BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF007H24

Length=307
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601270.1|  PREDICTED: uncharacterized protein LOC104096590  98.2    4e-23   
ref|XP_009763074.1|  PREDICTED: trafficking protein particle comp...  99.8    2e-22   Nicotiana sylvestris
ref|XP_009763075.1|  PREDICTED: trafficking protein particle comp...  98.6    4e-22   Nicotiana sylvestris
ref|XP_004248116.1|  PREDICTED: trafficking protein particle comp...  96.3    4e-21   Solanum lycopersicum
ref|XP_006361038.1|  PREDICTED: trafficking protein particle comp...  96.3    4e-21   Solanum tuberosum [potatoes]
ref|XP_009763076.1|  PREDICTED: uncharacterized protein LOC104215035  96.3    1e-20   Nicotiana sylvestris
emb|CDO99569.1|  unnamed protein product                              91.3    2e-19   Coffea canephora [robusta coffee]
ref|XP_011086106.1|  PREDICTED: trafficking protein particle comp...  90.9    3e-19   Sesamum indicum [beniseed]
gb|EYU43414.1|  hypothetical protein MIMGU_mgv1a006364mg              87.4    7e-18   Erythranthe guttata [common monkey flower]
gb|KDO75901.1|  hypothetical protein CISIN_1g013275mg                 84.0    9e-17   Citrus sinensis [apfelsine]
gb|KDO75899.1|  hypothetical protein CISIN_1g013275mg                 82.8    3e-16   Citrus sinensis [apfelsine]
ref|XP_006467831.1|  PREDICTED: trafficking protein particle comp...  82.8    3e-16   Citrus sinensis [apfelsine]
gb|KDO75900.1|  hypothetical protein CISIN_1g013275mg                 82.8    3e-16   Citrus sinensis [apfelsine]
ref|XP_006467830.1|  PREDICTED: trafficking protein particle comp...  82.8    4e-16   Citrus sinensis [apfelsine]
ref|XP_002269604.1|  PREDICTED: trafficking protein particle comp...  82.0    6e-16   Vitis vinifera
ref|XP_006449307.1|  hypothetical protein CICLE_v10015324mg           81.6    9e-16   
gb|EPS70413.1|  hypothetical protein M569_04348                       76.3    2e-15   Genlisea aurea
gb|KDP20945.1|  hypothetical protein JCGZ_21416                       80.1    2e-15   Jatropha curcas
ref|XP_007025671.1|  Uncharacterized protein TCM_029905               79.7    4e-15   
gb|KJB66700.1|  hypothetical protein B456_010G152800                  78.2    2e-14   Gossypium raimondii
ref|XP_008442355.1|  PREDICTED: trafficking protein particle comp...  77.8    2e-14   Cucumis melo [Oriental melon]
ref|XP_004170160.1|  PREDICTED: UPF0533 protein C5orf44-like          75.5    3e-14   
ref|XP_002305809.2|  hypothetical protein POPTR_0004s04060g           77.0    4e-14   
gb|KJB66698.1|  hypothetical protein B456_010G152800                  76.6    5e-14   Gossypium raimondii
gb|KJB66696.1|  hypothetical protein B456_010G152800                  76.3    5e-14   Gossypium raimondii
gb|KJB66693.1|  hypothetical protein B456_010G152800                  76.3    6e-14   Gossypium raimondii
gb|KJB66697.1|  hypothetical protein B456_010G152800                  76.6    6e-14   Gossypium raimondii
gb|KJB66692.1|  hypothetical protein B456_010G152800                  76.6    6e-14   Gossypium raimondii
gb|KJB66694.1|  hypothetical protein B456_010G152800                  76.6    6e-14   Gossypium raimondii
gb|KJB66695.1|  hypothetical protein B456_010G152800                  76.3    6e-14   Gossypium raimondii
gb|KJB66699.1|  hypothetical protein B456_010G152800                  76.3    6e-14   Gossypium raimondii
gb|KHG04640.1|  Uncharacterized protein F383_28963                    76.3    6e-14   Gossypium arboreum [tree cotton]
ref|XP_011027876.1|  PREDICTED: trafficking protein particle comp...  75.9    1e-13   Populus euphratica
ref|XP_011027875.1|  PREDICTED: trafficking protein particle comp...  75.5    1e-13   Populus euphratica
ref|XP_004146594.1|  PREDICTED: UPF0533 protein C5orf44-like          75.1    2e-13   Cucumis sativus [cucumbers]
ref|XP_010052333.1|  PREDICTED: trafficking protein particle comp...  74.7    2e-13   Eucalyptus grandis [rose gum]
ref|XP_010052332.1|  PREDICTED: trafficking protein particle comp...  74.7    2e-13   Eucalyptus grandis [rose gum]
gb|KCW76267.1|  hypothetical protein EUGRSUZ_D00641                   74.3    2e-13   Eucalyptus grandis [rose gum]
gb|KJB69490.1|  hypothetical protein B456_011G026200                  74.7    2e-13   Gossypium raimondii
gb|KHG23067.1|  hypothetical protein F383_05884                       74.3    3e-13   Gossypium arboreum [tree cotton]
emb|CDY53029.1|  BnaC04g00010D                                        74.7    3e-13   Brassica napus [oilseed rape]
gb|KJB69489.1|  hypothetical protein B456_011G026200                  72.0    4e-13   Gossypium raimondii
ref|XP_009335614.1|  PREDICTED: trafficking protein particle comp...  71.6    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_009142491.1|  PREDICTED: trafficking protein particle comp...  70.9    4e-12   Brassica rapa
emb|CDX80144.1|  BnaA05g00120D                                        71.2    5e-12   
ref|XP_009142490.1|  PREDICTED: trafficking protein particle comp...  71.2    5e-12   Brassica rapa
ref|XP_009335677.1|  PREDICTED: trafficking protein particle comp...  71.2    5e-12   Pyrus x bretschneideri [bai li]
ref|XP_008225054.1|  PREDICTED: trafficking protein particle comp...  70.5    7e-12   Prunus mume [ume]
ref|XP_008225055.1|  PREDICTED: trafficking protein particle comp...  70.5    7e-12   Prunus mume [ume]
ref|XP_008383772.1|  PREDICTED: trafficking protein particle comp...  70.5    8e-12   Malus domestica [apple tree]
ref|XP_010241986.1|  PREDICTED: trafficking protein particle comp...  70.1    1e-11   Nelumbo nucifera [Indian lotus]
ref|XP_006827801.1|  hypothetical protein AMTR_s00009p00267300        69.7    2e-11   
ref|XP_010241984.1|  PREDICTED: trafficking protein particle comp...  69.7    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010241983.1|  PREDICTED: trafficking protein particle comp...  69.7    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010241985.1|  PREDICTED: trafficking protein particle comp...  69.7    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_007211856.1|  hypothetical protein PRUPE_ppa004769mg           69.3    2e-11   
ref|XP_002519036.1|  expressed protein, putative                      68.9    2e-11   Ricinus communis
ref|XP_008356052.1|  PREDICTED: trafficking protein particle comp...  66.2    2e-11   
ref|XP_010272687.1|  PREDICTED: trafficking protein particle comp...  68.9    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_006293426.1|  hypothetical protein CARUB_v10025351mg           68.6    4e-11   Capsella rubella
ref|XP_006390324.1|  hypothetical protein EUTSA_v10018568mg           68.2    4e-11   Eutrema salsugineum [saltwater cress]
ref|XP_006594322.1|  PREDICTED: trafficking protein particle comp...  67.4    7e-11   
ref|XP_003542760.1|  PREDICTED: trafficking protein particle comp...  67.4    8e-11   Glycine max [soybeans]
gb|KHN10018.1|  UPF0533 protein C5orf44 like                          63.9    3e-10   Glycine soja [wild soybean]
ref|XP_010506845.1|  PREDICTED: trafficking protein particle comp...  65.9    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010507826.1|  PREDICTED: trafficking protein particle comp...  65.9    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002880336.1|  hypothetical protein ARALYDRAFT_483987           65.5    5e-10   
ref|XP_003529314.1|  PREDICTED: trafficking protein particle comp...  65.1    5e-10   Glycine max [soybeans]
ref|XP_010100548.1|  hypothetical protein L484_012103                 65.1    5e-10   
ref|XP_006583814.1|  PREDICTED: trafficking protein particle comp...  65.1    6e-10   
ref|NP_566117.1|  uncharacterized protein                             64.3    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010686533.1|  PREDICTED: trafficking protein particle comp...  62.8    3e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008806523.1|  PREDICTED: trafficking protein particle comp...  59.7    4e-08   Phoenix dactylifera
ref|XP_004293599.2|  PREDICTED: trafficking protein particle comp...  58.5    1e-07   Fragaria vesca subsp. vesca
ref|XP_003637387.1|  hypothetical protein MTR_084s0010                57.8    2e-07   
gb|AFK36098.1|  unknown                                               57.8    2e-07   Medicago truncatula
gb|KEH31094.1|  UPF0533 C5orf44-like protein                          57.4    2e-07   Medicago truncatula
ref|XP_010918425.1|  PREDICTED: trafficking protein particle comp...  57.4    3e-07   
ref|XP_010918426.1|  PREDICTED: trafficking protein particle comp...  57.4    3e-07   Elaeis guineensis
ref|XP_010918423.1|  PREDICTED: trafficking protein particle comp...  57.4    3e-07   Elaeis guineensis
ref|XP_001756136.1|  predicted protein                                57.8    3e-07   
gb|KEH31093.1|  UPF0533 C5orf44-like protein                          57.4    3e-07   Medicago truncatula
ref|XP_010545059.1|  PREDICTED: trafficking protein particle comp...  56.2    7e-07   Tarenaya hassleriana [spider flower]
ref|XP_004505040.1|  PREDICTED: UPF0533 protein C5orf44 homolog       54.7    2e-06   Cicer arietinum [garbanzo]
ref|XP_002970996.1|  hypothetical protein SELMODRAFT_95233            48.5    3e-04   
ref|XP_002962093.1|  hypothetical protein SELMODRAFT_76214            48.1    3e-04   
ref|XP_007159314.1|  hypothetical protein PHAVU_002G2277001g          43.9    6e-04   Phaseolus vulgaris [French bean]



>ref|XP_009601270.1| PREDICTED: uncharacterized protein LOC104096590 [Nicotiana tomentosiformis]
Length=167

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+TQ PHSLAFRVMRLCRPSLHVETPLRF+  DLLFGEDLFDD +AA+HLPRLL+
Sbjct  4    SSTQGPHSLAFRVMRLCRPSLHVETPLRFDPTDLLFGEDLFDDPVAAEHLPRLLA  58



>ref|XP_009763074.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Nicotiana sylvestris]
Length=450

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+TQ PHSLAFRVMRLCRPSLH+ETPLRF+  DLLFGEDLFDD +AA+HLPRLL+
Sbjct  4    SSTQGPHSLAFRVMRLCRPSLHIETPLRFDPTDLLFGEDLFDDPVAAEHLPRLLA  58



>ref|XP_009763075.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Nicotiana sylvestris]
Length=412

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+TQ PHSLAFRVMRLCRPSLH+ETPLRF+  DLLFGEDLFDD +AA+HLPRLL+
Sbjct  4    SSTQGPHSLAFRVMRLCRPSLHIETPLRFDPTDLLFGEDLFDDPVAAEHLPRLLA  58



>ref|XP_004248116.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Solanum lycopersicum]
Length=446

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+TQ PHSLAFRVMRLCRPSLHVE P+RF+  DLLFGEDLFDD +AA HLPRLL+
Sbjct  4    SSTQGPHSLAFRVMRLCRPSLHVEIPVRFDPSDLLFGEDLFDDPVAASHLPRLLA  58



>ref|XP_006361038.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Solanum tuberosum]
Length=449

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+TQ PHSLAFRVMRLCRPSLHVE P+RF+  DLLFGEDLFDD +AA HLPRLL+
Sbjct  4    SSTQGPHSLAFRVMRLCRPSLHVEIPVRFDPSDLLFGEDLFDDPVAASHLPRLLA  58



>ref|XP_009763076.1| PREDICTED: uncharacterized protein LOC104215035 [Nicotiana sylvestris]
Length=680

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+TQ PHSLAFRVMRLCRPSLHVETPLRF+   LLFGEDLFDD +AA+HLPRLL+
Sbjct  4    SSTQGPHSLAFRVMRLCRPSLHVETPLRFDPTYLLFGEDLFDDPVAAEHLPRLLA  58



>emb|CDO99569.1| unnamed protein product [Coffea canephora]
Length=439

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            S++Q  HSLAFRVMRLCRPSLHVETPL+F+ CDLLFGEDLFD   AA HLPRLL
Sbjct  2    SSSQASHSLAFRVMRLCRPSLHVETPLKFDPCDLLFGEDLFDHPPAAAHLPRLL  55



>ref|XP_011086106.1| PREDICTED: trafficking protein particle complex subunit 13 [Sesamum 
indicum]
Length=446

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 1/53 (2%)
 Frame = +3

Query  147  HSLAFRVMRLCRPSLHVET-PLRFNACDLLFGEDLFDDSLAADHLPRLLSGDS  302
            HSLAFRVMRLCRP+LHV+T PL+F+ CD+LFGEDLFDD +AA HLPRLLS  S
Sbjct  13   HSLAFRVMRLCRPTLHVDTAPLKFDPCDILFGEDLFDDPIAASHLPRLLSSQS  65



>gb|EYU43414.1| hypothetical protein MIMGU_mgv1a006364mg [Erythranthe guttata]
Length=447

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 1/53 (2%)
 Frame = +3

Query  147  HSLAFRVMRLCRPSLHVE-TPLRFNACDLLFGEDLFDDSLAADHLPRLLSGDS  302
            HSLAFRVMRLCRP+LHV+ +PL+F+ CDLLFGEDLFDD +AA HLPRLLS  S
Sbjct  14   HSLAFRVMRLCRPTLHVDISPLKFDPCDLLFGEDLFDDPIAASHLPRLLSSQS  66



>gb|KDO75901.1| hypothetical protein CISIN_1g013275mg [Citrus sinensis]
Length=405

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLSGD  299
            S+T   HSLAFRVMRLCRPSLHVE PLR +  DL  GED+FDD +AA +LP L+S D
Sbjct  2    SSTPGTHSLAFRVMRLCRPSLHVEPPLRVDPTDLFIGEDIFDDPIAASNLPPLISSD  58



>gb|KDO75899.1| hypothetical protein CISIN_1g013275mg [Citrus sinensis]
Length=433

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLSGD  299
            S+T   HSLAFRVMRLCRPSLHVE PLR +  DL  GED+FDD +AA +LP L+S D
Sbjct  2    SSTPGTHSLAFRVMRLCRPSLHVEPPLRVDPTDLFIGEDIFDDPIAASNLPPLISSD  58



>ref|XP_006467831.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X2 [Citrus sinensis]
 gb|KDO75898.1| hypothetical protein CISIN_1g013275mg [Citrus sinensis]
Length=439

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLSGD  299
            S+T   HSLAFRVMRLCRPSLHVE PLR +  DL  GED+FDD +AA +LP L+S D
Sbjct  2    SSTPGTHSLAFRVMRLCRPSLHVEPPLRVDPTDLFIGEDIFDDPIAASNLPPLISSD  58



>gb|KDO75900.1| hypothetical protein CISIN_1g013275mg [Citrus sinensis]
Length=446

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLSGD  299
            S+T   HSLAFRVMRLCRPSLHVE PLR +  DL  GED+FDD +AA +LP L+S D
Sbjct  2    SSTPGTHSLAFRVMRLCRPSLHVEPPLRVDPTDLFIGEDIFDDPIAASNLPPLISSD  58



>ref|XP_006467830.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X1 [Citrus sinensis]
 gb|KDO75897.1| hypothetical protein CISIN_1g013275mg [Citrus sinensis]
Length=446

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLSGD  299
            S+T   HSLAFRVMRLCRPSLHVE PLR +  DL  GED+FDD +AA +LP L+S D
Sbjct  2    SSTPGTHSLAFRVMRLCRPSLHVEPPLRVDPTDLFIGEDIFDDPIAASNLPPLISSD  58



>ref|XP_002269604.1| PREDICTED: trafficking protein particle complex subunit 13 [Vitis 
vinifera]
 emb|CBI41051.3| unnamed protein product [Vitis vinifera]
Length=438

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            S+ QT HSLAFRVMRLCRPS HV+ PLR +  DLL GED+FDD LAA  LPRLL
Sbjct  2    SSGQTSHSLAFRVMRLCRPSFHVDNPLRLDPADLLAGEDIFDDPLAASDLPRLL  55



>ref|XP_006449307.1| hypothetical protein CICLE_v10015324mg [Citrus clementina]
 gb|ESR62547.1| hypothetical protein CICLE_v10015324mg [Citrus clementina]
Length=429

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLSGD  299
            S+T   HSLAFRVMRLCRPSLHVE PLR +  DL  GED+FDD +AA +LP L++ D
Sbjct  2    SSTPGTHSLAFRVMRLCRPSLHVEPPLRVDPTDLFIGEDIFDDPIAASNLPPLIASD  58



>gb|EPS70413.1| hypothetical protein M569_04348 [Genlisea aurea]
Length=101

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +3

Query  117  MSSSSATQTPHSLAFRVMRLCRPSLHVE-TPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            MS     Q  HSLAFRVMRLCRP+LHVE +PLRF+ CDLL GED FDD  AA +  RL+ 
Sbjct  1    MSGGGGGQVAHSLAFRVMRLCRPTLHVESSPLRFDPCDLLVGEDFFDDPAAAANRHRLVG  60



>gb|KDP20945.1| hypothetical protein JCGZ_21416 [Jatropha curcas]
Length=434

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLSG  296
            S TQ  HSLAFRVMRLC+PS HV+ PLR +  DL+ GED+FDD +AA  LP L+ G
Sbjct  2    STTQGTHSLAFRVMRLCKPSFHVDAPLRVDPADLIVGEDIFDDPIAASRLPPLIDG  57



>ref|XP_007025671.1| Uncharacterized protein TCM_029905 [Theobroma cacao]
 gb|EOY28293.1| Uncharacterized protein TCM_029905 [Theobroma cacao]
Length=440

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD+LAA +LP LLS
Sbjct  2    STTQQGTHSLAFRVMRLCKPSFHVEPPFRLDPADLFVGEDIFDDALAASNLPPLLS  57



>gb|KJB66700.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=498

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD LAA +LP LLS
Sbjct  2    STTQQGTHSLAFRVMRLCKPSFHVEPPFRLDPADLFVGEDIFDDPLAAANLPPLLS  57



>ref|XP_008442355.1| PREDICTED: trafficking protein particle complex subunit 13 [Cucumis 
melo]
Length=440

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLSGD  299
            S+TQ  HSLAFRVMRLCRPS  V+ PLR +  DLL GED+ DD +AA+ LPRLL+  
Sbjct  2    SSTQGSHSLAFRVMRLCRPSFQVDPPLRIDPVDLLVGEDILDDPVAANQLPRLLAAQ  58



>ref|XP_004170160.1| PREDICTED: UPF0533 protein C5orf44-like, partial [Cucumis sativus]
Length=278

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  120  SSSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S  S  Q  HSLAFRVMRLCRPS  V+ PLR +  DLL GED+ DD +AA+ LPRLL+
Sbjct  76   SEMSNAQGSHSLAFRVMRLCRPSFQVDPPLRLDPVDLLVGEDILDDPVAANQLPRLLA  133



>ref|XP_002305809.2| hypothetical protein POPTR_0004s04060g [Populus trichocarpa]
 gb|EEE86320.2| hypothetical protein POPTR_0004s04060g [Populus trichocarpa]
Length=434

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 3/58 (5%)
 Frame = +3

Query  117  MSSSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            MS++ ATQ   SLAFRVMRLCRPS HV+TPL  +  DL+ GED+FDD LAA HLP L+
Sbjct  1    MSTAPATQ---SLAFRVMRLCRPSFHVDTPLLLDPSDLILGEDIFDDPLAATHLPPLI  55



>gb|KJB66698.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=432

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD LAA +LP LLS
Sbjct  2    STTQQGTHSLAFRVMRLCKPSFHVEPPFRLDPADLFVGEDIFDDPLAAANLPPLLS  57



>gb|KJB66696.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=417

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD LAA +LP LLS
Sbjct  2    STTQQGTHSLAFRVMRLCKPSFHVEPPFRLDPADLFVGEDIFDDPLAAANLPPLLS  57



>gb|KJB66693.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=419

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD LAA +LP LLS
Sbjct  2    STTQQGTHSLAFRVMRLCKPSFHVEPPFRLDPADLFVGEDIFDDPLAAANLPPLLS  57



>gb|KJB66697.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=437

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD LAA +LP LLS
Sbjct  2    STTQQGTHSLAFRVMRLCKPSFHVEPPFRLDPADLFVGEDIFDDPLAAANLPPLLS  57



>gb|KJB66692.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=440

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD LAA +LP LLS
Sbjct  2    STTQQGTHSLAFRVMRLCKPSFHVEPPFRLDPADLFVGEDIFDDPLAAANLPPLLS  57



>gb|KJB66694.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=441

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD LAA +LP LLS
Sbjct  2    STTQQGTHSLAFRVMRLCKPSFHVEPPFRLDPADLFVGEDIFDDPLAAANLPPLLS  57



>gb|KJB66695.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=430

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD LAA +LP LLS
Sbjct  2    STTQQGTHSLAFRVMRLCKPSFHVEPPFRLDPADLFVGEDIFDDPLAAANLPPLLS  57



>gb|KJB66699.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=442

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD LAA +LP LLS
Sbjct  2    STTQQGTHSLAFRVMRLCKPSFHVEPPFRLDPADLFVGEDIFDDPLAAANLPPLLS  57



>gb|KHG04640.1| Uncharacterized protein F383_28963 [Gossypium arboreum]
Length=442

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD LAA +LP LLS
Sbjct  2    STTQQGTHSLAFRVMRLCKPSFHVEPPFRLDPADLFVGEDIFDDPLAAANLPPLLS  57



>ref|XP_011027876.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Populus euphratica]
Length=426

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 3/58 (5%)
 Frame = +3

Query  117  MSSSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            MS+  ATQ   SLAFRVMRLCRPS HV+TPL  +  DL+ GED+FDD LAA HLP L+
Sbjct  1    MSTPPATQ---SLAFRVMRLCRPSFHVDTPLLLDPSDLILGEDIFDDPLAATHLPPLI  55



>ref|XP_011027875.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Populus euphratica]
Length=439

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 3/58 (5%)
 Frame = +3

Query  117  MSSSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            MS+  ATQ   SLAFRVMRLCRPS HV+TPL  +  DL+ GED+FDD LAA HLP L+
Sbjct  1    MSTPPATQ---SLAFRVMRLCRPSFHVDTPLLLDPSDLILGEDIFDDPLAATHLPPLI  55



>ref|XP_004146594.1| PREDICTED: UPF0533 protein C5orf44-like [Cucumis sativus]
 gb|KGN64666.1| hypothetical protein Csa_1G073730 [Cucumis sativus]
Length=440

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S  Q  HSLAFRVMRLCRPS  V+ PLR +  DLL GED+ DD +AA+ LPRLL+
Sbjct  2    SNAQGSHSLAFRVMRLCRPSFQVDPPLRLDPVDLLVGEDILDDPVAANQLPRLLA  56



>ref|XP_010052333.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Eucalyptus grandis]
Length=401

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S TQ PHSLAFRVMRLCRPSL VE PL  +  DLL GED+ DD LAA  LP LL+
Sbjct  2    STTQGPHSLAFRVMRLCRPSLLVEPPLLVHPSDLLAGEDILDDPLAASRLPSLLA  56



>ref|XP_010052332.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Eucalyptus grandis]
 gb|KCW76266.1| hypothetical protein EUGRSUZ_D00641 [Eucalyptus grandis]
Length=440

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S TQ PHSLAFRVMRLCRPSL VE PL  +  DLL GED+ DD LAA  LP LL+
Sbjct  2    STTQGPHSLAFRVMRLCRPSLLVEPPLLVHPSDLLAGEDILDDPLAASRLPSLLA  56



>gb|KCW76267.1| hypothetical protein EUGRSUZ_D00641 [Eucalyptus grandis]
Length=382

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S TQ PHSLAFRVMRLCRPSL VE PL  +  DLL GED+ DD LAA  LP LL+
Sbjct  2    STTQGPHSLAFRVMRLCRPSLLVEPPLLVHPSDLLAGEDILDDPLAASRLPSLLA  56



>gb|KJB69490.1| hypothetical protein B456_011G026200 [Gossypium raimondii]
Length=442

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD LAA +L  LLS
Sbjct  2    STTPQGIHSLAFRVMRLCKPSFHVEPPFRLDPSDLFVGEDIFDDPLAASNLSPLLS  57



>gb|KHG23067.1| hypothetical protein F383_05884 [Gossypium arboreum]
Length=401

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD LAA +L  LLS
Sbjct  2    STTPQGIHSLAFRVMRLCKPSFHVEPPFRLDPSDLFVGEDIFDDPLAASNLSPLLS  57



>emb|CDY53029.1| BnaC04g00010D [Brassica napus]
Length=521

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  108  LEKMSSSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRL  287
            L +  S+ ATQ PHSLAFRVMRLC+PS HV+ PLR +  DLL GED  DD  +A  L R 
Sbjct  40   LSERMSTGATQGPHSLAFRVMRLCKPSFHVDPPLRIDPFDLLAGEDFSDDPTSASLLRRH  99

Query  288  LS  293
            LS
Sbjct  100  LS  101



>gb|KJB69489.1| hypothetical protein B456_011G026200 [Gossypium raimondii]
Length=210

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+  Q  HSLAFRVMRLC+PS HVE P R +  DL  GED+FDD LAA +L  LLS
Sbjct  2    STTPQGIHSLAFRVMRLCKPSFHVEPPFRLDPSDLFVGEDIFDDPLAASNLSPLLS  57



>ref|XP_009335614.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Pyrus x bretschneideri]
Length=447

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVE-TPLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            SS    PHSLAFRVMRLC+PS  V+  PL  +  DL+ GED+FDD +AA  LPRLL
Sbjct  2    SSGQGGPHSLAFRVMRLCKPSFQVDPIPLLLDPADLVVGEDIFDDPMAAAQLPRLL  57



>ref|XP_009142491.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Brassica rapa]
Length=361

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  123  SSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+ ATQ PHSLAFRVMRLC+PS HV+ PLR +  DLL GED  DD  +A  L R LS
Sbjct  2    STGATQGPHSLAFRVMRLCKPSFHVDPPLRIDPFDLLAGEDFSDDPASASLLRRHLS  58



>emb|CDX80144.1| BnaA05g00120D [Brassica napus]
Length=439

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  123  SSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+ ATQ PHSLAFRVMRLC+PS HV+ PLR +  DLL GED  DD  +A  L R LS
Sbjct  2    STGATQGPHSLAFRVMRLCKPSFHVDPPLRIDPFDLLAGEDFSDDPASASLLRRHLS  58



>ref|XP_009142490.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Brassica rapa]
Length=439

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  123  SSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            S+ ATQ PHSLAFRVMRLC+PS HV+ PLR +  DLL GED  DD  +A  L R LS
Sbjct  2    STGATQGPHSLAFRVMRLCKPSFHVDPPLRIDPFDLLAGEDFSDDPASASLLRRHLS  58



>ref|XP_009335677.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Pyrus x bretschneideri]
Length=445

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVE-TPLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            SS    PHSLAFRVMRLC+PS  V+  PL  +  DL+ GED+FDD +AA  LPRLL
Sbjct  2    SSGQGGPHSLAFRVMRLCKPSFQVDPIPLLLDPADLVVGEDIFDDPMAAAQLPRLL  57



>ref|XP_008225054.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Prunus mume]
Length=439

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVE-TPLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            SS    PHSLAFRVMRLC+PS  V+  PL  +  DL+ GED+FDD +AA  LPRLL
Sbjct  2    SSGQGGPHSLAFRVMRLCKPSFQVDPIPLLLDPSDLIVGEDIFDDPIAAAQLPRLL  57



>ref|XP_008225055.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Prunus mume]
Length=434

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVE-TPLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            SS    PHSLAFRVMRLC+PS  V+  PL  +  DL+ GED+FDD +AA  LPRLL
Sbjct  2    SSGQGGPHSLAFRVMRLCKPSFQVDPIPLLLDPSDLIVGEDIFDDPIAAAQLPRLL  57



>ref|XP_008383772.1| PREDICTED: trafficking protein particle complex subunit 13 [Malus 
domestica]
Length=445

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVE-TPLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            SS    PH+LAFRVMRLC+PS  V+  PL  +  DL+ GED+FDD +AA  LPRLL
Sbjct  2    SSVQAGPHALAFRVMRLCKPSFQVDPIPLLLDPADLVVGEDIFDDPIAAAQLPRLL  57



>ref|XP_010241986.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X4 [Nelumbo nucifera]
Length=441

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            SAT   HSLAFRVMRLCRPS HVE PL+ +  DLL GED+FDD  AA HLPRL S
Sbjct  2    SATAGSHSLAFRVMRLCRPSFHVENPLQLDPLDLLTGEDIFDDPSAASHLPRLFS  56



>ref|XP_006827801.1| hypothetical protein AMTR_s00009p00267300 [Amborella trichopoda]
 gb|ERM95217.1| hypothetical protein AMTR_s00009p00267300 [Amborella trichopoda]
Length=488

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNA-CDLLFGEDLFDDSLAADHLPRLLS  293
            S+T   HSLAFRVMRLCRPS  V+ PL+ +   DLLFGEDLFD+  A D   RLLS
Sbjct  2    SSTPGSHSLAFRVMRLCRPSFQVDHPLKLDPLSDLLFGEDLFDNGEAIDQFSRLLS  57



>ref|XP_010241984.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X2 [Nelumbo nucifera]
Length=529

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            SAT   HSLAFRVMRLCRPS HVE PL+ +  DLL GED+FDD  AA HLPRL S
Sbjct  2    SATAGSHSLAFRVMRLCRPSFHVENPLQLDPLDLLTGEDIFDDPSAASHLPRLFS  56



>ref|XP_010241983.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X1 [Nelumbo nucifera]
Length=530

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            SAT   HSLAFRVMRLCRPS HVE PL+ +  DLL GED+FDD  AA HLPRL S
Sbjct  2    SATAGSHSLAFRVMRLCRPSFHVENPLQLDPLDLLTGEDIFDDPSAASHLPRLFS  56



>ref|XP_010241985.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X3 [Nelumbo nucifera]
Length=525

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            SAT   HSLAFRVMRLCRPS HVE PL+ +  DLL GED+FDD  AA HLPRL S
Sbjct  2    SATAGSHSLAFRVMRLCRPSFHVENPLQLDPLDLLTGEDIFDDPSAASHLPRLFS  56



>ref|XP_007211856.1| hypothetical protein PRUPE_ppa004769mg [Prunus persica]
 gb|EMJ13055.1| hypothetical protein PRUPE_ppa004769mg [Prunus persica]
Length=492

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVE-TPLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            SS    PHSLAFRVMRLC+PS  V+  PL  +  DL+ GED+FDD +A+  LPRLL
Sbjct  2    SSGQGGPHSLAFRVMRLCKPSFQVDPIPLLLDPSDLVVGEDIFDDPIASAQLPRLL  57



>ref|XP_002519036.1| expressed protein, putative [Ricinus communis]
 gb|EEF43247.1| expressed protein, putative [Ricinus communis]
Length=434

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            S T   HSLAFRVMRLCRPS HV+  L  +  DL+ GED+FDD +AA  LP L+
Sbjct  2    STTPGTHSLAFRVMRLCRPSFHVDAQLLVDPSDLIVGEDIFDDPVAASRLPPLI  55



>ref|XP_008356052.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Malus domestica]
Length=133

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +3

Query  126  SSATQTPHSLAFRVMRLCRPSLHVE-TPLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            SS    PH LAFRVMRLC+PS  V+  PL  +  DL+ GED+FDD +AA  LPRLL
Sbjct  2    SSGQGGPHXLAFRVMRLCKPSXQVDPIPLLLDPADLVVGEDVFDDPMAAAQLPRLL  57



>ref|XP_010272687.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Nelumbo nucifera]
Length=442

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDD--SLAADHLPRLL  290
            +A+   HSL FRVMRLCRPS  V+ PLRF++ DLL GED+FDD  +++   LPRL 
Sbjct  2    NASMGLHSLTFRVMRLCRPSFQVDDPLRFDSLDLLTGEDIFDDPATVSQAQLPRLF  57



>ref|XP_006293426.1| hypothetical protein CARUB_v10025351mg [Capsella rubella]
 gb|EOA26324.1| hypothetical protein CARUB_v10025351mg [Capsella rubella]
Length=444

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  120  SSSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            ++ + TQ PHSLAFRVMRLC+PS HV+ PLR +  DLL GED  DD  +A    RL+S
Sbjct  3    ATQTQTQGPHSLAFRVMRLCKPSFHVDPPLRIDPFDLLAGEDFSDDPSSASLFRRLVS  60



>ref|XP_006390324.1| hypothetical protein EUTSA_v10018568mg [Eutrema salsugineum]
 gb|ESQ27610.1| hypothetical protein EUTSA_v10018568mg [Eutrema salsugineum]
Length=440

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            SATQ PHSLAFRVMRLC+PS HV+ PLR +  DLL GED  DD  +A    R +S
Sbjct  2    SATQGPHSLAFRVMRLCKPSFHVDPPLRIDPFDLLAGEDFSDDPTSASLFRRHVS  56



>ref|XP_006594322.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X2 [Glycine max]
Length=403

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  147  HSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADH  275
            HSLAFRVMRLCRPS +VE PLR +  DL  GEDLFDD  A  H
Sbjct  13   HSLAFRVMRLCRPSFNVEPPLRLDPTDLFVGEDLFDDPAAKPH  55



>ref|XP_003542760.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X1 [Glycine max]
Length=440

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  147  HSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADH  275
            HSLAFRVMRLCRPS +VE PLR +  DL  GEDLFDD  A  H
Sbjct  13   HSLAFRVMRLCRPSFNVEPPLRLDPTDLFVGEDLFDDPAAKPH  55



>gb|KHN10018.1| UPF0533 protein C5orf44 like [Glycine soja]
Length=211

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  147  HSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADH  275
            HSLAFRVMRLCRPS +VE PLR +  DL  GEDLFDD  A  H
Sbjct  13   HSLAFRVMRLCRPSFNVEPPLRLDPTDLFVGEDLFDDPAAKPH  55



>ref|XP_010506845.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Camelina sativa]
Length=441

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  120  SSSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            ++ + TQ PHSLAFRVMRLC+PS HV+ PLR +  DLL GED  DD  +A    R +S
Sbjct  3    ATQTQTQGPHSLAFRVMRLCKPSFHVDPPLRIDPFDLLAGEDFSDDPSSASLFRRHVS  60



>ref|XP_010507826.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Camelina sativa]
 ref|XP_010507827.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Camelina sativa]
Length=444

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  120  SSSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            ++ + TQ PHSLAFRVMRLC+PS HV+ PLR +  DLL GED  DD  +A    R +S
Sbjct  3    ATQTQTQGPHSLAFRVMRLCKPSFHVDPPLRIDPFDLLAGEDFSDDPSSASLFRRHVS  60



>ref|XP_002880336.1| hypothetical protein ARALYDRAFT_483987 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56595.1| hypothetical protein ARALYDRAFT_483987 [Arabidopsis lyrata subsp. 
lyrata]
Length=443

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            SAT  PHSLAFRVMRLC+PS HV+ PLR +  DLL GED  DD  +A    R +S
Sbjct  2    SATHGPHSLAFRVMRLCKPSFHVDPPLRIDPFDLLAGEDFSDDPSSASLFRRHVS  56



>ref|XP_003529314.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X1 [Glycine max]
Length=435

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  147  HSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLA  266
            HSLAFRVMRLCRPS +VE PLR +  DL  GEDLFDD  A
Sbjct  12   HSLAFRVMRLCRPSFNVEPPLRLDPADLFAGEDLFDDPAA  51



>ref|XP_010100548.1| hypothetical protein L484_012103 [Morus notabilis]
 gb|EXB82791.1| hypothetical protein L484_012103 [Morus notabilis]
Length=454

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = +3

Query  153  LAFRVMRLCRPSLHVET-PLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            LAFRVMRLCRPS H +  PLR +  DLL GED+FDD LAA  LPRLL
Sbjct  16   LAFRVMRLCRPSFHADPLPLRVDPADLLVGEDIFDDPLAAASLPRLL  62



>ref|XP_006583814.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X2 [Glycine max]
Length=430

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  147  HSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLA  266
            HSLAFRVMRLCRPS +VE PLR +  DL  GEDLFDD  A
Sbjct  12   HSLAFRVMRLCRPSFNVEPPLRLDPADLFAGEDLFDDPAA  51



>ref|NP_566117.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL16264.1|AF428334_1 At2g47960/T9J23.10 [Arabidopsis thaliana]
 gb|AAL67048.1| unknown protein [Arabidopsis thaliana]
 gb|AAC63650.2| expressed protein [Arabidopsis thaliana]
 gb|AAM15133.1| expressed protein [Arabidopsis thaliana]
 gb|AAM45021.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10917.1| uncharacterized protein AT2G47960 [Arabidopsis thaliana]
Length=442

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 40/59 (68%), Gaps = 4/59 (7%)
 Frame = +3

Query  129  SATQT----PHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            SATQT    PHSLAFRVMRLC+PS HV+ PLR +  DLL GED  DD  +A    R +S
Sbjct  2    SATQTQTHGPHSLAFRVMRLCKPSFHVDPPLRIDPFDLLAGEDFSDDPSSASLFRRHVS  60



>ref|XP_010686533.1| PREDICTED: trafficking protein particle complex subunit 13 [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  QTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGED  245
            Q  HSLAFRVMRLCRPSLHVETPL F+  DLL GED
Sbjct  20   QVNHSLAFRVMRLCRPSLHVETPLLFDPADLLIGED  55



>ref|XP_008806523.1| PREDICTED: trafficking protein particle complex subunit 13 [Phoenix 
dactylifera]
Length=447

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +3

Query  132  ATQTPHSLAFRVMRLCRPSLHVETP-LRFNACDLLFGEDLFDDSLAADHL  278
             + T HSLAFRVMRLCRPS   E   LR +  DLL GEDLFDD   + HL
Sbjct  8    GSPTQHSLAFRVMRLCRPSFQAEDAILRLDPSDLLAGEDLFDDPRVSPHL  57



>ref|XP_004293599.2| PREDICTED: trafficking protein particle complex subunit 13 [Fragaria 
vesca subsp. vesca]
Length=445

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  120  SSSSATQTPHSLAFRVMRLCRPSLHVET-PLRFNACDLLFGEDLFDDSLAADHLPRLL  290
            S       PHSLAFRVMRLC+PS  VE+ PL  +  DLL GED+FDD LAA  +PRLL
Sbjct  3    SGGGGQGGPHSLAFRVMRLCKPSFQVESLPLLLDPADLLVGEDIFDDPLAAVQVPRLL  60



>ref|XP_003637387.1| hypothetical protein MTR_084s0010 [Medicago truncatula]
Length=446

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  147  HSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLA  266
            HS+AFRVMRLCRPS +V+ PLR +  DL  GED FDD  A
Sbjct  14   HSVAFRVMRLCRPSFNVDPPLRIDPDDLFVGEDHFDDPSA  53



>gb|AFK36098.1| unknown [Medicago truncatula]
 gb|KEH31092.1| UPF0533 C5orf44-like protein [Medicago truncatula]
Length=437

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  147  HSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLA  266
            HS+AFRVMRLCRPS +V+ PLR +  DL  GED FDD  A
Sbjct  14   HSVAFRVMRLCRPSFNVDPPLRIDPDDLFVGEDHFDDPSA  53



>gb|KEH31094.1| UPF0533 C5orf44-like protein [Medicago truncatula]
Length=419

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  147  HSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLA  266
            HS+AFRVMRLCRPS +V+ PLR +  DL  GED FDD  A
Sbjct  14   HSVAFRVMRLCRPSFNVDPPLRIDPDDLFVGEDHFDDPSA  53



>ref|XP_010918425.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Elaeis guineensis]
Length=443

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETP-LRFNACDLLFGEDLFDDSLAADHL  278
            + + T HSLAFRVMRLCRPS   E   LR +  DLL GEDLFDD   + HL
Sbjct  7    AGSPTHHSLAFRVMRLCRPSFQAEDAILRLDPSDLLAGEDLFDDPRVSSHL  57



>ref|XP_010918426.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Elaeis guineensis]
Length=440

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETP-LRFNACDLLFGEDLFDDSLAADHL  278
            + + T HSLAFRVMRLCRPS   E   LR +  DLL GEDLFDD   + HL
Sbjct  7    AGSPTHHSLAFRVMRLCRPSFQAEDAILRLDPSDLLAGEDLFDDPRVSSHL  57



>ref|XP_010918423.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Elaeis guineensis]
Length=444

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETP-LRFNACDLLFGEDLFDDSLAADHL  278
            + + T HSLAFRVMRLCRPS   E   LR +  DLL GEDLFDD   + HL
Sbjct  7    AGSPTHHSLAFRVMRLCRPSFQAEDAILRLDPSDLLAGEDLFDDPRVSSHL  57



>ref|XP_001756136.1| predicted protein [Physcomitrella patens]
 gb|EDQ79002.1| predicted protein [Physcomitrella patens]
Length=518

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = +3

Query  114  KMSSSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFD  254
            KMSS     T HSLAFRVMRLCRP+L V+  LRF+  DL+ GEDL D
Sbjct  59   KMSSGPGG-TGHSLAFRVMRLCRPALQVDLGLRFDPMDLVQGEDLHD  104



>gb|KEH31093.1| UPF0533 C5orf44-like protein [Medicago truncatula]
Length=432

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  147  HSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLA  266
            HS+AFRVMRLCRPS +V+ PLR +  DL  GED FDD  A
Sbjct  14   HSVAFRVMRLCRPSFNVDPPLRIDPDDLFVGEDHFDDPSA  53



>ref|XP_010545059.1| PREDICTED: trafficking protein particle complex subunit 13 [Tarenaya 
hassleriana]
 ref|XP_010545060.1| PREDICTED: trafficking protein particle complex subunit 13 [Tarenaya 
hassleriana]
Length=441

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  129  SATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLS  293
            SATQ PHSLAFRVMRLC+PS HV+ PLR +  DLL GED  DD  +A  L RL+S
Sbjct  2    SATQGPHSLAFRVMRLCKPSFHVDPPLRLDPLDLLAGEDFSDDPSSASLLRRLVS  56



>ref|XP_004505040.1| PREDICTED: UPF0533 protein C5orf44 homolog [Cicer arietinum]
Length=434

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  153  LAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLA  266
            +AFRVMRLCRPS +V+ PLR +  DL  GED+FDD  A
Sbjct  13   VAFRVMRLCRPSFNVDPPLRLDPDDLFVGEDIFDDPSA  50



>ref|XP_002970996.1| hypothetical protein SELMODRAFT_95233 [Selaginella moellendorffii]
 gb|EFJ27594.1| hypothetical protein SELMODRAFT_95233 [Selaginella moellendorffii]
Length=439

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 3/59 (5%)
 Frame = +3

Query  123  SSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLSGD  299
            +S A    HSLAFRVMRLCRPS  V+ PL  +  D+  GED  +     + LP L++G+
Sbjct  2    TSGAGAAGHSLAFRVMRLCRPSCQVDHPLLVDPSDVCNGEDSVN---FKELLPGLVNGN  57



>ref|XP_002962093.1| hypothetical protein SELMODRAFT_76214 [Selaginella moellendorffii]
 gb|EFJ37353.1| hypothetical protein SELMODRAFT_76214 [Selaginella moellendorffii]
Length=439

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 3/59 (5%)
 Frame = +3

Query  123  SSSATQTPHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPRLLSGD  299
            +S A    HSLAFRVMRLCRPS  V+ PL  +  D+  GED  +     + LP L++G+
Sbjct  2    TSGAGAAGHSLAFRVMRLCRPSCQVDHPLLVDPSDVCNGEDSVN---FKELLPGLVNGN  57



>ref|XP_007159314.1| hypothetical protein PHAVU_002G2277001g, partial [Phaseolus vulgaris]
 gb|ESW31308.1| hypothetical protein PHAVU_002G2277001g, partial [Phaseolus vulgaris]
Length=42

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  147  HSLAFRVMRLCRPSLHVETPLRFNACDLL  233
            HSLAFRVMRLCRPS +V+ PLR +  DL 
Sbjct  14   HSLAFRVMRLCRPSFNVDPPLRLDPTDLF  42



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560813144135