BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF007O08

Length=232
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009597821.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  89.7    2e-20   Nicotiana tomentosiformis
gb|KDO58999.1|  hypothetical protein CISIN_1g014118mg                 92.0    2e-20   Citrus sinensis [apfelsine]
gb|KDO59000.1|  hypothetical protein CISIN_1g014118mg                 91.7    4e-20   Citrus sinensis [apfelsine]
gb|EYU44643.1|  hypothetical protein MIMGU_mgv1a006427mg              91.3    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_008361862.1|  PREDICTED: ubiquitin receptor RAD23c-like        85.9    1e-19   
ref|XP_009791275.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  90.1    2e-19   Nicotiana sylvestris
ref|XP_004233496.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3  89.7    2e-19   Solanum lycopersicum
ref|XP_004236965.1|  PREDICTED: ubiquitin receptor RAD23c             90.5    2e-19   Solanum lycopersicum
ref|XP_009631151.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  89.7    2e-19   
ref|XP_009791274.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  90.1    2e-19   Nicotiana sylvestris
gb|EYU34397.1|  hypothetical protein MIMGU_mgv1a008220mg              89.7    2e-19   Erythranthe guttata [common monkey flower]
ref|XP_010317192.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2  89.7    2e-19   Solanum lycopersicum
ref|XP_006367045.1|  PREDICTED: ubiquitin receptor RAD23c-like        89.7    2e-19   
ref|XP_004233495.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1  89.7    2e-19   Solanum lycopersicum
emb|CDX91998.1|  BnaC03g33000D                                        89.7    2e-19   
ref|XP_009631150.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  89.7    3e-19   Nicotiana tomentosiformis
gb|ABB02636.1|  RAD23-like                                            89.4    3e-19   Solanum tuberosum [potatoes]
ref|XP_009597820.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  88.6    3e-19   Nicotiana tomentosiformis
ref|XP_009134681.1|  PREDICTED: ubiquitin receptor RAD23c             89.4    3e-19   Brassica rapa
emb|CDX74251.1|  BnaA03g27960D                                        89.0    4e-19   
ref|XP_011099561.1|  PREDICTED: ubiquitin receptor RAD23c-like        89.0    5e-19   Sesamum indicum [beniseed]
ref|XP_010463666.1|  PREDICTED: ubiquitin receptor RAD23c             89.0    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010549930.1|  PREDICTED: ubiquitin receptor RAD23c-like        88.6    6e-19   Tarenaya hassleriana [spider flower]
gb|ACU18469.1|  unknown                                               85.9    7e-19   Glycine max [soybeans]
gb|KDO58998.1|  hypothetical protein CISIN_1g014118mg                 88.6    7e-19   Citrus sinensis [apfelsine]
gb|KDO58995.1|  hypothetical protein CISIN_1g014118mg                 88.6    8e-19   Citrus sinensis [apfelsine]
ref|NP_974211.1|  UV excision repair protein RAD23C                   87.4    8e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485565.1|  PREDICTED: ubiquitin receptor RAD23c-like        88.6    8e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010498530.1|  PREDICTED: ubiquitin receptor RAD23c-like        88.6    8e-19   Camelina sativa [gold-of-pleasure]
ref|XP_011097188.1|  PREDICTED: ubiquitin receptor RAD23c-like        87.8    1e-18   Sesamum indicum [beniseed]
gb|KFK37713.1|  hypothetical protein AALP_AA3G019400                  88.2    1e-18   Arabis alpina [alpine rockcress]
ref|XP_007223090.1|  hypothetical protein PRUPE_ppa007032mg           87.4    2e-18   Prunus persica
ref|XP_006482261.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  87.4    2e-18   Citrus sinensis [apfelsine]
gb|KDO58993.1|  hypothetical protein CISIN_1g014118mg                 87.4    2e-18   Citrus sinensis [apfelsine]
ref|XP_006482260.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  87.4    2e-18   Citrus sinensis [apfelsine]
gb|KDO58994.1|  hypothetical protein CISIN_1g014118mg                 87.4    2e-18   Citrus sinensis [apfelsine]
gb|KDO58997.1|  hypothetical protein CISIN_1g014118mg                 87.4    2e-18   Citrus sinensis [apfelsine]
ref|XP_006430788.1|  hypothetical protein CICLE_v10011886mg           87.4    2e-18   Citrus clementina [clementine]
gb|KFK37714.1|  hypothetical protein AALP_AA3G019400                  87.8    2e-18   Arabis alpina [alpine rockcress]
emb|CDP19777.1|  unnamed protein product                              87.4    2e-18   Coffea canephora [robusta coffee]
ref|XP_006430789.1|  hypothetical protein CICLE_v10011886mg           87.4    2e-18   Citrus clementina [clementine]
gb|KDO58996.1|  hypothetical protein CISIN_1g014118mg                 87.4    2e-18   Citrus sinensis [apfelsine]
ref|XP_009607598.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  87.0    2e-18   Nicotiana tomentosiformis
ref|XP_006430787.1|  hypothetical protein CICLE_v10011886mg           87.4    2e-18   
ref|XP_011070815.1|  PREDICTED: ubiquitin receptor RAD23c-like        87.8    2e-18   
ref|XP_010647738.1|  PREDICTED: ubiquitin receptor RAD23c isoform X1  87.0    2e-18   Vitis vinifera
ref|XP_006363121.1|  PREDICTED: ubiquitin receptor RAD23c-like        87.0    2e-18   Solanum tuberosum [potatoes]
ref|XP_002282352.1|  PREDICTED: ubiquitin receptor RAD23c isoform X2  87.0    2e-18   Vitis vinifera
ref|XP_008243218.1|  PREDICTED: ubiquitin receptor RAD23d-like        87.0    2e-18   
ref|NP_001274760.1|  uncharacterized protein LOC102577665             86.7    3e-18   Solanum tuberosum [potatoes]
ref|XP_009781759.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  86.7    3e-18   Nicotiana sylvestris
ref|XP_007227719.1|  hypothetical protein PRUPE_ppa007047mg           86.7    3e-18   Prunus persica
ref|XP_004232367.1|  PREDICTED: ubiquitin receptor RAD23d             86.7    3e-18   
ref|XP_009607597.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  86.7    3e-18   Nicotiana tomentosiformis
ref|XP_009781758.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  86.3    4e-18   Nicotiana sylvestris
ref|XP_010103794.1|  Putative DNA repair protein RAD23-4              87.4    5e-18   
ref|XP_010103792.1|  Putative DNA repair protein RAD23-3              86.3    5e-18   Morus notabilis
ref|XP_008781252.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  86.7    5e-18   Phoenix dactylifera
ref|XP_008781237.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  86.7    5e-18   Phoenix dactylifera
ref|XP_008781245.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  86.7    6e-18   
ref|XP_008781229.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  86.7    6e-18   
ref|XP_006408409.1|  hypothetical protein EUTSA_v10020817mg           86.3    6e-18   Eutrema salsugineum [saltwater cress]
ref|XP_010263555.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  85.9    7e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010263550.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  85.9    7e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010525156.1|  PREDICTED: ubiquitin receptor RAD23c-like        85.9    7e-18   Tarenaya hassleriana [spider flower]
ref|XP_007033285.1|  Rad23 UV excision repair protein family isof...  85.1    8e-18   
ref|XP_010265160.1|  PREDICTED: ubiquitin receptor RAD23c-like        85.5    8e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009356676.1|  PREDICTED: ubiquitin receptor RAD23c-like        85.5    8e-18   Pyrus x bretschneideri [bai li]
gb|EYU29968.1|  hypothetical protein MIMGU_mgv1a008352mg              85.5    8e-18   Erythranthe guttata [common monkey flower]
gb|EYU29967.1|  hypothetical protein MIMGU_mgv1a008352mg              85.5    8e-18   Erythranthe guttata [common monkey flower]
ref|XP_007033284.1|  Rad23 UV excision repair protein family isof...  86.7    8e-18   
gb|ABD96960.1|  hypothetical protein                                  85.9    9e-18   Tarenaya spinosa
ref|XP_002283656.1|  PREDICTED: ubiquitin receptor RAD23c             85.1    9e-18   Vitis vinifera
ref|XP_009784661.1|  PREDICTED: ubiquitin receptor RAD23d             85.1    1e-17   Nicotiana sylvestris
gb|AII99835.1|  putative DNA repair protein RAD23-3-like protein      85.1    1e-17   Nicotiana tabacum [American tobacco]
ref|XP_008368214.1|  PREDICTED: ubiquitin receptor RAD23c-like        85.1    1e-17   
dbj|BAC76393.1|  RAD23-like protein                                   84.3    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ83348.1|  unknown                                               82.4    1e-17   Medicago truncatula
ref|XP_007223091.1|  hypothetical protein PRUPE_ppa007032mg           83.6    2e-17   
ref|XP_004172134.1|  PREDICTED: putative DNA repair protein RAD23...  84.3    2e-17   
ref|XP_004135098.1|  PREDICTED: putative DNA repair protein RAD23...  84.3    2e-17   
gb|KGN52072.1|  hypothetical protein Csa_5G608600                     84.7    3e-17   Cucumis sativus [cucumbers]
ref|XP_008801153.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  84.0    3e-17   Phoenix dactylifera
gb|KJB80004.1|  hypothetical protein B456_013G076900                  84.0    3e-17   Gossypium raimondii
ref|XP_008446578.1|  PREDICTED: ubiquitin receptor RAD23c-like        84.3    3e-17   Cucumis melo [Oriental melon]
ref|XP_006299986.1|  hypothetical protein CARUB_v10016200mg           84.3    3e-17   Capsella rubella
gb|KJB80005.1|  hypothetical protein B456_013G076900                  84.0    3e-17   Gossypium raimondii
ref|XP_007046250.1|  Rad23 UV excision repair protein family isof...  82.8    5e-17   
ref|XP_011035053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  83.2    5e-17   Populus euphratica
ref|XP_010552226.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  83.2    6e-17   Tarenaya hassleriana [spider flower]
ref|XP_010552232.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  83.2    6e-17   Tarenaya hassleriana [spider flower]
gb|KJB80001.1|  hypothetical protein B456_013G076800                  82.4    7e-17   Gossypium raimondii
ref|XP_010926135.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  83.2    7e-17   Elaeis guineensis
ref|XP_010926134.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  83.2    7e-17   Elaeis guineensis
ref|XP_011035049.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  82.8    7e-17   Populus euphratica
ref|XP_011035048.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  82.8    8e-17   Populus euphratica
ref|XP_007142903.1|  hypothetical protein PHAVU_007G026600g           83.2    8e-17   Phaseolus vulgaris [French bean]
ref|NP_001189793.1|  UV excision repair protein RAD23C                83.2    8e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186903.1|  UV excision repair protein RAD23C                   83.2    8e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003555895.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  82.8    9e-17   Glycine max [soybeans]
ref|XP_007046249.1|  Rad23 UV excision repair protein family isof...  82.8    9e-17   
ref|XP_010926133.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  82.8    1e-16   Elaeis guineensis
ref|XP_011035052.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  82.4    1e-16   Populus euphratica
ref|XP_011035051.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  82.4    1e-16   Populus euphratica
gb|KHN05574.1|  Putative DNA repair protein RAD23-3                   82.8    1e-16   Glycine soja [wild soybean]
ref|XP_002305813.1|  ubiquitin family protein                         82.4    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010926132.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  82.8    1e-16   Elaeis guineensis
gb|KJB80000.1|  hypothetical protein B456_013G076800                  82.4    1e-16   Gossypium raimondii
gb|KJB79998.1|  hypothetical protein B456_013G076800                  82.4    1e-16   Gossypium raimondii
ref|XP_003536688.1|  PREDICTED: ubiquitin receptor RAD23c             82.8    1e-16   Glycine max [soybeans]
ref|XP_002884326.1|  hypothetical protein ARALYDRAFT_477488           82.8    1e-16   
ref|XP_010916168.1|  PREDICTED: ubiquitin receptor RAD23c-like        82.0    1e-16   Elaeis guineensis
ref|XP_007215515.1|  hypothetical protein PRUPE_ppa007020mg           82.0    1e-16   Prunus persica
ref|XP_008390012.1|  PREDICTED: ubiquitin receptor RAD23c-like        81.6    1e-16   
ref|XP_008775144.1|  PREDICTED: ubiquitin receptor RAD23d-like        82.0    2e-16   Phoenix dactylifera
ref|XP_004497101.1|  PREDICTED: putative DNA repair protein RAD23...  82.0    2e-16   Cicer arietinum [garbanzo]
ref|XP_006584607.1|  PREDICTED: uncharacterized protein LOC100813...  81.6    2e-16   
ref|XP_009356279.1|  PREDICTED: ubiquitin receptor RAD23d-like        81.6    2e-16   Pyrus x bretschneideri [bai li]
gb|KHN15504.1|  Putative DNA repair protein RAD23-3                   82.0    2e-16   Glycine soja [wild soybean]
ref|XP_006584608.1|  PREDICTED: uncharacterized protein LOC100813...  81.6    2e-16   
gb|ACU18529.1|  unknown                                               81.6    2e-16   Glycine max [soybeans]
ref|XP_009399729.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  81.6    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399730.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  81.6    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006437672.1|  hypothetical protein CICLE_v10031777mg           79.7    3e-16   
ref|NP_001240201.1|  uncharacterized protein LOC100809066             81.3    3e-16   Glycine max [soybeans]
ref|XP_006584606.1|  PREDICTED: uncharacterized protein LOC100813...  81.6    3e-16   
ref|NP_001242098.1|  uncharacterized protein LOC100813881             81.3    3e-16   
gb|KJB79994.1|  hypothetical protein B456_013G076500                  80.9    4e-16   Gossypium raimondii
ref|XP_006584604.1|  PREDICTED: uncharacterized protein LOC100813...  81.6    4e-16   
ref|XP_006584605.1|  PREDICTED: uncharacterized protein LOC100813...  81.6    5e-16   Glycine max [soybeans]
ref|XP_008801157.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  80.5    5e-16   
ref|XP_008230399.1|  PREDICTED: ubiquitin receptor RAD23d             80.5    5e-16   Prunus mume [ume]
ref|XP_008801156.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  80.1    7e-16   
ref|XP_002529115.1|  uv excision repair protein rad23, putative       80.5    8e-16   Ricinus communis
ref|XP_006437673.1|  hypothetical protein CICLE_v10031777mg           79.0    9e-16   
gb|KJB79995.1|  hypothetical protein B456_013G076600                  80.1    9e-16   Gossypium raimondii
ref|XP_008801154.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  80.1    9e-16   Phoenix dactylifera
ref|XP_009417654.1|  PREDICTED: ubiquitin receptor RAD23d-like        80.1    9e-16   
gb|KEH44233.1|  RAD23 UV excision repair family protein               80.1    1e-15   Medicago truncatula
emb|CDP02781.1|  unnamed protein product                              79.7    1e-15   Coffea canephora [robusta coffee]
ref|XP_010553920.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1  79.7    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_010553921.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2  79.7    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_008379541.1|  PREDICTED: ubiquitin receptor RAD23d-like        79.7    1e-15   
ref|XP_006437674.1|  hypothetical protein CICLE_v10031777mg           78.6    1e-15   
ref|XP_010907325.1|  PREDICTED: ubiquitin receptor RAD23d-like        79.3    2e-15   Elaeis guineensis
ref|XP_002312393.1|  hypothetical protein POPTR_0008s11840g           78.6    2e-15   
ref|XP_004299088.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  79.3    2e-15   Fragaria vesca subsp. vesca
ref|XP_011464118.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  79.3    2e-15   Fragaria vesca subsp. vesca
ref|XP_006383465.1|  hypothetical protein POPTR_0005s15740g           79.0    2e-15   Populus trichocarpa [western balsam poplar]
gb|KDP32945.1|  hypothetical protein JCGZ_12976                       79.0    2e-15   Jatropha curcas
ref|XP_006437675.1|  hypothetical protein CICLE_v10031777mg           78.6    3e-15   Citrus clementina [clementine]
ref|XP_002516727.1|  uv excision repair protein rad23, putative       78.6    3e-15   Ricinus communis
ref|XP_006484457.1|  PREDICTED: ubiquitin receptor RAD23c-like        78.2    4e-15   Citrus sinensis [apfelsine]
ref|XP_008341883.1|  PREDICTED: ubiquitin receptor RAD23d-like        78.2    6e-15   
ref|XP_011021237.1|  PREDICTED: ubiquitin receptor RAD23c isoform X5  77.4    6e-15   Populus euphratica
ref|XP_011021236.1|  PREDICTED: ubiquitin receptor RAD23c isoform X4  77.4    7e-15   Populus euphratica
ref|XP_011021233.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3  77.4    7e-15   Populus euphratica
ref|XP_009391405.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  77.8    8e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391404.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  77.8    8e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011021232.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2  77.4    8e-15   Populus euphratica
ref|XP_011021231.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1  77.4    8e-15   Populus euphratica
gb|EPS71284.1|  hypothetical protein M569_03474                       77.0    1e-14   Genlisea aurea
ref|XP_006846642.1|  hypothetical protein AMTR_s00156p00078120        77.0    1e-14   Amborella trichopoda
ref|XP_007142901.1|  hypothetical protein PHAVU_007G026400g           77.0    1e-14   Phaseolus vulgaris [French bean]
ref|XP_011022053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  75.9    1e-14   Populus euphratica
ref|XP_011022044.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  76.3    2e-14   Populus euphratica
ref|XP_002315945.2|  hypothetical protein POPTR_0010s13610g           76.3    2e-14   
ref|XP_011007998.1|  PREDICTED: ubiquitin receptor RAD23d-like        75.9    3e-14   Populus euphratica
ref|XP_010681568.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  75.1    4e-14   Beta vulgaris subsp. vulgaris [field beet]
emb|CAA72741.1|  RAD23, isoform I                                     75.5    4e-14   Daucus carota [carrots]
ref|XP_010681566.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  75.1    5e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681564.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  75.1    5e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681563.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  75.1    6e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010440953.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  75.1    6e-14   Camelina sativa [gold-of-pleasure]
gb|AFK37901.1|  unknown                                               73.2    6e-14   Medicago truncatula
ref|XP_006383464.1|  ubiquitin family protein                         74.7    8e-14   
emb|CAC01850.1|  putative protein                                     72.0    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197113.4|  uncharacterized protein                             72.0    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006655985.1|  PREDICTED: ubiquitin receptor RAD23c-like        74.3    1e-13   Oryza brachyantha
ref|XP_009357056.1|  PREDICTED: ubiquitin receptor RAD23d             73.9    1e-13   Pyrus x bretschneideri [bai li]
ref|XP_006283908.1|  hypothetical protein CARUB_v10005026mg           73.9    1e-13   Capsella rubella
emb|CDX69474.1|  BnaA10g18230D                                        73.2    2e-13   
ref|XP_004489115.1|  PREDICTED: putative DNA repair protein RAD23...  73.2    2e-13   Cicer arietinum [garbanzo]
ref|XP_006603061.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  72.8    3e-13   Glycine max [soybeans]
ref|XP_010681567.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  72.8    3e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001057334.1|  Os06g0264300                                     73.2    3e-13   
gb|EAZ00429.1|  hypothetical protein OsI_22453                        73.2    4e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_002870839.1|  hypothetical protein ARALYDRAFT_494129           72.8    4e-13   
emb|CDX69473.1|  BnaA10g18220D                                        73.9    4e-13   
ref|XP_010681565.1|  PREDICTED: ubiquitin receptor RAD23c-like is...  72.8    4e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003551850.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  72.4    6e-13   Glycine max [soybeans]
gb|AFK37577.1|  unknown                                               72.0    7e-13   Lotus japonicus
ref|XP_003563980.1|  PREDICTED: ubiquitin receptor RAD23d-like        72.0    8e-13   Brachypodium distachyon [annual false brome]
gb|KCW86330.1|  hypothetical protein EUGRSUZ_B03019                   70.9    1e-12   Eucalyptus grandis [rose gum]
ref|XP_004304134.1|  PREDICTED: ubiquitin receptor RAD23d-like        71.6    1e-12   Fragaria vesca subsp. vesca
ref|XP_010692904.1|  PREDICTED: ubiquitin receptor RAD23d             71.6    1e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK33251.1|  hypothetical protein AALP_AA6G350300                  71.6    1e-12   Arabis alpina [alpine rockcress]
gb|KEH21499.1|  RAD23 UV excision repair family protein               70.9    2e-12   Medicago truncatula
ref|XP_010044267.1|  PREDICTED: ubiquitin receptor RAD23d-like        71.2    2e-12   Eucalyptus grandis [rose gum]
gb|EMS50196.1|  putative DNA repair protein RAD23                     72.0    2e-12   Triticum urartu
ref|XP_006427691.1|  hypothetical protein CICLE_v100258681mg          67.0    2e-12   
ref|XP_004956777.1|  PREDICTED: probable DNA repair protein RAD23...  71.2    2e-12   
gb|ABY66298.1|  RAD23-like protein                                    70.5    2e-12   Brassica napus [oilseed rape]
ref|XP_009121516.1|  PREDICTED: ubiquitin receptor RAD23c-like        70.1    3e-12   
ref|XP_010450906.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2  70.1    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010450905.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1  70.1    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010435751.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  70.1    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010435749.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  70.1    4e-12   Camelina sativa [gold-of-pleasure]
gb|KDO46132.1|  hypothetical protein CISIN_1g0198171mg                67.8    5e-12   Citrus sinensis [apfelsine]
dbj|BAC76395.1|  RAD23-like protein                                   68.9    7e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003578094.1|  PREDICTED: probable ubiquitin receptor RAD23     69.3    7e-12   Brachypodium distachyon [annual false brome]
gb|KDO46130.1|  hypothetical protein CISIN_1g0198171mg                67.4    9e-12   Citrus sinensis [apfelsine]
gb|KDO46129.1|  hypothetical protein CISIN_1g0198171mg                67.4    1e-11   Citrus sinensis [apfelsine]
gb|AAK59766.1|  unknown protein                                       68.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004147454.1|  PREDICTED: putative DNA repair protein RAD23...  68.6    1e-11   Cucumis sativus [cucumbers]
gb|KDO46131.1|  hypothetical protein CISIN_1g0198171mg                67.4    1e-11   Citrus sinensis [apfelsine]
ref|XP_009605626.1|  PREDICTED: probable ubiquitin receptor RAD23a    65.5    1e-11   Nicotiana tomentosiformis
ref|XP_004956778.1|  PREDICTED: probable DNA repair protein RAD23...  68.6    1e-11   Setaria italica
ref|XP_006405766.1|  hypothetical protein EUTSA_v10027790mg           68.2    2e-11   Eutrema salsugineum [saltwater cress]
ref|XP_009139789.1|  PREDICTED: ubiquitin receptor RAD23d             68.2    2e-11   Brassica rapa
emb|CDY01661.1|  BnaC04g30910D                                        67.8    2e-11   
ref|XP_009121517.1|  PREDICTED: ubiquitin receptor RAD23c-like        67.4    2e-11   
gb|KFK25846.1|  hypothetical protein AALP_AA8G169700                  67.4    4e-11   Arabis alpina [alpine rockcress]
emb|CBI25247.3|  unnamed protein product                              67.4    4e-11   Vitis vinifera
ref|XP_010655132.1|  PREDICTED: ubiquitin receptor RAD23b             67.4    4e-11   Vitis vinifera
emb|CDX74522.1|  BnaA04g08670D                                        67.0    5e-11   
gb|ACJ84340.1|  unknown                                               63.9    6e-11   Medicago truncatula
ref|NP_001078680.1|  ubiquitin receptor RAD23d                        66.2    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008443453.1|  PREDICTED: ubiquitin receptor RAD23b-like        66.6    6e-11   Cucumis melo [Oriental melon]
ref|XP_010246571.1|  PREDICTED: ubiquitin receptor RAD23b-like        66.6    7e-11   Nelumbo nucifera [Indian lotus]
emb|CDX67404.1|  BnaA07g14440D                                        66.6    7e-11   
ref|XP_009125074.1|  PREDICTED: ubiquitin receptor RAD23d             66.6    7e-11   Brassica rapa
dbj|BAJ98767.1|  predicted protein                                    66.6    7e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY58121.1|  BnaCnng32650D                                        66.6    7e-11   Brassica napus [oilseed rape]
ref|XP_002299163.1|  DNA repair protein RAD23                         66.2    7e-11   
ref|XP_010268454.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  66.2    7e-11   Nelumbo nucifera [Indian lotus]
ref|XP_011034604.1|  PREDICTED: ubiquitin receptor RAD23b-like        66.2    8e-11   Populus euphratica
ref|NP_001061854.1|  Os08g0430200                                     66.6    8e-11   
gb|EMT27109.1|  Putative DNA repair protein RAD23                     66.6    8e-11   
gb|EMS61794.1|  putative DNA repair protein RAD23                     66.6    8e-11   Triticum urartu
gb|KJB69954.1|  hypothetical protein B456_011G053200                  65.9    8e-11   Gossypium raimondii
ref|XP_006368664.1|  hypothetical protein POPTR_0001s07510g           66.2    8e-11   
gb|EAZ07072.1|  hypothetical protein OsI_29318                        66.2    9e-11   Oryza sativa Indica Group [Indian rice]
dbj|BAJ97496.1|  predicted protein                                    66.2    9e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU24565.1|  hypothetical protein MIMGU_mgv1a008731mg              65.5    1e-10   Erythranthe guttata [common monkey flower]
gb|ACF83232.1|  unknown                                               63.9    1e-10   Zea mays [maize]
ref|XP_010268452.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  65.9    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009408042.1|  PREDICTED: ubiquitin receptor RAD23b-like        65.9    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008228865.1|  PREDICTED: ubiquitin receptor RAD23b-like        65.9    1e-10   Prunus mume [ume]
ref|XP_007215553.1|  hypothetical protein PRUPE_ppa007284mg           65.9    1e-10   Prunus persica
ref|XP_007150827.1|  hypothetical protein PHAVU_005G184000g           65.5    1e-10   Phaseolus vulgaris [French bean]
ref|XP_003529480.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  65.5    1e-10   Glycine max [soybeans]
ref|NP_001240038.1|  uncharacterized protein LOC100819019             65.5    1e-10   Glycine max [soybeans]
gb|ACU20959.1|  unknown                                               65.5    1e-10   Glycine max [soybeans]
gb|KJB69952.1|  hypothetical protein B456_011G053200                  65.5    1e-10   Gossypium raimondii
ref|XP_007135849.1|  hypothetical protein PHAVU_010G163300g           65.5    1e-10   Phaseolus vulgaris [French bean]
ref|XP_003543713.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  65.5    2e-10   Glycine max [soybeans]
gb|KHG09850.1|  Putative DNA repair RAD23-1 -like protein             65.5    2e-10   Gossypium arboreum [tree cotton]
ref|XP_002512770.1|  uv excision repair protein rad23, putative       65.5    2e-10   
emb|CDY26493.1|  BnaC09g41750D                                        65.1    2e-10   Brassica napus [oilseed rape]
gb|KHN31866.1|  Putative DNA repair protein RAD23-1                   65.1    2e-10   Glycine soja [wild soybean]
ref|XP_003574508.1|  PREDICTED: probable ubiquitin receptor RAD23...  65.5    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_010235145.1|  PREDICTED: probable ubiquitin receptor RAD23...  65.5    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_010695313.1|  PREDICTED: probable ubiquitin receptor RAD23a    65.1    2e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006646967.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  65.1    2e-10   Oryza brachyantha
gb|KJB69953.1|  hypothetical protein B456_011G053200                  64.7    2e-10   Gossypium raimondii
ref|XP_006646966.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  65.1    2e-10   Oryza brachyantha
ref|XP_011082656.1|  PREDICTED: ubiquitin receptor RAD23b-like        65.1    2e-10   Sesamum indicum [beniseed]
gb|ACN40029.1|  unknown                                               65.5    2e-10   Picea sitchensis
ref|XP_006493449.1|  PREDICTED: ubiquitin receptor RAD23b-like        65.1    2e-10   Citrus sinensis [apfelsine]
gb|KHG13236.1|  Putative DNA repair RAD23-1 -like protein             65.1    2e-10   Gossypium arboreum [tree cotton]
ref|NP_198663.1|  ubiquitin receptor RAD23d                           65.1    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KJB34920.1|  hypothetical protein B456_006G091100                  65.1    2e-10   Gossypium raimondii
ref|XP_004303217.1|  PREDICTED: ubiquitin receptor RAD23b             64.7    3e-10   Fragaria vesca subsp. vesca
ref|XP_006341431.1|  PREDICTED: ubiquitin receptor RAD23b-like        64.7    3e-10   Solanum tuberosum [potatoes]
gb|AFW66284.1|  hypothetical protein ZEAMMB73_839350                  63.5    4e-10   
ref|XP_004235877.1|  PREDICTED: ubiquitin receptor RAD23b             63.9    5e-10   
ref|XP_009615678.1|  PREDICTED: ubiquitin receptor RAD23b             63.9    5e-10   Nicotiana tomentosiformis
ref|XP_008381163.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  63.9    6e-10   
ref|XP_009418051.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  63.9    6e-10   
ref|XP_010107189.1|  Putative DNA repair protein RAD23-1              63.9    6e-10   
ref|XP_007024819.1|  Rad23 UV excision repair protein family isof...  63.2    6e-10   
ref|XP_007024818.1|  Rad23 UV excision repair protein family isof...  63.5    7e-10   
ref|XP_009797065.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  63.5    7e-10   
ref|XP_009418030.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  63.5    7e-10   
ref|XP_002964690.1|  hypothetical protein SELMODRAFT_82644            63.5    7e-10   
ref|XP_009797063.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  63.5    7e-10   
ref|XP_010034058.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  63.5    7e-10   
ref|XP_010034057.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  63.5    7e-10   
ref|XP_009365249.1|  PREDICTED: ubiquitin receptor RAD23b-like        63.5    8e-10   
gb|ACG32894.1|  DNA repair protein RAD23                              63.5    8e-10   
ref|XP_009598522.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  63.5    8e-10   
ref|XP_009598520.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  63.5    8e-10   
ref|NP_001149140.1|  LOC100282762                                     63.5    8e-10   
ref|XP_010034056.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  63.5    9e-10   
ref|XP_010034055.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  63.5    9e-10   
ref|NP_001130219.1|  uncharacterized protein LOC100191313             61.6    1e-09   
ref|XP_001763027.1|  predicted protein                                63.2    1e-09   
gb|EYU24564.1|  hypothetical protein MIMGU_mgv1a008731mg              63.2    1e-09   
ref|XP_003637291.1|  RAD23 protein                                    63.2    1e-09   
ref|XP_008342756.1|  PREDICTED: ubiquitin receptor RAD23b-like        63.2    1e-09   
ref|XP_006646969.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  63.2    1e-09   
gb|KHG13156.1|  Putative DNA repair RAD23-1 -like protein             63.2    1e-09   
ref|XP_009354240.1|  PREDICTED: ubiquitin receptor RAD23b-like        62.8    1e-09   
ref|XP_006646968.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  62.8    1e-09   
ref|XP_004965183.1|  PREDICTED: putative DNA repair protein RAD23...  63.2    1e-09   
emb|CDO98260.1|  unnamed protein product                              62.8    1e-09   
ref|XP_004486596.1|  PREDICTED: putative DNA repair protein RAD23...  62.8    1e-09   
ref|XP_004486595.1|  PREDICTED: putative DNA repair protein RAD23...  62.8    1e-09   
gb|KJB67005.1|  hypothetical protein B456_010G170000                  62.8    1e-09   
ref|XP_002303970.1|  DNA repair protein RAD23                         62.8    1e-09   
ref|XP_002451657.1|  hypothetical protein SORBIDRAFT_04g005370        62.8    2e-09   
gb|AAF68123.1|AC010793_18  F20B17.8                                   62.8    2e-09   
ref|XP_006385947.1|  hypothetical protein POPTR_0003s18540g           62.4    2e-09   
emb|CAA72742.1|  RAD23 protein, isoform II                            62.8    2e-09   
ref|XP_002873756.1|  hypothetical protein ARALYDRAFT_326056           60.1    2e-09   
ref|XP_011020549.1|  PREDICTED: ubiquitin receptor RAD23b-like        62.4    2e-09   
gb|EMS58233.1|  Putative DNA repair protein RAD23-1                   62.8    2e-09   
ref|XP_002961618.1|  hypothetical protein SELMODRAFT_77427            62.4    2e-09   
ref|NP_001063134.1|  Os09g0407200                                     62.4    2e-09   
ref|NP_001148810.1|  LOC100282427                                     62.0    2e-09   
ref|XP_008677244.1|  PREDICTED: LOC100282427 isoform X2               62.0    2e-09   
ref|XP_002889262.1|  hypothetical protein ARALYDRAFT_316857           62.0    2e-09   
ref|XP_008794386.1|  PREDICTED: ubiquitin receptor RAD23b-like        62.0    2e-09   
gb|ACN26781.1|  unknown                                               61.6    2e-09   
gb|AAB65841.1|  osRAD23                                               62.4    2e-09   
emb|CDY26494.1|  BnaC09g41740D                                        60.8    3e-09   
gb|AFW87601.1|  hypothetical protein ZEAMMB73_681598                  62.0    3e-09   
ref|NP_001266655.1|  DNA repair protein RAD23                         62.0    3e-09   
ref|XP_009759118.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2  61.6    3e-09   
ref|XP_003622299.1|  hypothetical protein MTR_7g032690                62.0    3e-09   
ref|XP_009759117.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1  61.6    3e-09   
ref|XP_003622298.1|  hypothetical protein MTR_7g032690                62.0    3e-09   
ref|XP_006281616.1|  hypothetical protein CARUB_v10027742mg           58.5    3e-09   
gb|ACH72675.1|  RAD23                                                 62.0    3e-09   
ref|NP_001142065.1|  uncharacterized protein LOC100274222             62.0    3e-09   
ref|XP_010532056.1|  PREDICTED: ubiquitin receptor RAD23b             61.6    4e-09   
dbj|BAK04690.1|  predicted protein                                    61.6    4e-09   
gb|EEC72612.1|  hypothetical protein OsI_06092                        61.6    4e-09   
ref|NP_001046083.1|  Os02g0179300                                     61.6    4e-09   
ref|XP_010929196.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  61.6    4e-09   
ref|XP_010929195.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  61.6    4e-09   
ref|XP_010929193.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  61.6    5e-09   
ref|XP_003570619.1|  PREDICTED: ubiquitin receptor RAD23b-like        61.2    5e-09   
gb|AAF18513.1|AC010924_26  Contains similarity to gb|Y12014 RAD23...  59.7    6e-09   
ref|XP_003622297.1|  hypothetical protein MTR_7g032690                61.6    6e-09   
gb|ABK24371.1|  unknown                                               60.8    6e-09   
gb|ABN05900.1|  Ubiquitin                                             61.6    7e-09   
ref|NP_001185439.1|  ubiquitin receptor RAD23b                        60.8    7e-09   
gb|ABG89119.1|  Rad23-3Ai                                             60.8    7e-09   
ref|NP_974181.1|  ubiquitin receptor RAD23b                           60.8    7e-09   
ref|XP_010472832.1|  PREDICTED: ubiquitin receptor RAD23b-like        60.8    7e-09   
ref|XP_010417634.1|  PREDICTED: ubiquitin receptor RAD23b             60.8    7e-09   
ref|XP_006845449.1|  hypothetical protein AMTR_s00019p00116110        60.8    8e-09   
ref|NP_565216.2|  ubiquitin receptor RAD23b                           60.5    8e-09   
tpg|DAA61379.1|  TPA: hypothetical protein ZEAMMB73_350633            60.8    8e-09   
ref|XP_008650775.1|  PREDICTED: uncharacterized protein LOC100191...  60.8    8e-09   
dbj|BAC76390.1|  RAD23-like protein                                   60.5    8e-09   
ref|XP_004137651.1|  PREDICTED: putative DNA repair protein RAD23...  60.5    9e-09   
ref|NP_850982.1|  ubiquitin receptor RAD23b                           60.5    9e-09   
ref|XP_008462953.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1  60.5    9e-09   
dbj|BAC76389.1|  RAD23-like protein                                   60.5    1e-08   
ref|XP_010429867.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  60.5    1e-08   
ref|XP_010429866.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  60.1    1e-08   
gb|KGN58646.1|  hypothetical protein Csa_3G710740                     60.1    1e-08   
emb|CDY33351.1|  BnaC05g12320D                                        60.1    1e-08   
ref|XP_009398645.1|  PREDICTED: ubiquitin receptor RAD23b-like        60.1    1e-08   
ref|XP_006302422.1|  hypothetical protein CARUB_v10020503mg           60.1    1e-08   
ref|XP_004161413.1|  PREDICTED: putative DNA repair protein RAD23...  60.1    1e-08   
ref|XP_002890153.1|  hypothetical protein ARALYDRAFT_312599           59.7    2e-08   
ref|XP_010459157.1|  PREDICTED: probable ubiquitin receptor RAD23a    59.7    2e-08   
tpg|DAA61375.1|  TPA: hypothetical protein ZEAMMB73_350633            59.3    2e-08   
ref|XP_001752113.1|  predicted protein                                56.2    2e-08   
gb|ABY66299.1|  DNA repair protein RAD23                              58.9    2e-08   
ref|XP_006416841.1|  hypothetical protein EUTSA_v10007982mg           58.5    4e-08   
ref|XP_010485077.1|  PREDICTED: uncharacterized protein LOC104763398  58.9    4e-08   
emb|CDX81753.1|  BnaC08g38480D                                        58.5    5e-08   
ref|XP_008668010.1|  PREDICTED: LOC100283179 isoform X1               58.5    5e-08   
ref|XP_006306209.1|  hypothetical protein CARUB_v10011879mg           58.5    5e-08   
ref|XP_001775909.1|  predicted protein                                56.2    6e-08   
ref|XP_010476726.1|  PREDICTED: LOW QUALITY PROTEIN: probable ubi...  58.2    7e-08   
ref|XP_009117771.1|  PREDICTED: probable ubiquitin receptor RAD23a    58.2    7e-08   
gb|ACF79443.1|  unknown                                               58.2    7e-08   
ref|NP_173070.1|  DNA repair protein RAD23A                           57.8    7e-08   
ref|XP_010497716.1|  PREDICTED: probable ubiquitin receptor RAD23a    57.8    9e-08   
ref|NP_001149553.1|  LOC100283179                                     57.8    9e-08   
gb|KFK42374.1|  hypothetical protein AALP_AA2G247700                  57.4    1e-07   
gb|EPS72838.1|  hypothetical protein M569_01918                       57.0    1e-07   
gb|KHN38092.1|  Putative DNA repair protein RAD23-1                   57.8    1e-07   
emb|CDY35071.1|  BnaA06g10810D                                        57.0    1e-07   
ref|XP_009149056.1|  PREDICTED: probable ubiquitin receptor RAD23a    57.0    1e-07   
emb|CDY26496.1|  BnaC09g41720D                                        57.0    1e-07   
ref|XP_001780766.1|  predicted protein                                57.0    2e-07   
ref|XP_009122868.1|  PREDICTED: ubiquitin receptor RAD23d-like        56.6    2e-07   
ref|XP_010446048.1|  PREDICTED: uncharacterized protein LOC104728818  56.6    3e-07   
ref|XP_006389863.1|  hypothetical protein EUTSA_v10018655mg           55.8    4e-07   
emb|CDX67983.1|  BnaA07g20230D                                        55.5    6e-07   
ref|XP_009104513.1|  PREDICTED: ubiquitin receptor RAD23b             53.5    3e-06   
emb|CDX79333.1|  BnaC06g19700D                                        53.5    3e-06   
dbj|BAC76391.1|  RAD23-like protein                                   50.8    2e-05   
ref|XP_009167422.1|  hypothetical protein T265_04413                  46.2    8e-05   
ref|XP_004951696.1|  PREDICTED: putative DNA repair protein RAD23...  48.9    1e-04   
pdb|3V6C|B  Chain B, Crystal Structure Of Usp2 In Complex With Mu...  44.3    5e-04   
ref|XP_005737880.1|  PREDICTED: polyubiquitin-C-like isoform X2       44.7    5e-04   
ref|XP_004557477.1|  PREDICTED: polyubiquitin-C-like                  44.7    6e-04   
ref|XP_005737879.1|  PREDICTED: polyubiquitin-C-like isoform X1       44.7    9e-04   
ref|XP_011035054.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  45.8    0.001   



>ref|XP_009597821.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=148

 Score = 89.7 bits (221),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+VQG + YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIESVQGQDFYPAAQQMLIH  48



>gb|KDO58999.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=308

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIH  48



>gb|KDO59000.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=364

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIH  48



>gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata]
Length=444

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/49 (88%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +1

Query  85   NMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            +MKIFVKTLKGTHFEIEVKPEDTVADVKK++ETVQGS+VYPA+Q MLIH
Sbjct  65   SMKIFVKTLKGTHFEIEVKPEDTVADVKKNVETVQGSDVYPAAQQMLIH  113



>ref|XP_008361862.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=83

 Score = 85.9 bits (211),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIH
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIH  48



>ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIH  48



>ref|XP_004233496.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Solanum lycopersicum]
Length=365

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIH  48



>ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum]
Length=409

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIH  48



>ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIH  48



>ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIH  48



>gb|EYU34397.1| hypothetical protein MIMGU_mgv1a008220mg [Erythranthe guttata]
Length=381

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGSN+YPA Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSNIYPAGQQMLIH  48



>ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum]
Length=381

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIH  48



>ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=398

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIH  48



>ref|XP_004233495.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Solanum lycopersicum]
Length=383

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIH  48



>emb|CDX91998.1| BnaC03g33000D [Brassica napus]
Length=403

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIH  48



>ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIH  48



>gb|ABB02636.1| RAD23-like [Solanum tuberosum]
Length=384

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIH  48



>ref|XP_009597820.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
tomentosiformis]
Length=288

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+VQG + YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIESVQGQDFYPAAQQMLIH  48



>ref|XP_009134681.1| PREDICTED: ubiquitin receptor RAD23c [Brassica rapa]
Length=401

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIH  48



>emb|CDX74251.1| BnaA03g27960D [Brassica napus]
Length=401

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIH  48



>ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            M+IFVKTLKGTHFEIEVKPEDTVADVKK+IETVQG++VYPASQ MLIH
Sbjct  1    MRIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPASQQMLIH  48



>ref|XP_010463666.1| PREDICTED: ubiquitin receptor RAD23c [Camelina sativa]
Length=422

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIH  48



>ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
 gb|ABD96879.1| hypothetical protein [Cleome spinosa]
Length=383

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQG++VYP++Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPSAQQMLIH  48



>gb|ACU18469.1| unknown [Glycine max]
Length=160

 Score = 85.9 bits (211),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIH  48



>gb|KDO58998.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=397

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIH  48



>gb|KDO58995.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=430

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIH  48



>ref|NP_974211.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73825.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=299

 Score = 87.4 bits (215),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIH  48



>ref|XP_010485565.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=419

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIH  48



>ref|XP_010498530.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=420

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIH  48



>ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIH  48



>gb|KFK37713.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=425

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG+++YPA++LMLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIH  48



>ref|XP_007223090.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24289.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=385

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHF++ VKPEDTV+DVKK IET QGS+VYPASQ MLIH
Sbjct  1    MKIFVKTLKGTHFDVAVKPEDTVSDVKKQIETSQGSDVYPASQQMLIH  48



>ref|XP_006482261.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Citrus 
sinensis]
Length=396

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIH  48



>gb|KDO58993.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=398

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIH  48



>ref|XP_006482260.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Citrus 
sinensis]
Length=397

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIH  48



>gb|KDO58994.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=402

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIH  48



>gb|KDO58997.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIH  48



>ref|XP_006430788.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44028.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=400

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIH  48



>gb|KFK37714.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=435

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG+++YPA++LMLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIH  48



>emb|CDP19777.1| unnamed protein product [Coffea canephora]
Length=390

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPEDTV DVKKSIET QG+ VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVTDVKKSIETAQGAEVYPASQQMLIH  48



>ref|XP_006430789.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44029.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIH  48



>gb|KDO58996.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIH  48



>ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIH  48



>ref|XP_006430787.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44027.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIH  48



>ref|XP_011070815.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=433

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+ QG+++YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKTIESTQGADIYPATQQMLIH  48



>ref|XP_010647738.1| PREDICTED: ubiquitin receptor RAD23c isoform X1 [Vitis vinifera]
Length=398

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIH
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIH  48



>ref|XP_006363121.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=390

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIH  48



>ref|XP_002282352.1| PREDICTED: ubiquitin receptor RAD23c isoform X2 [Vitis vinifera]
 emb|CBI27030.3| unnamed protein product [Vitis vinifera]
Length=397

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIH
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIH  48



>ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume]
Length=384

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHF++EVKPEDTVADVKK IET QGS+VYPASQ MLIH
Sbjct  1    MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIH  48



>ref|NP_001274760.1| uncharacterized protein LOC102577665 [Solanum tuberosum]
 gb|ABB16981.1| unknown [Solanum tuberosum]
Length=382

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLI  228
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLI
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLI  47



>ref|XP_009781759.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIH  48



>ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
 ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume]
 gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
Length=385

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHF++EVKPEDTVADVKK IET QGS+VYPASQ MLIH
Sbjct  1    MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIH  48



>ref|XP_004232367.1| PREDICTED: ubiquitin receptor RAD23d [Solanum lycopersicum]
 emb|CAB51544.1| RAD23 protein [Solanum lycopersicum var. cerasiforme]
Length=389

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIH  48



>ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=383

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIH  48



>ref|XP_009781758.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIH  48



>ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
 gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
Length=550

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  79   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            ++ MKI VKTLKGTHFEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIH
Sbjct  115  KKKMKICVKTLKGTHFEIEVKPEDTVADVKKNIEVVQGADVYPASQQMLIH  165



>ref|XP_010103792.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
 gb|EXB97154.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
Length=421

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGTHFEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIH
Sbjct  1    MKVCVKTLKGTHFEIEVKPEDTVADVKKNIEAVQGADVYPASQQMLIH  48



>ref|XP_008781252.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Phoenix 
dactylifera]
Length=450

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 42/51 (82%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  79   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIH
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIH  86



>ref|XP_008781237.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=451

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 42/51 (82%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  79   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIH
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIH  86



>ref|XP_008781245.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Phoenix 
dactylifera]
Length=451

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/51 (82%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  79   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIH
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIH  86



>ref|XP_008781229.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=452

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/51 (82%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  79   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIH
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIH  86



>ref|XP_006408409.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49862.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=416

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG HFEIEVKP+D+VADVKK+IETVQG++VYPA++LMLIH
Sbjct  1    MKIFVKTLKGIHFEIEVKPDDSVADVKKNIETVQGADVYPAAKLMLIH  48



>ref|XP_010263555.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nelumbo 
nucifera]
Length=386

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEI+V PEDTVADVKK+IETVQG +VYPA Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIH  48



>ref|XP_010263550.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEI+V PEDTVADVKK+IETVQG +VYPA Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIH  48



>ref|XP_010525156.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
Length=407

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIH  48



>ref|XP_007033285.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
 gb|EOY04211.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
Length=350

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+I+T QG ++YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQMLIH  48



>ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera]
Length=383

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTV DVKK+IE+V G +VYPA Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVDDVKKNIESVHGPDVYPAGQQMLIH  48



>ref|XP_009356676.1| PREDICTED: ubiquitin receptor RAD23c-like [Pyrus x bretschneideri]
Length=384

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIH
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIH  48



>gb|EYU29968.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=375

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIH  48



>gb|EYU29967.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=376

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIH  48



>ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=487

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+I+T QG ++YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQMLIH  48



>gb|ABD96960.1| hypothetical protein [Cleome spinosa]
Length=435

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIH  48



>ref|XP_002283656.1| PREDICTED: ubiquitin receptor RAD23c [Vitis vinifera]
 emb|CBI33660.3| unnamed protein product [Vitis vinifera]
Length=381

 Score = 85.1 bits (209),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE V G++VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIELVHGTDVYPAAQQMLIH  48



>ref|XP_009784661.1| PREDICTED: ubiquitin receptor RAD23d [Nicotiana sylvestris]
Length=387

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIH  48



>gb|AII99835.1| putative DNA repair protein RAD23-3-like protein [Nicotiana tabacum]
Length=387

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIH  48



>ref|XP_008368214.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=378

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIH
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIH  48



>dbj|BAC76393.1| RAD23-like protein [Arabidopsis thaliana]
Length=337

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIH  48



>gb|ACJ83348.1| unknown [Medicago truncatula]
Length=159

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P+DT++ VKK+IETVQG +VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTISAVKKNIETVQGVDVYPAAQQMLIH  48



>ref|XP_007223091.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24290.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=322

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHF++ VKPEDTV+DVKK IET QGS+VYPASQ MLIH
Sbjct  1    MKIFVKTLKGTHFDVAVKPEDTVSDVKKQIETSQGSDVYPASQQMLIH  48



>ref|XP_004172134.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cucumis 
sativus]
Length=407

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_004135098.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cucumis 
sativus]
Length=407

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIH  48



>gb|KGN52072.1| hypothetical protein Csa_5G608600 [Cucumis sativus]
Length=420

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_008801153.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIH  48



>gb|KJB80004.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=384

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHF IEVKPED VADVKK+IETVQG++VYPA+Q MLI+
Sbjct  1    MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIY  48



>ref|XP_008446578.1| PREDICTED: ubiquitin receptor RAD23c-like [Cucumis melo]
Length=422

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_006299986.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
 gb|EOA32884.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
Length=427

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI+VKTLKGTHFEIEVKPED+++DVKK+IET QG++VYPA++LMLIH
Sbjct  1    MKIYVKTLKGTHFEIEVKPEDSISDVKKNIETAQGADVYPAAKLMLIH  48



>gb|KJB80005.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=385

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHF IEVKPED VADVKK+IETVQG++VYPA+Q MLI+
Sbjct  1    MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIY  48



>ref|XP_007046250.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
 gb|EOY02082.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
Length=340

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HF++EVK ED V+DVKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGSHFDVEVKAEDVVSDVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_011035053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Populus 
euphratica]
Length=373

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVY  48



>ref|XP_010552226.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIH  48



>ref|XP_010552232.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIH  48



>gb|KJB80001.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=320

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI+
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIY  48



>ref|XP_010926135.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Elaeis 
guineensis]
Length=395

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIH  48



>ref|XP_010926134.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Elaeis 
guineensis]
Length=396

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIH  48



>ref|XP_011035049.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Populus 
euphratica]
Length=390

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVY  48



>ref|XP_011035048.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=391

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVY  48



>ref|XP_007142903.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
 gb|ESW14897.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
Length=400

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV+P+DTV++VKKSIETVQG +VYPA+  MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDTVSEVKKSIETVQGVDVYPAALQMLIH  48



>ref|NP_001189793.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73826.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=418

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIH  48



>ref|NP_186903.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 sp|Q84L31.2|RD23C_ARATH RecName: Full=Ubiquitin receptor RAD23c; Short=AtRAD23c; AltName: 
Full=Putative DNA repair protein RAD23-3; AltName: Full=RAD23-like 
protein 3; Short=AtRAD23-3 [Arabidopsis thaliana]
 gb|AAF32461.1| putative RAD23 [Arabidopsis thaliana]
 gb|AAK62617.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 gb|AAM47342.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 dbj|BAC76392.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89116.1| Rad23-1 [synthetic construct]
 gb|AEE73824.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=419

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIH  48



>ref|XP_003555895.1| PREDICTED: ubiquitin receptor RAD23c-like isoform 1 [Glycine 
max]
 gb|KHN11428.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=402

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_007046249.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY02081.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=385

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HF++EVK ED V+DVKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGSHFDVEVKAEDVVSDVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_010926133.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIH  48



>ref|XP_011035052.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Populus 
euphratica]
Length=385

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVY  48



>ref|XP_011035051.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Populus 
euphratica]
Length=386

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVY  48



>gb|KHN05574.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=410

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_002305813.1| ubiquitin family protein [Populus trichocarpa]
 gb|EEE86324.1| ubiquitin family protein [Populus trichocarpa]
Length=385

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVY  48



>ref|XP_010926132.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Elaeis 
guineensis]
Length=422

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIH
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIH  48



>gb|KJB80000.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=382

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI+
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIY  48



>gb|KJB79998.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
 gb|KJB79999.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=384

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI+
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIY  48



>ref|XP_003536688.1| PREDICTED: ubiquitin receptor RAD23c [Glycine max]
Length=408

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_002884326.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60585.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVK ED+VADVKK+IETVQG++VYPA++ MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKLEDSVADVKKNIETVQGADVYPAAKQMLIH  48



>ref|XP_010916168.1| PREDICTED: ubiquitin receptor RAD23c-like [Elaeis guineensis]
Length=384

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTVADVK++IE  QG +VYPA Q MLI+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKRNIEATQGQSVYPAEQQMLIY  48



>ref|XP_007215515.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
 gb|EMJ16714.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
Length=385

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPE+ VADVKK IETVQG++VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTNFEIEVKPEEMVADVKKIIETVQGADVYPASQQMLIH  48



>ref|XP_008390012.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=359

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HF++EVKPEDTVADVKK IE  +GS+VYPA Q MLIH
Sbjct  1    MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEACKGSDVYPAPQQMLIH  48



>ref|XP_008775144.1| PREDICTED: ubiquitin receptor RAD23d-like [Phoenix dactylifera]
Length=384

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIF+KTLKGTHFEIEVKPEDTV DVK++IE  QG +VYPA Q MLIH
Sbjct  1    MKIFIKTLKGTHFEIEVKPEDTVTDVKRNIEATQGQSVYPAEQQMLIH  48



>ref|XP_004497101.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cicer arietinum]
Length=400

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKP+DT+++VKK+IE VQG +VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPQDTISEVKKNIENVQGVDVYPAAQQMLIH  48



>ref|XP_006584607.1| PREDICTED: uncharacterized protein LOC100813881 isoform X4 [Glycine 
max]
Length=383

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_009356279.1| PREDICTED: ubiquitin receptor RAD23d-like [Pyrus x bretschneideri]
Length=385

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+HF++EVKPEDTVADVKK IE  +GS+VYPA Q MLIH
Sbjct  1    MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEASKGSDVYPAPQQMLIH  48



>gb|KHN15504.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=416

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_006584608.1| PREDICTED: uncharacterized protein LOC100813881 isoform X5 [Glycine 
max]
Length=382

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIH  48



>gb|ACU18529.1| unknown [Glycine max]
Length=382

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_009399729.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG++FEI+V PEDTVADVKK+IET QG  VYPA Q MLIH
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIH  48



>ref|XP_009399730.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG++FEI+V PEDTVADVKK+IET QG  VYPA Q MLIH
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIH  48



>ref|XP_006437672.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50912.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=212

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIY  49



>ref|NP_001240201.1| uncharacterized protein LOC100809066 [Glycine max]
 gb|ACU22776.1| unknown [Glycine max]
 gb|KHN47572.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=392

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_006584606.1| PREDICTED: uncharacterized protein LOC100813881 isoform X3 [Glycine 
max]
Length=401

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIH  48



>ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max]
 gb|ACU21107.1| unknown [Glycine max]
Length=400

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIH  48



>gb|KJB79994.1| hypothetical protein B456_013G076500 [Gossypium raimondii]
Length=384

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPA+Q MLI+
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIY  48



>ref|XP_006584604.1| PREDICTED: uncharacterized protein LOC100813881 isoform X1 [Glycine 
max]
Length=469

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_006584605.1| PREDICTED: uncharacterized protein LOC100813881 isoform X2 [Glycine 
max]
Length=468

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIH  48



>ref|XP_008801157.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Phoenix 
dactylifera]
Length=367

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIH  48



>ref|XP_008230399.1| PREDICTED: ubiquitin receptor RAD23d [Prunus mume]
Length=385

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPE+ V+DVKK IETVQG++VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTNFEIEVKPEEMVSDVKKIIETVQGADVYPASQQMLIH  48



>ref|XP_008801156.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Phoenix 
dactylifera]
Length=370

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIH  48



>ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=409

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT F++EVKPEDT+ADVKKSIET QG++VYPA Q MLI+
Sbjct  1    MKIFVKTLKGTTFDVEVKPEDTIADVKKSIETTQGADVYPAGQQMLIY  48



>ref|XP_006437673.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50913.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=300

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIY  49



>gb|KJB79995.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=384

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLI  228
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPA+Q MLI
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLI  47



>ref|XP_008801154.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=388

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIH  48



>ref|XP_009417654.1| PREDICTED: ubiquitin receptor RAD23d-like [Musa acuminata subsp. 
malaccensis]
Length=391

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT+FEI+VKPEDTVADVK+ IET QG  VYPA Q MLIH
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVADVKRYIETSQGKTVYPADQQMLIH  48



>gb|KEH44233.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=397

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV P+DT++ VKK+IETVQG +VYPA+Q MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTISAVKKNIETVQGVDVYPAAQQMLIH  48



>emb|CDP02781.1| unnamed protein product [Coffea canephora]
Length=387

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGTHF+IEVKP+D+VADVK+ IET+QGS+VYPA+Q MLIH
Sbjct  1    MKVSVKTLKGTHFQIEVKPDDSVADVKRIIETIQGSDVYPAAQQMLIH  48



>ref|XP_010553920.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Tarenaya hassleriana]
Length=379

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIH
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIH  48



>ref|XP_010553921.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Tarenaya hassleriana]
Length=378

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIH
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIH  48



>ref|XP_008379541.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=387

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPE+TVADVK  IET QG++VYPA Q MLIH
Sbjct  1    MKVFVKTLKGTNFEIEVKPEETVADVKTIIETAQGADVYPAPQQMLIH  48



>ref|XP_006437674.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50914.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=331

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIY  49



>ref|XP_010907325.1| PREDICTED: ubiquitin receptor RAD23d-like [Elaeis guineensis]
Length=391

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDTVADVK+ IE+ QG +VYP+ Q MLIH
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKRIIESTQGQSVYPSEQQMLIH  48



>ref|XP_002312393.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
 gb|EEE89760.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
Length=333

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            M+IFVKTLKG+ F+IEVKPEDTVADVKK IET QG  VYPA Q MLIH
Sbjct  1    MRIFVKTLKGSTFDIEVKPEDTVADVKKKIETAQGVAVYPAEQQMLIH  48



>ref|XP_004299088.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=400

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIH  48



>ref|XP_011464118.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=401

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIH  48



>ref|XP_006383465.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
 gb|ERP61262.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
Length=399

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE VQG++VYPA+Q MLI+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENVQGADVYPAAQQMLIY  48



>gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas]
Length=382

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKP+D VADVKK+IETVQG++VYPA++ MLI+
Sbjct  1    MKVFVKTLKGTNFEIEVKPDDRVADVKKAIETVQGADVYPAAKQMLIY  48



>ref|XP_006437675.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50915.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=390

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIY  49



>ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=381

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEI+VKPEDTV DVK +IE  QG++VYPASQ MLIH
Sbjct  1    MKVFVKTLKGTNFEIDVKPEDTVEDVKNNIEIAQGADVYPASQQMLIH  48



>ref|XP_006484457.1| PREDICTED: ubiquitin receptor RAD23c-like [Citrus sinensis]
Length=390

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIY  49



>ref|XP_008341883.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=408

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+F IEVKPE+TVADVK  IET QG++VYPA Q MLIH
Sbjct  1    MKVFVKTLKGTNFAIEVKPEETVADVKTIIETAQGADVYPAPQQMLIH  48



>ref|XP_011021237.1| PREDICTED: ubiquitin receptor RAD23c isoform X5 [Populus euphratica]
Length=364

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIY  48



>ref|XP_011021236.1| PREDICTED: ubiquitin receptor RAD23c isoform X4 [Populus euphratica]
Length=381

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIY  48



>ref|XP_011021233.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Populus euphratica]
Length=382

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIY  48



>ref|XP_009391405.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT+FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIH
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIH  48



>ref|XP_009391404.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT+FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIH
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIH  48



>ref|XP_011021232.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Populus euphratica]
Length=398

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIY  48



>ref|XP_011021231.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Populus euphratica]
Length=399

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIY  48



>gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea]
Length=389

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 2/48 (4%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGTHFEIEVKPEDTV+DVK  IET QG   YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVSDVKTIIETAQGE--YPAAQQMLIH  46



>ref|XP_006846642.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
 gb|ERN08317.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
Length=389

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKG+HFEIEV+P DTV+ VKK+IET+ G +VYPA+Q +LIH
Sbjct  1    MKLFVKTLKGSHFEIEVEPSDTVSAVKKNIETIHGQDVYPAAQQLLIH  48



>ref|XP_007142901.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
 gb|ESW14895.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
Length=402

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGTHFEIEV+P+D V++VKKSIE+ QG++VYPA+  MLIH
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDAVSEVKKSIESAQGADVYPAALQMLIH  48



>ref|XP_011022053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Populus 
euphratica]
Length=324

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKG+ F+IEV+PEDTVADVKK+IET QG  VYPA Q MLIH
Sbjct  1    MKILVKTLKGSTFDIEVRPEDTVADVKKNIETAQGVAVYPAEQQMLIH  48



>ref|XP_011022044.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=378

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKG+ F+IEV+PEDTVADVKK+IET QG  VYPA Q MLIH
Sbjct  1    MKILVKTLKGSTFDIEVRPEDTVADVKKNIETAQGVAVYPAEQQMLIH  48



>ref|XP_002315945.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|EEF02116.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=396

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIY  48



>ref|XP_011007998.1| PREDICTED: ubiquitin receptor RAD23d-like [Populus euphratica]
Length=388

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIY  48



>ref|XP_010681568.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X6 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIY  51



>emb|CAA72741.1| RAD23, isoform I [Daucus carota]
Length=382

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI+VKTLKG+ FEI+V P+D+VADVK+SIET QG+ VYPA+Q MLI+
Sbjct  1    MKIYVKTLKGSQFEIQVNPDDSVADVKRSIETAQGAAVYPAAQQMLIY  48



>ref|XP_010681566.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIY  51



>ref|XP_010681564.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=392

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIY  51



>ref|XP_010681563.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIY  51



>ref|XP_010440953.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
 ref|XP_010440954.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
 ref|XP_010440955.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Camelina 
sativa]
 ref|XP_010440956.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Camelina 
sativa]
Length=377

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIH
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIH  47



>gb|AFK37901.1| unknown [Medicago truncatula]
Length=215

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKGTHFEI+V   DTV DVKK+IE  QG+ VYPA+Q MLIH
Sbjct  1    MKINVKTLKGTHFEIQVNLHDTVGDVKKNIEGAQGAAVYPAAQQMLIH  48



>ref|XP_006383464.1| ubiquitin family protein [Populus trichocarpa]
 gb|ERP61261.1| ubiquitin family protein [Populus trichocarpa]
Length=384

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 1/49 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDT-VADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEVKPEDT V +VKK+IE VQG++VYPA+Q MLI+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVVEVKKNIENVQGADVYPAAQQMLIY  49



>emb|CAC01850.1| putative protein [Arabidopsis thaliana]
Length=142

 Score = 72.0 bits (175),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKG  FEIEVKP D+VA+VKK+IETV G++ YPA+Q +LIH
Sbjct  1    MKIIVKTLKGIRFEIEVKPNDSVAEVKKNIETVMGASEYPAAQQILIH  48



>ref|NP_197113.4| uncharacterized protein [Arabidopsis thaliana]
 gb|AED92245.1| uncharacterized protein AT5G16090 [Arabidopsis thaliana]
Length=171

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKG  FEIEVKP D+VA+VKK+IETV G++ YPA+Q +LIH
Sbjct  1    MKIIVKTLKGIRFEIEVKPNDSVAEVKKNIETVMGASEYPAAQQILIH  48



>ref|XP_006655985.1| PREDICTED: ubiquitin receptor RAD23c-like [Oryza brachyantha]
Length=409

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIE  PE +VA+VKK IET QG NVYPA Q MLIH
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKKIIETTQGQNVYPADQQMLIH  48



>ref|XP_009357056.1| PREDICTED: ubiquitin receptor RAD23d [Pyrus x bretschneideri]
Length=391

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK++VKTLKGT+FEIEVK E+TVADVK  IET QG++VYPA Q MLIH
Sbjct  1    MKVYVKTLKGTNFEIEVKLEETVADVKTIIETAQGADVYPAPQQMLIH  48



>ref|XP_006283908.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
 gb|EOA16806.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
Length=385

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTL GT+FEIEVKP DTV++VKK+IETVQG+  YPA++ MLIH
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSEVKKAIETVQGAQ-YPAAKQMLIH  47



>emb|CDX69474.1| BnaA10g18230D [Brassica napus]
Length=365

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT FEI+V PED+V DVKK+IETV G   YPA++ +LIH
Sbjct  1    MKIFVKTLKGTRFEIQVSPEDSVGDVKKNIETVMGVTAYPAAEQVLIH  48



>ref|XP_004489115.1| PREDICTED: putative DNA repair protein RAD23-4-like [Cicer arietinum]
Length=377

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKGTHFEI+V  +DTV DVKK+IE VQG +VYPA+Q MLIH
Sbjct  1    MKINVKTLKGTHFEIQVNLQDTVGDVKKNIEAVQGVDVYPAAQQMLIH  48



>ref|XP_006603061.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Glycine 
max]
Length=350

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKGTHF ++V P+DTVA VKK+IET QG++VYPA+Q MLIH
Sbjct  1    MKINVKTLKGTHFVLQVNPQDTVAVVKKNIETAQGADVYPAAQQMLIH  48



>ref|XP_010681567.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIY  51



>ref|NP_001057334.1| Os06g0264300 [Oryza sativa Japonica Group]
 dbj|BAD54365.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD54370.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF19248.1| Os06g0264300 [Oryza sativa Japonica Group]
 gb|EAZ36555.1| hypothetical protein OsJ_20893 [Oryza sativa Japonica Group]
 dbj|BAG88004.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIH
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIH  48



>gb|EAZ00429.1| hypothetical protein OsI_22453 [Oryza sativa Indica Group]
Length=413

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIH
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIH  48



>ref|XP_002870839.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47098.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTL GT+FEIEVKP DTV+DVKK+IETV+G+  YPA + MLIH
Sbjct  1    MKIFVKTLSGTNFEIEVKPADTVSDVKKAIETVKGAE-YPAVKQMLIH  47



>emb|CDX69473.1| BnaA10g18220D [Brassica napus]
Length=659

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  79   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            ++ MKIFVKTLKG  FEI+VKPED VADVKK+IETV G   YPA++  LIH
Sbjct  350  KDKMKIFVKTLKGARFEIQVKPEDLVADVKKNIETVLGVTAYPAAEQRLIH  400


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 3/48 (6%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG  FEI+V  ED+VADVKK+IETV G     A++ MLIH
Sbjct  1    MKIFVKTLKGDRFEIQVNLEDSVADVKKNIETVMGVT---AAEQMLIH  45



>ref|XP_010681565.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIY  51



>ref|XP_003551850.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Glycine 
max]
 gb|KHN17319.1| Putative DNA repair protein RAD23-4 [Glycine soja]
Length=375

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKGTHF ++V P+DTVA VKK+IET QG++VYPA+Q MLIH
Sbjct  1    MKINVKTLKGTHFVLQVNPQDTVAVVKKNIETAQGADVYPAAQQMLIH  48



>gb|AFK37577.1| unknown [Lotus japonicus]
Length=376

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKGTHF+I+V  +D+VADVKK+IE  QG+ VYPA+Q MLIH
Sbjct  1    MKINVKTLKGTHFQIQVNLQDSVADVKKTIEVAQGAGVYPAAQQMLIH  48



>ref|XP_003563980.1| PREDICTED: ubiquitin receptor RAD23d-like [Brachypodium distachyon]
Length=413

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE  QG NVYPA Q MLIH
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIEGAQGQNVYPADQQMLIH  48



>gb|KCW86330.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=320

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKGT+FEIEV+P++ V DVKK IE +QG++++PASQ MLIH
Sbjct  1    MKINVKTLKGTNFEIEVEPQEAVVDVKKKIEIIQGASMFPASQQMLIH  48



>ref|XP_004304134.1| PREDICTED: ubiquitin receptor RAD23d-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTLKGT+FEIEV+P+  VADVK+ IE  QG++VYPAS+ MLIH
Sbjct  1    MKVFVKTLKGTNFEIEVEPKQLVADVKQVIEKAQGADVYPASKQMLIH  48



>ref|XP_010692904.1| PREDICTED: ubiquitin receptor RAD23d [Beta vulgaris subsp. vulgaris]
Length=409

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT+FEI+   +DTVADVKKSIE +QG+  YPA+  MLIH
Sbjct  1    MKIFVKTLKGTNFEIDANIDDTVADVKKSIEKIQGAETYPANLQMLIH  48



>gb|KFK33251.1| hypothetical protein AALP_AA6G350300 [Arabis alpina]
Length=392

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT+FEIEVKP DTV+DVKK+IET+ G + YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTNFEIEVKPVDTVSDVKKAIETLHGEH-YPAAQQMLIH  47



>gb|KEH21499.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=370

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKGTHFEI+V   DTV DVKK+IE  QG+ VYPA+Q MLIH
Sbjct  1    MKINVKTLKGTHFEIQVNLHDTVGDVKKNIEGAQGAAVYPAAQQMLIH  48



>ref|XP_010044267.1| PREDICTED: ubiquitin receptor RAD23d-like [Eucalyptus grandis]
 gb|KCW86329.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=401

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKGT+FEIEV+P++ V DVKK IE +QG++++PASQ MLIH
Sbjct  1    MKINVKTLKGTNFEIEVEPQEAVVDVKKKIEIIQGASMFPASQQMLIH  48



>gb|EMS50196.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=610

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+ FEIEV P D V+DVKK IET QG NVYPA Q MLI+
Sbjct  1    MKVSVKTLKGSKFEIEVNPADKVSDVKKLIETSQGQNVYPADQQMLIY  48



>ref|XP_006427691.1| hypothetical protein CICLE_v100258681mg, partial [Citrus clementina]
 gb|ESR40931.1| hypothetical protein CICLE_v100258681mg, partial [Citrus clementina]
Length=76

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIH  48



>ref|XP_004956777.1| PREDICTED: probable DNA repair protein RAD23-like isoform X1 
[Setaria italica]
Length=468

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+ F+IEV+  D VADVKK IE+ QG NVYPA Q MLIH
Sbjct  1    MKVSVKTLKGSSFQIEVEATDKVADVKKVIESTQGQNVYPADQQMLIH  48



>gb|ABY66298.1| RAD23-like protein [Brassica napus]
Length=357

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVK LKG  FEI+V PED+V DVKK+IETV G   YPA++ +LIH
Sbjct  1    MKIFVKNLKGARFEIQVSPEDSVGDVKKNIETVMGVTAYPAAEQVLIH  48



>ref|XP_009121516.1| PREDICTED: ubiquitin receptor RAD23c-like [Brassica rapa]
Length=357

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVK LKG  FEI+V PED+V DVKK+IETV G   YPA++ +LIH
Sbjct  1    MKIFVKNLKGARFEIQVSPEDSVGDVKKNIETVMGVTAYPAAEQVLIH  48



>ref|XP_010450906.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Camelina sativa]
Length=379

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIH
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIH  47



>ref|XP_010450905.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Camelina sativa]
Length=381

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIH
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIH  47



>ref|XP_010435751.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
Length=374

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIH
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIH  47



>ref|XP_010435749.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
Length=376

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIH
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIH  47



>gb|KDO46132.1| hypothetical protein CISIN_1g0198171mg [Citrus sinensis]
Length=197

 Score = 67.8 bits (164),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIH  48



>dbj|BAC76395.1| RAD23-like protein [Arabidopsis thaliana]
Length=343

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIH
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIH  47



>ref|XP_003578094.1| PREDICTED: probable ubiquitin receptor RAD23 [Brachypodium distachyon]
Length=395

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+ F+IEV P D V+DVKK IE+ QG NVYPA Q MLIH
Sbjct  1    MKVSVKTLKGSSFQIEVNPADKVSDVKKLIESSQGQNVYPADQQMLIH  48



>gb|KDO46130.1| hypothetical protein CISIN_1g0198171mg, partial [Citrus sinensis]
Length=260

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIH  48



>gb|KDO46129.1| hypothetical protein CISIN_1g0198171mg [Citrus sinensis]
Length=274

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIH  48



>gb|AAK59766.1| unknown protein [Arabidopsis thaliana]
Length=378

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIH
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIH  47



>ref|XP_004147454.1| PREDICTED: putative DNA repair protein RAD23-1-like [Cucumis 
sativus]
 gb|KGN59613.1| hypothetical protein Csa_3G829030 [Cucumis sativus]
Length=374

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HF+IEV+P DTV  VKK+IE VQG + YP SQ +LIH
Sbjct  1    MKLTVKTLKGSHFQIEVQPTDTVLGVKKNIENVQGKDSYPCSQQLLIH  48



>gb|KDO46131.1| hypothetical protein CISIN_1g0198171mg [Citrus sinensis]
Length=267

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIH  48



>ref|XP_009605626.1| PREDICTED: probable ubiquitin receptor RAD23a [Nicotiana tomentosiformis]
Length=108

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI V+P DT+  VKK IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTIMAVKKHIEDVQGKDNYPCGQQLLIH  48



>ref|XP_004956778.1| PREDICTED: probable DNA repair protein RAD23-like isoform X2 
[Setaria italica]
Length=394

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+ F+IEV+  D VADVKK IE+ QG NVYPA Q MLIH
Sbjct  1    MKVSVKTLKGSSFQIEVEATDKVADVKKVIESTQGQNVYPADQQMLIH  48



>ref|XP_006405766.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
 gb|ESQ47219.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
Length=389

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT+FEIEV   DT++DVKKSIET+ G   YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTNFEIEVNETDTISDVKKSIETIHGEQ-YPAAQQMLIH  47



>ref|XP_009139789.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=378

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT+FEIEV P DT++D K+ IET QG+  YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIH  47



>emb|CDY01661.1| BnaC04g30910D [Brassica napus]
Length=378

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT+FEIEV P DT++D K+ IET QG+  YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIH  47



>ref|XP_009121517.1| PREDICTED: ubiquitin receptor RAD23c-like [Brassica rapa]
Length=342

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKG  FEI+V  ED+VADVKK+IETV G N YPA++  LIH
Sbjct  1    MKIFVKTLKGDRFEIQVNLEDSVADVKKNIETVLGVNAYPAAEQRLIH  48



>gb|KFK25846.1| hypothetical protein AALP_AA8G169700 [Arabis alpina]
Length=410

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKI VKTLKG  F+I+VKP+D+VADVKK+IETV G + YPA++  LIH
Sbjct  1    MKIVVKTLKGDRFKIQVKPDDSVADVKKNIETVLGPSEYPAAEQTLIH  48



>emb|CBI25247.3| unnamed protein product [Vitis vinifera]
Length=399

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIH  48



>ref|XP_010655132.1| PREDICTED: ubiquitin receptor RAD23b [Vitis vinifera]
Length=411

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIH  48



>emb|CDX74522.1| BnaA04g08670D [Brassica napus]
Length=380

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT+FEIEV P DT++D K+ IE+ QG+  YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIESHQGAQ-YPAAQQMLIH  47



>gb|ACJ84340.1| unknown [Medicago truncatula]
Length=110

 Score = 63.9 bits (154),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI V P D++  VKK+IE +QG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVHPSDSIMAVKKNIEDIQGKDNYPCGQQLLIH  48



>ref|NP_001078680.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 gb|AED94322.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=332

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIH
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIH  47



>ref|XP_008443453.1| PREDICTED: ubiquitin receptor RAD23b-like [Cucumis melo]
 ref|XP_008443454.1| PREDICTED: ubiquitin receptor RAD23b-like [Cucumis melo]
Length=374

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HF+IEV+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFQIEVQPTDTVLGVKKNIENVQGKDSYPCGQQLLIH  48



>ref|XP_010246571.1| PREDICTED: ubiquitin receptor RAD23b-like [Nelumbo nucifera]
Length=378

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGTHFEI V+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGTHFEIRVQPGDTVMAVKKNIEDVQGKDSYPCGQQLLIH  48



>emb|CDX67404.1| BnaA07g14440D [Brassica napus]
Length=382

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIH  47



>ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=382

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIH  47



>dbj|BAJ98767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIY  48



>emb|CDY58121.1| BnaCnng32650D [Brassica napus]
Length=384

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIH
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIH  47



>ref|XP_002299163.1| DNA repair protein RAD23 [Populus trichocarpa]
 gb|EEE83968.1| DNA repair protein RAD23 [Populus trichocarpa]
Length=349

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI+V+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIKVQPTDTVMGVKKNIEDVQGKDNYPCGQQLLIH  48



>ref|XP_010268454.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nelumbo 
nucifera]
Length=344

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGTHFEI V+P DT+  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGTHFEIRVQPGDTIMAVKKTIEDVQGKDSYPCGQQLLIH  48



>ref|XP_011034604.1| PREDICTED: ubiquitin receptor RAD23b-like [Populus euphratica]
Length=375

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI+V+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIKVQPTDTVMGVKKNIEDVQGKDNYPCGQQLLIH  48



>ref|NP_001061854.1| Os08g0430200 [Oryza sativa Japonica Group]
 dbj|BAD01169.1| putative osRAD23 [Oryza sativa Japonica Group]
 dbj|BAF23768.1| Os08g0430200 [Oryza sativa Japonica Group]
 gb|EAZ42817.1| hypothetical protein OsJ_27402 [Oryza sativa Japonica Group]
 dbj|BAG89255.1| unnamed protein product [Oryza sativa Japonica Group]
Length=406

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ +KTLKG+ FEI+V+P   V+DVKK IE  QG NVYPA Q MLIH
Sbjct  1    MKVSIKTLKGSSFEIDVEPTSKVSDVKKLIEVTQGDNVYPADQQMLIH  48



>gb|EMT27109.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=423

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIY  48



>gb|EMS61794.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=424

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIY  48



>gb|KJB69954.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=317

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIH  48



>ref|XP_006368664.1| hypothetical protein POPTR_0001s07510g [Populus trichocarpa]
 gb|ABK95041.1| unknown [Populus trichocarpa]
 gb|ERP65233.1| hypothetical protein POPTR_0001s07510g [Populus trichocarpa]
Length=375

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI+V+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIKVQPTDTVMGVKKNIEDVQGKDNYPCGQQLLIH  48



>gb|EAZ07072.1| hypothetical protein OsI_29318 [Oryza sativa Indica Group]
Length=406

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ +KTLKG+ FEI+V+P   V+DVKK IE  QG NVYPA Q MLIH
Sbjct  1    MKVSIKTLKGSSFEIDVEPTSKVSDVKKLIEVTQGDNVYPADQQMLIH  48



>dbj|BAJ97496.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=420

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIY  48



>gb|EYU24565.1| hypothetical protein MIMGU_mgv1a008731mg [Erythranthe guttata]
Length=327

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HF+I V P DTV  VKKSIE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFQITVHPNDTVMAVKKSIEDVQGKDNYPCGQQLLIH  48



>gb|ACF83232.1| unknown [Zea mays]
 gb|AFW66285.1| hypothetical protein ZEAMMB73_839350 [Zea mays]
Length=185

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLI  228
            MK+ VKTLKGTHFEI V+P DT+  VKK+IE +QG + YP  Q +LI
Sbjct  1    MKLTVKTLKGTHFEIRVQPNDTIMAVKKNIEEIQGKDSYPWGQQLLI  47



>ref|XP_010268452.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010268453.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGTHFEI V+P DT+  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGTHFEIRVQPGDTIMAVKKTIEDVQGKDSYPCGQQLLIH  48



>ref|XP_009408042.1| PREDICTED: ubiquitin receptor RAD23b-like [Musa acuminata subsp. 
malaccensis]
Length=388

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKGTHFEI V+P DT+  VKK+IE +QG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGTHFEIRVQPNDTIMAVKKNIEQIQGKDSYPWGQQLLIH  48



>ref|XP_008228865.1| PREDICTED: ubiquitin receptor RAD23b-like [Prunus mume]
Length=374

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVQPTDTVMAVKKNIEDVQGKDNYPCGQQLLIH  48



>ref|XP_007215553.1| hypothetical protein PRUPE_ppa007284mg [Prunus persica]
 gb|EMJ16752.1| hypothetical protein PRUPE_ppa007284mg [Prunus persica]
Length=374

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIH  231
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVQPTDTVMAVKKNIEDVQGKDNYPCGQQLLIH  48



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566855288900