysoleuca]
Length=143

 Score = 77.4 bits (189),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  +SVQCFG+KKTA AV HCK G+GL+K+NG P+ L QPEILR+K +E
Sbjct  2    AATQSVQCFGKKKTATAVAHCKAGKGLVKVNGKPLSLTQPEILRFKVYE  50



>ref|XP_008079047.1| Ribosomal protein S5 2-like protein [Glarea lozoyensis ATCC 20868]
 gb|EHK99550.1| putative 40S ribosomal protein S16 [Glarea lozoyensis 74030]
 gb|EPE33895.1| Ribosomal protein S5 2-like protein [Glarea lozoyensis ATCC 20868]
Length=143

 Score = 77.4 bits (189),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  +SVQCFG+KKTA AV HC+ G+GL+K+NG P+ L+QPEILR+K +E
Sbjct  2    ASTQSVQCFGKKKTATAVAHCRAGKGLVKVNGKPLNLVQPEILRFKVYE  50



>gb|ACG26490.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACG29547.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACG32405.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACG35014.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACG41061.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACG48541.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACN25584.1| unknown [Zea mays]
 tpg|DAA59219.1| TPA: 40S ribosomal protein S16 [Zea mays]
Length=149

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  98   SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +VQCFGRKKTAVAV + K GRGLIK+NGVPIELI+PE+LR KAFE
Sbjct  12   TVQCFGRKKTAVAVAYTKPGRGLIKVNGVPIELIRPEMLRLKAFE  56



>emb|CEG74905.1| Putative 40S ribosomal protein S16 [Rhizopus microsporus]
Length=181

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E+VQ FGRKKTA AV HCKRGRGLI+ING P+EL++PEIL++K +E
Sbjct  1    MEAVQTFGRKKTATAVAHCKRGRGLIRINGSPLELLEPEILKFKVYE  47



>ref|XP_002450189.1| hypothetical protein SORBIDRAFT_05g001680 [Sorghum bicolor]
 gb|EES09177.1| hypothetical protein SORBIDRAFT_05g001680 [Sorghum bicolor]
Length=148

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  98   SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +VQCFGRKKTAVAV + K GRGLIK+NGVPIELI+PE+LR KAFE
Sbjct  11   TVQCFGRKKTAVAVAYTKPGRGLIKVNGVPIELIRPEMLRLKAFE  55



>ref|XP_007686327.1| hypothetical protein COCMIDRAFT_35302 [Bipolaris oryzae ATCC 
44560]
 ref|XP_007703294.1| hypothetical protein COCSADRAFT_149239 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_007708517.1| hypothetical protein COCCADRAFT_1911 [Bipolaris zeicola 26-R-13]
 gb|EMD60928.1| hypothetical protein COCSADRAFT_149239 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD89157.1| hypothetical protein COCHEDRAFT_102419 [Bipolaris maydis C5]
 gb|ENI05123.1| hypothetical protein COCC4DRAFT_196229 [Bipolaris maydis ATCC 
48331]
 gb|EUC37140.1| hypothetical protein COCCADRAFT_1911 [Bipolaris zeicola 26-R-13]
 gb|EUC47152.1| hypothetical protein COCMIDRAFT_35302 [Bipolaris oryzae ATCC 
44560]
 gb|EUN26588.1| hypothetical protein COCVIDRAFT_16423 [Bipolaris victoriae FI3]
Length=142

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +SVQCFG+KKTA AV HCK G+GL+K+NG P+ LIQPE+LR+K +E
Sbjct  4    QSVQCFGKKKTATAVAHCKAGKGLVKVNGKPLSLIQPEVLRFKVYE  49



>ref|XP_004254022.1| 40S ribosomal protein S16, putative, partial [Entamoeba invadens 
IP1]
 gb|ELP87251.1| 40S ribosomal protein S16, putative, partial [Entamoeba invadens 
IP1]
Length=129

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  80   AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  P++SVQ FG+KKTA+AV  CK+G+G+I++NGVP++LIQP +LR KAFE
Sbjct  26   ATEPIKSVQVFGKKKTAIAVALCKQGKGMIRVNGVPLDLIQPPMLRIKAFE  76



>ref|XP_003579002.1| PREDICTED: 40S ribosomal protein S16-like [Brachypodium distachyon]
Length=149

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  98   SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            SVQCFGRKKTAVAV + K GRGLIK+NG PIELI+PE+LR KAFE
Sbjct  12   SVQCFGRKKTAVAVAYTKPGRGLIKVNGAPIELIRPEMLRLKAFE  56



>ref|XP_008029776.1| hypothetical protein SETTUDRAFT_165152 [Setosphaeria turcica 
Et28A]
 gb|EOA82752.1| hypothetical protein SETTUDRAFT_165152 [Setosphaeria turcica 
Et28A]
Length=142

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  95   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +SVQCFG+KKTA AV HCK G+GL+K+NG P+ L+QPEILR+K +E
Sbjct  4    QSVQCFGKKKTATAVAHCKAGKGLVKVNGKPLSLVQPEILRFKVYE  49



>gb|ESZ99352.1| 40S ribosomal protein S16 [Sclerotinia borealis F-4157]
Length=143

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  +SVQCFG+K+TA AV HCK G+GL+K+NG P+ L+QPEILR+K +E
Sbjct  2    ASTQSVQCFGKKRTATAVAHCKAGKGLVKVNGKPLSLVQPEILRFKVYE  50



>ref|XP_001555512.1| 40S ribosomal protein S16 [Botrytis cinerea B05.10]
 emb|CCD51330.1| similar to 40S ribosomal protein S16 [Botrytis cinerea T4]
Length=143

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  +SVQCFG+KKTA AV HCK G+GL+K+NG P+ L+QPE+LR+K +E
Sbjct  2    ASNQSVQCFGKKKTATAVAHCKAGKGLVKVNGKPLNLVQPEVLRFKVYE  50



>ref|XP_002622587.1| 40S ribosomal protein S16 [Blastomyces dermatitidis SLH14081]
 gb|EEQ72105.1| 30S ribosomal protein S9 [Blastomyces dermatitidis SLH14081]
 gb|EEQ92163.1| 30S ribosomal protein S9 [Blastomyces dermatitidis ER-3]
 gb|EGE78556.1| 40S ribosomal protein S9 [Blastomyces dermatitidis ATCC 18188]
 gb|EQL35477.1| 40S ribosomal protein S16 [Blastomyces dermatitidis ATCC 26199]
Length=143

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            A  +SVQCFG+KKTA AV HCK G+GLIK+NG P+ L QPEILR+K +E
Sbjct  2    ATTQSVQCFGKKKTATAVAHCKAGKGLIKVNGRPLALTQPEILRFKVYE  50



>ref|XP_002500989.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62247.1| predicted protein [Micromonas sp. RCC299]
Length=142

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
             +SVQ FGRKKTAVAV HCK G+GLI+ NG PIELIQPE L++KA E
Sbjct  3    TQSVQTFGRKKTAVAVVHCKAGKGLIRFNGAPIELIQPETLKFKAME  49



>gb|EPB82886.1| 40S ribosomal protein [Mucor circinelloides f. circinelloides 
1006PhL]
 gb|EPB88336.1| 40S ribosomal protein [Mucor circinelloides f. circinelloides 
1006PhL]
 dbj|GAN09195.1| 40S ribosomal protein S16 [Mucor ambiguus]
 dbj|GAN03518.1| 40S ribosomal protein S16 [Mucor ambiguus]
 emb|CEP15361.1| hypothetical protein [Parasitella parasitica]
 emb|CEP13785.1| hypothetical protein [Parasitella parasitica]
 emb|CEP11789.1| hypothetical protein [Parasitella parasitica]
Length=140

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +E+VQ FGRKKTA AV HCKRG GLI+ING PIEL++PEIL++K +E
Sbjct  1    MEAVQTFGRKKTATAVAHCKRGHGLIRINGSPIELLEPEILKFKVYE  47



>ref|XP_008714363.1| 40S ribosomal protein S16 [Cyphellophora europaea CBS 101466]
 gb|ETN42627.1| 40S ribosomal protein S16 [Cyphellophora europaea CBS 101466]
Length=143

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP + VQCFG+KKTA AV HCK+G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    SAP-QMVQCFGKKKTATAVAHCKKGKGLIKVNGKPLHLVQPEILRFKVYE  50



>gb|KIV89975.1| 40S ribosomal protein S16 [Exophiala mesophila]
Length=143

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV H K+G+GLIK+NG P+ L+QPEILR+K +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHAKKGKGLIKVNGKPLSLVQPEILRFKVYE  50



>ref|XP_007723453.1| 40S ribosomal protein S16 [Capronia coronata CBS 617.96]
 gb|EXJ91259.1| 40S ribosomal protein S16 [Capronia coronata CBS 617.96]
Length=143

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +2

Query  83   AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE  232
            +AP +SVQCFG+KKTA AV HCK+G+GLIK+NG P+ L QPEILR+K +E
Sbjct  2    SAP-QSVQCFGKKKTATAVAHCKKGKGLIKVNGRPLALAQPEILRFKVYE  50



>gb|EGU88635.1| hypothetical protein FOXB_00884 [Fusarium oxysporum Fo5176]
Length=112

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  92   VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAF  229
             +SVQCFG+KKTA AV HCK GRGLIK+NG P+ L+QPEILR+K +
Sbjct  3    TQSVQCFGKKKTATAVAHCKAGRGLIKVNGRPLSLVQPEILRFKIY  48



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565019478555