BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF007E18

Length=484
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACJ84523.1|  unknown                                                 198   9e-61   Medicago truncatula
ref|XP_003608101.1|  Mitogen-activated protein kinase                   199   4e-60   
gb|AHJ80962.1|  mitogen-activated protein kinase 2                      202   7e-60   Morus notabilis
ref|XP_010101362.1|  Mitogen-activated protein kinase-MMK1-like p...    202   8e-60   
emb|CAN72393.1|  hypothetical protein VITISV_019292                     195   2e-59   Vitis vinifera
ref|XP_003608100.1|  Mitogen-activated protein kinase                   199   1e-58   Medicago truncatula
gb|KHN31012.1|  Mitogen-activated protein kinase like MMK1              199   1e-58   Glycine soja [wild soybean]
gb|AID46462.1|  MAP kinase 1                                            198   2e-58   Vigna mungo [urad dal]
ref|NP_001235426.1|  mitogen-activated protein kinase 2                 198   2e-58   Glycine max [soybeans]
gb|KHN32349.1|  Mitogen-activated protein kinase like MMK1              198   5e-58   Glycine soja [wild soybean]
sp|Q07176.1|MMK1_MEDSA  RecName: Full=Mitogen-activated protein k...    197   5e-58   Medicago sativa [alfalfa]
sp|Q40532.1|NTF4_TOBAC  RecName: Full=Mitogen-activated protein k...    195   2e-57   Nicotiana tabacum [American tobacco]
ref|XP_010650725.1|  PREDICTED: mitogen-activated protein kinase ...    195   3e-57   Vitis vinifera
ref|XP_008394276.1|  PREDICTED: mitogen-activated protein kinase ...    194   5e-57   
ref|NP_181907.1|  MAP kinase 6                                          194   7e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004505140.1|  PREDICTED: mitogen-activated protein kinase ...    194   8e-57   
ref|NP_001275113.1|  mitogen-activated protein kinase homolog NTF...    194   9e-57   Solanum tuberosum [potatoes]
ref|XP_007153722.1|  hypothetical protein PHAVU_003G059500g             193   2e-56   Phaseolus vulgaris [French bean]
gb|ABG54333.1|  double HA-tagged mitogen activated protein kinase 6     193   2e-56   synthetic construct
gb|KCW63920.1|  hypothetical protein EUGRSUZ_G01599                     191   3e-56   Eucalyptus grandis [rose gum]
ref|XP_009358393.1|  PREDICTED: mitogen-activated protein kinase ...    192   3e-56   Pyrus x bretschneideri [bai li]
ref|XP_002880067.1|  hypothetical protein ARALYDRAFT_903782             192   3e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_007202173.1|  hypothetical protein PRUPE_ppa006536mg             192   3e-56   Prunus persica
ref|XP_008445483.1|  PREDICTED: mitogen-activated protein kinase ...    192   4e-56   Cucumis melo [Oriental melon]
ref|XP_004144187.1|  PREDICTED: mitogen-activated protein kinase ...    192   4e-56   Cucumis sativus [cucumbers]
ref|XP_008243044.1|  PREDICTED: mitogen-activated protein kinase ...    192   4e-56   Prunus mume [ume]
gb|ACG60597.1|  mitogen activated protein kinase 2                      191   8e-56   Solanum peruvianum [Peruvian tomato]
emb|CDX83459.1|  BnaA03g20470D                                          191   9e-56   
ref|NP_001234355.1|  mitogen-activated protein kinase 2                 191   9e-56   Solanum lycopersicum
gb|ADM89008.1|  MPK6 protein                                            191   9e-56   Brassica napus [oilseed rape]
ref|XP_010066116.1|  PREDICTED: mitogen-activated protein kinase ...    191   1e-55   Eucalyptus grandis [rose gum]
emb|CDY17911.1|  BnaC04g03080D                                          191   1e-55   Brassica napus [oilseed rape]
ref|XP_009133635.1|  PREDICTED: mitogen-activated protein kinase ...    191   1e-55   Brassica rapa
ref|NP_001280856.1|  mitogen-activated protein kinase homolog D5        191   2e-55   Malus domestica [apple tree]
emb|CDX79801.1|  BnaA05g03550D                                          190   2e-55   
ref|XP_011097634.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    190   2e-55   
ref|XP_009142961.1|  PREDICTED: mitogen-activated protein kinase 6      190   2e-55   Brassica rapa
ref|XP_006397553.1|  hypothetical protein EUTSA_v10001439mg             191   3e-55   
ref|XP_010508373.1|  PREDICTED: mitogen-activated protein kinase 6      190   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_008384112.1|  PREDICTED: mitogen-activated protein kinase ...    190   4e-55   
gb|AGA37189.1|  mitogen-activated protein kinase 6.1                    189   4e-55   Brassica napus [oilseed rape]
gb|AAN65179.1|  mitogen-activated protein kinase 6                      189   5e-55   Petroselinum crispum
ref|XP_010506280.1|  PREDICTED: mitogen-activated protein kinase ...    189   5e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009366225.1|  PREDICTED: mitogen-activated protein kinase ...    189   7e-55   Pyrus x bretschneideri [bai li]
ref|XP_010526635.1|  PREDICTED: mitogen-activated protein kinase ...    189   9e-55   Tarenaya hassleriana [spider flower]
gb|EYU23922.1|  hypothetical protein MIMGU_mgv1a008052mg                188   1e-54   Erythranthe guttata [common monkey flower]
gb|ABO65104.1|  mitogen-activated protein kinase Naf4                   182   1e-54   Nicotiana attenuata
gb|AHX99575.1|  mitogen-activated protein kinase 6                      188   1e-54   Betula platyphylla [Asian white birch]
ref|XP_010517958.1|  PREDICTED: mitogen-activated protein kinase ...    188   1e-54   
ref|XP_006351058.1|  PREDICTED: mitogen-activated protein kinase ...    188   2e-54   
emb|CDY44256.1|  BnaC03g24480D                                          187   3e-54   Brassica napus [oilseed rape]
gb|EYU22909.1|  hypothetical protein MIMGU_mgv1a007972mg                186   8e-54   Erythranthe guttata [common monkey flower]
ref|XP_006583849.1|  PREDICTED: mitogen-activated protein kinase ...    186   8e-54   Glycine max [soybeans]
ref|XP_003529369.1|  PREDICTED: mitogen-activated protein kinase ...    186   1e-53   Glycine max [soybeans]
ref|XP_010530307.1|  PREDICTED: mitogen-activated protein kinase 6      185   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_009770220.1|  PREDICTED: mitogen-activated protein kinase ...    185   2e-53   Nicotiana sylvestris
dbj|BAG50820.1|  MAP kinase                                             185   3e-53   Nicotiana benthamiana
dbj|BAC53772.1|  salicylic acid-induced protein kinase                  184   3e-53   Nicotiana benthamiana
gb|KJB29907.1|  hypothetical protein B456_005G123100                    181   4e-53   Gossypium raimondii
gb|ABB16418.1|  mitogen-activated protein kinase Ntf4-2                 184   5e-53   Nicotiana tabacum [American tobacco]
gb|AAZ23128.1|  mitogen-activated protein kinase 1                      184   5e-53   Arachis hypogaea [goober]
gb|KFK37200.1|  hypothetical protein AALP_AA4G227200                    184   7e-53   Arabis alpina [alpine rockcress]
ref|XP_002310398.2|  mitogen-activated protein kinase 7                 183   9e-53   Populus trichocarpa [western balsam poplar]
dbj|BAG50821.1|  MAP kinase                                             183   1e-52   Nicotiana benthamiana
ref|XP_006294349.1|  hypothetical protein CARUB_v10023366mg             183   2e-52   Capsella rubella
gb|KJB29908.1|  hypothetical protein B456_005G123100                    181   2e-52   Gossypium raimondii
ref|XP_010672463.1|  PREDICTED: mitogen-activated protein kinase ...    182   3e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|AJA29666.1|  mitogen-activated protein kinase 6                      182   4e-52   Gossypium hirsutum [American cotton]
gb|KHG06263.1|  Mitogen-activated protein kinase NTF4                   182   4e-52   Gossypium arboreum [tree cotton]
gb|AAF81420.1|  MAP kinase 2                                            181   6e-52   Capsicum annuum
gb|ADT65136.1|  mitogen-activated protein kinase                        181   6e-52   Gossypium hirsutum [American cotton]
gb|KDP35142.1|  hypothetical protein JCGZ_10676                         179   3e-51   Jatropha curcas
ref|XP_009389895.1|  PREDICTED: mitogen-activated protein kinase ...    179   4e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABB16417.1|  mitogen-activated protein kinase Ntf4-1                 179   5e-51   Nicotiana tabacum [American tobacco]
ref|XP_006492790.1|  PREDICTED: mitogen-activated protein kinase ...    178   7e-51   Citrus sinensis [apfelsine]
ref|XP_011001813.1|  PREDICTED: mitogen-activated protein kinase ...    177   1e-50   Populus euphratica
ref|XP_007033688.1|  Mitogen-activated protein kinase 6                 178   1e-50   
emb|CDP08056.1|  unnamed protein product                                177   2e-50   Coffea canephora [robusta coffee]
gb|AAF65766.1|AF242308_1  mitogen-activated protein kinase              177   2e-50   Euphorbia esula [wolf's milk]
ref|XP_006442196.1|  hypothetical protein CICLE_v10020481mg             177   3e-50   Citrus clementina [clementine]
ref|NP_001152745.1|  ABA stimulation MAP kinase                         176   6e-50   
gb|ABJ89812.1|  salicylic acid-activated MAP kinase                     176   6e-50   Nicotiana attenuata
ref|XP_004287157.1|  PREDICTED: mitogen-activated protein kinase ...    175   1e-49   Fragaria vesca subsp. vesca
gb|AHN53386.1|  MAPK6 protein                                           175   1e-49   Solanum tuberosum [potatoes]
ref|NP_001275321.1|  mitogen-activated protein kinase homolog NTF...    175   1e-49   Solanum tuberosum [potatoes]
ref|XP_011074877.1|  PREDICTED: mitogen-activated protein kinase ...    175   1e-49   Sesamum indicum [beniseed]
gb|KHG30807.1|  Mitogen-activated protein kinase MMK1                   175   1e-49   Gossypium arboreum [tree cotton]
gb|AEG64802.1|  mitogen-activated protein kinase                        175   1e-49   Gossypium hirsutum [American cotton]
ref|XP_004964813.1|  PREDICTED: mitogen-activated protein kinase ...    175   2e-49   Setaria italica
ref|NP_001234011.1|  Mitogen-activated protein kinase                   174   3e-49   
ref|XP_010271099.1|  PREDICTED: mitogen-activated protein kinase ...    171   3e-49   Nelumbo nucifera [Indian lotus]
gb|AAP20419.1|  mitogen-activated protein kinase 1                      174   3e-49   Solanum lycopersicum
ref|XP_009606346.1|  PREDICTED: mitogen-activated protein kinase ...    174   5e-49   Nicotiana tomentosiformis
gb|EPS60369.1|  hypothetical protein M569_14432                         172   1e-48   Genlisea aurea
emb|CAH05023.1|  putative MAP kinase                                    172   1e-48   Papaver rhoeas [field poppy]
gb|KJB27807.1|  hypothetical protein B456_005G011100                    172   2e-48   Gossypium raimondii
ref|XP_002524853.1|  big map kinase/bmk, putative                       171   4e-48   Ricinus communis
ref|XP_011047652.1|  PREDICTED: mitogen-activated protein kinase ...    171   5e-48   Populus euphratica
ref|XP_002323707.2|  mitogen-activated protein kinase 7                 171   5e-48   
sp|Q06060.1|MPK_PEA  RecName: Full=Mitogen-activated protein kina...    170   8e-48   Pisum sativum [garden pea]
ref|XP_009399824.1|  PREDICTED: mitogen-activated protein kinase 1      170   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN39979.1|  unknown                                                 169   1e-47   Picea sitchensis
gb|ACN39845.1|  unknown                                                 169   3e-47   Picea sitchensis
gb|ACT63866.1|  mitogen activated protein kinase 6                      168   5e-47   Pinus taeda
gb|AAO16560.1|  mitogen-activated protein kinase                        168   6e-47   Triticum aestivum [Canadian hard winter wheat]
gb|AFW85791.1|  putative MAP kinase family protein                      167   9e-47   
gb|AAY90121.1|  mitogen-activated protein kinase                        168   9e-47   Rheum australe [Himalayan rhubarb]
gb|ACG37232.1|  MPK6 - putative MAPK                                    167   9e-47   Zea mays [maize]
gb|AEM97899.1|  sucrose-activated protein kinase                        166   2e-46   Cephalostachyum fuchsianum
gb|EEC80038.1|  hypothetical protein OsI_21727                          166   3e-46   Oryza sativa Indica Group [Indian rice]
emb|CAC79662.1|  mitogen activated protein kinase                       165   6e-46   Capsicum annuum
ref|NP_001056846.1|  Os06g0154500                                       165   9e-46   
ref|XP_009419763.1|  PREDICTED: mitogen-activated protein kinase ...    165   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006655804.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    164   2e-45   
ref|XP_010925649.1|  PREDICTED: mitogen-activated protein kinase ...    164   2e-45   Elaeis guineensis
ref|NP_001266884.1|  uncharacterized protein LOC100834779               164   3e-45   Brachypodium distachyon [annual false brome]
ref|XP_010246606.1|  PREDICTED: mitogen-activated protein kinase ...    163   4e-45   Nelumbo nucifera [Indian lotus]
ref|XP_008781104.1|  PREDICTED: mitogen-activated protein kinase ...    161   4e-45   
dbj|BAJ90351.1|  predicted protein                                      162   9e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF85409.1|  unknown                                                 162   1e-44   Zea mays [maize]
ref|XP_002437855.1|  hypothetical protein SORBIDRAFT_10g003810          162   1e-44   Sorghum bicolor [broomcorn]
gb|KHG09868.1|  Mitogen-activated protein kinase MMK1                   161   3e-44   Gossypium arboreum [tree cotton]
ref|XP_008780958.1|  PREDICTED: mitogen-activated protein kinase ...    161   3e-44   Phoenix dactylifera
ref|XP_010915532.1|  PREDICTED: mitogen-activated protein kinase 1      160   6e-44   
gb|KJB71607.1|  hypothetical protein B456_011G132800                    158   6e-44   Gossypium raimondii
gb|KJB71606.1|  hypothetical protein B456_011G132800                    158   1e-43   Gossypium raimondii
gb|ACD76439.1|  mitogen activated protein kinase 6                      158   2e-43   Oryza sativa Indica Group [Indian rice]
gb|KJB71605.1|  hypothetical protein B456_011G132800                    159   3e-43   Gossypium raimondii
ref|XP_008812083.1|  PREDICTED: mitogen-activated protein kinase 1      158   3e-43   Phoenix dactylifera
ref|NP_001104843.1|  MAP kinase2                                        157   1e-42   
ref|XP_006845036.1|  hypothetical protein AMTR_s00058p00218380          152   9e-41   
ref|NP_001237882.1|  mitogen-activated protein kinase 1                 149   5e-40   
gb|KHN22030.1|  Mitogen-activated protein kinase 3                      149   5e-40   Glycine soja [wild soybean]
gb|AFK40694.1|  unknown                                                 143   2e-39   Lotus japonicus
gb|AGS78125.1|  mitogen activated protein kinase 1                      147   2e-39   Curcuma longa
gb|ACU19570.1|  unknown                                                 142   3e-39   Glycine max [soybeans]
gb|ACJ84868.1|  unknown                                                 146   3e-39   Medicago truncatula
ref|XP_003606509.1|  Mitogen-activated protein kinase                   147   4e-39   
emb|CAA57721.1|  protein kinase                                         147   4e-39   Medicago sativa [alfalfa]
gb|AAF73236.1|AF153061_1  MAP kinase 3                                  147   5e-39   Pisum sativum [garden pea]
ref|XP_009596748.1|  PREDICTED: mitogen-activated protein kinase ...    138   1e-38   Nicotiana tomentosiformis
ref|XP_007132166.1|  hypothetical protein PHAVU_011G071400g             144   2e-38   Phaseolus vulgaris [French bean]
gb|AAZ23129.1|  mitogen-activated protein kinase 2                      145   2e-38   Arachis hypogaea [goober]
gb|ABM67698.1|  mitogen-activated protein kinase                        145   2e-38   Citrus sinensis [apfelsine]
gb|AEV89968.1|  mitogen activated protein kinase                        145   3e-38   Humulus lupulus [common hop]
ref|XP_010032056.1|  PREDICTED: mitogen-activated protein kinase 3      145   3e-38   Eucalyptus grandis [rose gum]
ref|XP_007132165.1|  hypothetical protein PHAVU_011G071400g             144   3e-38   Phaseolus vulgaris [French bean]
gb|KJB20239.1|  hypothetical protein B456_003G139900                    144   3e-38   Gossypium raimondii
ref|XP_010261325.1|  PREDICTED: mitogen-activated protein kinase ...    137   5e-38   
gb|AGO61959.1|  MAPK FLRS                                               143   6e-38   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010260161.1|  PREDICTED: mitogen-activated protein kinase ...    144   6e-38   Nelumbo nucifera [Indian lotus]
ref|XP_004294685.1|  PREDICTED: mitogen-activated protein kinase 3      144   6e-38   Fragaria vesca subsp. vesca
gb|AJA29669.1|  mitogen-activated protein kinase 9                      144   6e-38   Gossypium hirsutum [American cotton]
ref|XP_009358265.1|  PREDICTED: mitogen-activated protein kinase 3      144   6e-38   Pyrus x bretschneideri [bai li]
gb|KJB20241.1|  hypothetical protein B456_003G139900                    144   7e-38   Gossypium raimondii
gb|KHG08689.1|  Mitogen-activated protein kinase 3                      144   7e-38   Gossypium arboreum [tree cotton]
ref|XP_010253496.1|  PREDICTED: mitogen-activated protein kinase ...    144   8e-38   Nelumbo nucifera [Indian lotus]
gb|EYU18887.1|  hypothetical protein MIMGU_mgv1a008230mg                143   9e-38   Erythranthe guttata [common monkey flower]
ref|XP_006424672.1|  hypothetical protein CICLE_v10028667mg             143   1e-37   Citrus clementina [clementine]
ref|XP_002314017.1|  kinase MMK4 family protein                         143   1e-37   Populus trichocarpa [western balsam poplar]
ref|XP_007205387.1|  hypothetical protein PRUPE_ppa007370mg             143   1e-37   Prunus persica
ref|XP_009416271.1|  PREDICTED: mitogen-activated protein kinase ...    143   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010689418.1|  PREDICTED: mitogen-activated protein kinase 3      143   1e-37   Beta vulgaris subsp. vulgaris [field beet]
gb|AAN65181.1|  mitogen-activated protein kinase 3b                     143   1e-37   Petroselinum crispum
ref|XP_003539740.1|  PREDICTED: mitogen-activated protein kinase ...    143   1e-37   Glycine max [soybeans]
gb|KJB56017.1|  hypothetical protein B456_009G104600                    140   2e-37   Gossypium raimondii
gb|ABB51133.1|  mitogen-activated protein kinase 2                      142   2e-37   Rheum australe [Himalayan rhubarb]
ref|NP_001275822.1|  mitogen-activated protein kinase 1                 142   2e-37   Citrus sinensis [apfelsine]
ref|NP_001265988.1|  mitogen-activated protein kinase 3-like            142   2e-37   
ref|XP_008385257.1|  PREDICTED: mitogen-activated protein kinase 3      142   3e-37   
gb|AGI60283.1|  mitogen-activated protein kinase 4                      142   3e-37   Dendrobium officinale
ref|XP_009352415.1|  PREDICTED: mitogen-activated protein kinase ...    142   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_002284807.1|  PREDICTED: mitogen-activated protein kinase 3      142   4e-37   Vitis vinifera
ref|XP_011089373.1|  PREDICTED: mitogen-activated protein kinase 3      142   4e-37   Sesamum indicum [beniseed]
ref|NP_001267653.1|  mitogen-activated protein kinase 3-like            142   4e-37   Cucumis sativus [cucumbers]
ref|XP_002976336.1|  hypothetical protein SELMODRAFT_449423             142   4e-37   
ref|NP_001284376.1|  mitogen-activated protein kinase 3                 141   4e-37   Cucumis melo [Oriental melon]
ref|NP_001288546.1|  mitogen-activated protein kinase 5                 141   4e-37   Zea mays [maize]
gb|ACG38361.1|  MPK3 - putative MAPK                                    141   4e-37   Zea mays [maize]
ref|XP_010112333.1|  Mitogen-activated protein kinase 3                 141   6e-37   Morus notabilis
emb|CAA73323.1|  MAP kinase I                                           141   7e-37   Petroselinum crispum
ref|XP_011025027.1|  PREDICTED: mitogen-activated protein kinase ...    139   7e-37   Populus euphratica
ref|XP_009406947.1|  PREDICTED: mitogen-activated protein kinase 5      141   7e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007016654.1|  Mitogen-activated protein kinase 3                 141   8e-37   
gb|KJB56016.1|  hypothetical protein B456_009G104600                    140   1e-36   Gossypium raimondii
gb|KHG13782.1|  Mitogen-activated protein kinase 3                      140   1e-36   Gossypium arboreum [tree cotton]
ref|XP_011007365.1|  PREDICTED: mitogen-activated protein kinase ...    140   1e-36   Populus euphratica
ref|XP_006402656.1|  hypothetical protein EUTSA_v10006460mg             140   2e-36   Eutrema salsugineum [saltwater cress]
gb|ACP31204.1|  MAP kinase 1                                            134   2e-36   Solanum melongena [aubergine]
gb|ABO84839.1|  putative MAP kinase 3                                   140   2e-36   Catharanthus roseus [chatas]
ref|XP_011025026.1|  PREDICTED: mitogen-activated protein kinase ...    139   2e-36   Populus euphratica
gb|AHY02158.1|  mitogen-activated protein kinase 3                      140   2e-36   Betula platyphylla [Asian white birch]
gb|AJA29672.1|  mitogen-activated protein kinase 13                     140   2e-36   Gossypium hirsutum [American cotton]
ref|XP_011025025.1|  PREDICTED: mitogen-activated protein kinase ...    139   3e-36   Populus euphratica
ref|XP_002298450.1|  kinase MMK4 family protein                         139   3e-36   Populus trichocarpa [western balsam poplar]
gb|ADU54564.1|  wound-induced mitogen-activated protein kinase          139   3e-36   Nicotiana glutinosa
gb|KDP44133.1|  hypothetical protein JCGZ_05600                         139   3e-36   Jatropha curcas
dbj|BAC53771.1|  wound-inuduced protein kinase                          139   3e-36   Nicotiana benthamiana
ref|XP_008792346.1|  PREDICTED: mitogen-activated protein kinase 5      139   4e-36   Phoenix dactylifera
gb|ABJ89813.1|  wound-induced protein kinase                            139   4e-36   Nicotiana attenuata
ref|XP_008358164.1|  PREDICTED: mitogen-activated protein kinase ...    139   4e-36   Malus domestica [apple tree]
ref|XP_009802373.1|  PREDICTED: mitogen-activated protein kinase 3      139   5e-36   Nicotiana sylvestris
ref|XP_010920941.1|  PREDICTED: mitogen-activated protein kinase 5      138   6e-36   Elaeis guineensis
gb|AEX49899.1|  mitogen-activated protein kinase 4                      139   6e-36   Saccharum hybrid cultivar ROC22
emb|CDX99153.1|  BnaA06g18440D                                          137   1e-35   
gb|KDO76322.1|  hypothetical protein CISIN_1g017083mg                   135   1e-35   Citrus sinensis [apfelsine]
ref|XP_006828349.1|  hypothetical protein AMTR_s00023p00249950          138   1e-35   Amborella trichopoda
gb|AAW65993.1|  mitogen-activated protein kinase                        137   1e-35   Saccharum hybrid cultivar SP80-3280
gb|ADI52626.1|  mitogen-activated protein kinase 3                      138   1e-35   Gossypium hirsutum [American cotton]
ref|XP_009150063.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    137   2e-35   Brassica rapa
gb|AAV34677.1|  mitogen-activated protein kinase 3                      137   2e-35   Brassica napus [oilseed rape]
emb|CDX86029.1|  BnaC03g55440D                                          137   2e-35   
gb|AGA37186.1|  mitogen-activated protein kinase 3.1                    137   2e-35   Brassica napus [oilseed rape]
ref|XP_002876524.1|  predicted protein                                  137   3e-35   Arabidopsis lyrata subsp. lyrata
gb|AAV68711.1|  mitogen-activated protein kinase 3                      137   3e-35   Chorispora bungeana
gb|EPS57900.1|  mitogen-activated protein kinase                        136   3e-35   Genlisea aurea
ref|XP_010276898.1|  PREDICTED: mitogen-activated protein kinase ...    137   3e-35   Nelumbo nucifera [Indian lotus]
gb|AAC28850.1|  MAP kinase homolog                                      136   3e-35   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001105599.1|  LOC542594                                          137   4e-35   
gb|ACJ84655.1|  unknown                                                 134   4e-35   Medicago truncatula
gb|AGV52329.1|  MAPK3                                                   136   4e-35   Brassica juncea [brown mustard]
ref|XP_006419018.1|  hypothetical protein EUTSA_v10002582mg             135   4e-35   
ref|XP_010425992.1|  PREDICTED: mitogen-activated protein kinase ...    136   4e-35   Camelina sativa [gold-of-pleasure]
ref|NP_001266826.1|  uncharacterized protein LOC100837420               136   5e-35   Brachypodium distachyon [annual false brome]
gb|ABY85198.2|  mitogen activated protein kinase 1                      136   5e-35   Datura metel
gb|ABS11090.1|  MAP kinase                                              136   5e-35   Triticum aestivum [Canadian hard winter wheat]
gb|AAP22124.1|  wound-induced protein kinase                            134   5e-35   Humulus lupulus [common hop]
gb|ACH63244.1|  mitogen activated protein kinase                        136   5e-35   Rheum australe [Himalayan rhubarb]
ref|XP_010514890.1|  PREDICTED: mitogen-activated protein kinase ...    136   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006419019.1|  hypothetical protein EUTSA_v10002582mg             136   5e-35   Eutrema salsugineum [saltwater cress]
ref|XP_004984821.1|  PREDICTED: mitogen-activated protein kinase ...    136   5e-35   Setaria italica
gb|ACF83548.1|  unknown                                                 136   6e-35   Zea mays [maize]
gb|KHN26933.1|  Mitogen-activated protein kinase like MMK2              135   6e-35   Glycine soja [wild soybean]
ref|XP_010535564.1|  PREDICTED: mitogen-activated protein kinase 3      135   7e-35   Tarenaya hassleriana [spider flower]
ref|XP_010503182.1|  PREDICTED: mitogen-activated protein kinase 3      135   7e-35   Camelina sativa [gold-of-pleasure]
ref|XP_004984820.1|  PREDICTED: mitogen-activated protein kinase ...    136   8e-35   Setaria italica
ref|XP_004492784.1|  PREDICTED: mitogen-activated protein kinase ...    135   8e-35   Cicer arietinum [garbanzo]
ref|XP_006291331.1|  hypothetical protein CARUB_v10017466mg             135   1e-34   Capsella rubella
ref|NP_190150.1|  mitogen-activated protein kinase 3                    135   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003633959.1|  PREDICTED: mitogen-activated protein kinase ...    135   1e-34   Vitis vinifera
ref|XP_002875737.1|  mitogen-activated protein kinase 3                 135   1e-34   Arabidopsis lyrata subsp. lyrata
emb|CAA56314.1|  MAP KINASE                                             135   1e-34   Avena sativa [cultivated oat]
ref|XP_007040337.1|  MAP kinase 4                                       135   1e-34   
gb|KFK33939.1|  hypothetical protein AALP_AA5G081200                    135   1e-34   Arabis alpina [alpine rockcress]
emb|CDP20377.1|  unnamed protein product                                135   1e-34   Coffea canephora [robusta coffee]
ref|XP_006385774.1|  hypothetical protein POPTR_0003s13170g             134   1e-34   
dbj|BAA04866.1|  MAP kinase                                             135   1e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KDP28586.1|  hypothetical protein JCGZ_14357                         135   2e-34   Jatropha curcas
ref|XP_010934936.1|  PREDICTED: mitogen-activated protein kinase ...    135   2e-34   Elaeis guineensis
ref|XP_002278860.1|  PREDICTED: mitogen-activated protein kinase ...    135   2e-34   Vitis vinifera
gb|ABR10070.1|  MAPK                                                    134   2e-34   Malus hupehensis
gb|ABG54330.1|  double HA-tagged mitogen activated protein kinase 3     135   2e-34   synthetic construct
ref|XP_009349811.1|  PREDICTED: mitogen-activated protein kinase ...    134   2e-34   
ref|NP_001275448.1|  mitogen-activated protein kinase 3-like            134   2e-34   Solanum tuberosum [potatoes]
ref|XP_009396188.1|  PREDICTED: mitogen-activated protein kinase ...    134   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003624049.1|  Mitogen-activated protein kinase                   134   2e-34   Medicago truncatula
gb|AGD94958.1|  mitogen-activated protein kinase                        134   2e-34   Lilium regale
gb|AFK35403.1|  unknown                                                 134   2e-34   Medicago truncatula
ref|XP_010089054.1|  Mitogen-activated protein kinase 4                 134   3e-34   Morus notabilis
ref|XP_008343413.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    134   3e-34   
gb|AAF81419.1|  MAP kinase 1                                            134   3e-34   Capsicum annuum
ref|XP_004510752.1|  PREDICTED: mitogen-activated protein kinase ...    134   3e-34   Cicer arietinum [garbanzo]
gb|KDP25391.1|  hypothetical protein JCGZ_20547                         134   3e-34   Jatropha curcas
gb|KCW71567.1|  hypothetical protein EUGRSUZ_E00103                     132   3e-34   Eucalyptus grandis [rose gum]
gb|EMS61932.1|  Mitogen-activated protein kinase 5                      134   3e-34   Triticum urartu
ref|XP_007135122.1|  hypothetical protein PHAVU_010G102800g             134   3e-34   Phaseolus vulgaris [French bean]
gb|KHN46703.1|  Mitogen-activated protein kinase like MMK2              134   4e-34   Glycine soja [wild soybean]
dbj|BAA09600.1|  WIPK                                                   134   4e-34   Nicotiana tabacum [American tobacco]
ref|XP_002304516.2|  MAP kinase family protein                          134   4e-34   
ref|XP_006598940.1|  PREDICTED: mitogen-activated protein kinase ...    134   4e-34   
ref|XP_008458174.1|  PREDICTED: mitogen-activated protein kinase ...    134   4e-34   Cucumis melo [Oriental melon]
gb|ABK25416.1|  unknown                                                 134   4e-34   Picea sitchensis
ref|XP_002302599.1|  Mitogen-activated protein kinase 4                 133   4e-34   Populus trichocarpa [western balsam poplar]
ref|XP_004306748.1|  PREDICTED: mitogen-activated protein kinase ...    133   4e-34   Fragaria vesca subsp. vesca
ref|XP_004138470.1|  PREDICTED: mitogen-activated protein kinase ...    133   5e-34   Cucumis sativus [cucumbers]
gb|KHM99338.1|  Mitogen-activated protein kinase like MMK2              133   5e-34   Glycine soja [wild soybean]
ref|XP_009366541.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    134   5e-34   
ref|XP_011022625.1|  PREDICTED: mitogen-activated protein kinase ...    134   5e-34   Populus euphratica
ref|NP_001242213.1|  uncharacterized protein LOC100815697               133   5e-34   
ref|XP_008232995.1|  PREDICTED: mitogen-activated protein kinase ...    133   5e-34   
ref|XP_006439487.1|  hypothetical protein CICLE_v10020633mg             133   5e-34   
ref|XP_006476505.1|  PREDICTED: mitogen-activated protein kinase ...    133   6e-34   
ref|XP_003622463.1|  Mitogen-activated protein kinase                   133   6e-34   
ref|XP_006439486.1|  hypothetical protein CICLE_v10020633mg             133   6e-34   
ref|XP_007051730.1|  MAP kinase 4                                       133   6e-34   
gb|AAD37790.1|AF149424_1  MAP kinase                                    133   6e-34   
gb|AEQ28763.1|  mitogen-activated protein kinase 1                      133   6e-34   
gb|KJB09719.1|  hypothetical protein B456_001G159000                    133   6e-34   
ref|XP_007218147.1|  hypothetical protein PRUPE_ppa007306mg             133   7e-34   
ref|XP_010042752.1|  PREDICTED: mitogen-activated protein kinase ...    130   7e-34   
ref|XP_006444976.1|  hypothetical protein CICLE_v10020645mg             133   7e-34   
ref|NP_001234360.1|  mitogen-activated protein kinase 3                 133   7e-34   
gb|ABW34945.1|  mitogen-activated protein kinase 3                      133   8e-34   
gb|AIU98492.1|  mitogen-activated protein kinase                        133   8e-34   
ref|XP_007209254.1|  hypothetical protein PRUPE_ppa007254mg             132   9e-34   
gb|KHG15311.1|  Mitogen-activated protein kinase 4                      133   9e-34   
ref|XP_011080918.1|  PREDICTED: mitogen-activated protein kinase ...    132   9e-34   
ref|XP_009363400.1|  PREDICTED: mitogen-activated protein kinase ...    132   9e-34   
gb|ADQ85914.1|  mitogen-activated protein kinase                        132   1e-33   
ref|NP_191538.1|  mitogen-activated protein kinase 10                   132   1e-33   
ref|XP_006396920.1|  hypothetical protein EUTSA_v10028737mg             132   1e-33   
gb|AAN75065.2|AF435805_1  mitogen-activated protein kinase              133   1e-33   
gb|AID46463.1|  MAP kinase 2                                            132   1e-33   
gb|AJA29676.1|  mitogen-activated protein kinase 18                     132   1e-33   
gb|ABG54337.1|  double HA-tagged mitogen activated protein kinase 10    132   2e-33   
ref|XP_010112959.1|  Mitogen-activated protein kinase-MMK2-like p...    132   2e-33   
ref|XP_006287960.1|  hypothetical protein CARUB_v10001195mg             132   2e-33   
ref|XP_010435048.1|  PREDICTED: mitogen-activated protein kinase ...    132   2e-33   
gb|AHY02157.1|  mitogen-activated protein kinase 4                      132   2e-33   
ref|XP_007209255.1|  hypothetical protein PRUPE_ppa007254mg             131   2e-33   
ref|XP_010919113.1|  PREDICTED: mitogen-activated protein kinase 2      131   2e-33   
ref|XP_008794840.1|  PREDICTED: mitogen-activated protein kinase ...    132   2e-33   
ref|XP_002509851.1|  big map kinase/bmk, putative                       132   2e-33   
gb|KCW72201.1|  hypothetical protein EUGRSUZ_E00652                     130   2e-33   
gb|KJB20601.1|  hypothetical protein B456_003G155700                    129   3e-33   
ref|XP_002872577.1|  mitogen-activated protein kinase 5                 131   3e-33   
ref|XP_010055090.1|  PREDICTED: mitogen-activated protein kinase ...    131   3e-33   
ref|XP_010941156.1|  PREDICTED: mitogen-activated protein kinase ...    132   3e-33   
ref|XP_008363496.1|  PREDICTED: mitogen-activated protein kinase ...    125   3e-33   
ref|XP_011036909.1|  PREDICTED: mitogen-activated protein kinase ...    131   3e-33   
ref|XP_011036902.1|  PREDICTED: mitogen-activated protein kinase ...    131   3e-33   
ref|XP_009395432.1|  PREDICTED: mitogen-activated protein kinase 2      131   3e-33   
ref|XP_010422087.1|  PREDICTED: mitogen-activated protein kinase ...    131   3e-33   
ref|NP_001140308.1|  uncharacterized protein LOC100272353               131   3e-33   
ref|NP_001242364.1|  uncharacterized protein LOC100786554               131   3e-33   
ref|XP_009345123.1|  PREDICTED: mitogen-activated protein kinase ...    131   4e-33   
ref|XP_001763232.1|  predicted protein                                  131   4e-33   
ref|XP_009597777.1|  PREDICTED: mitogen-activated protein kinase ...    125   4e-33   
gb|AFP20227.1|  MAP kinase                                              130   5e-33   
gb|EMT18008.1|  Mitogen-activated protein kinase 2                      132   5e-33   
ref|XP_011029347.1|  PREDICTED: mitogen-activated protein kinase ...    131   5e-33   
gb|EPS64079.1|  hypothetical protein M569_10702                         128   5e-33   
ref|XP_009793071.1|  PREDICTED: mitogen-activated protein kinase ...    130   5e-33   
ref|XP_009604282.1|  PREDICTED: mitogen-activated protein kinase ...    130   6e-33   
ref|XP_006828303.1|  hypothetical protein AMTR_s00023p00233730          130   6e-33   
sp|Q40353.1|MMK2_MEDSA  RecName: Full=Mitogen-activated protein k...    130   6e-33   
gb|EMT08915.1|  hypothetical protein F775_52499                         130   7e-33   
ref|XP_006649891.1|  PREDICTED: mitogen-activated protein kinase ...    130   7e-33   
gb|AAN65180.1|  mitogen-activated protein kinase 4                      130   7e-33   
gb|KCW46052.1|  hypothetical protein EUGRSUZ_L00026                     128   7e-33   
gb|KJB20602.1|  hypothetical protein B456_003G155700                    129   7e-33   
ref|XP_009382252.1|  PREDICTED: mitogen-activated protein kinase ...    130   8e-33   
gb|KJB20600.1|  hypothetical protein B456_003G155700                    129   1e-32   
ref|XP_004143889.1|  PREDICTED: mitogen-activated protein kinase ...    130   1e-32   
gb|KJB24766.1|  hypothetical protein B456_004G159400                    129   1e-32   
gb|ADZ76491.1|  MAP kinase 5-CT                                         129   1e-32   
ref|NP_001241378.1|  uncharacterized protein LOC100803024               130   1e-32   
emb|CDX89033.1|  BnaA04g01530D                                          130   1e-32   
ref|XP_004517236.1|  PREDICTED: mitogen-activated protein kinase ...    129   1e-32   
ref|NP_001274898.1|  mitogen-activated protein kinase homolog MMK...    130   1e-32   
gb|AAK01710.1|AF332873_1  MAP kinase BIMK1                              129   1e-32   
ref|XP_010055688.1|  PREDICTED: mitogen-activated protein kinase ...    129   1e-32   
ref|NP_001049770.1|  Os03g0285800                                       129   1e-32   
gb|ABH01189.1|  mitogen activated protein kinase 3                      129   1e-32   
ref|XP_006292783.1|  hypothetical protein CARUB_v10019032mg             130   1e-32   
ref|XP_010556563.1|  PREDICTED: mitogen-activated protein kinase 4      129   1e-32   
gb|EMS58532.1|  Mitogen-activated protein kinase 2                      130   1e-32   
gb|AJA29670.1|  mitogen-activated protein kinase 10                     129   1e-32   
ref|XP_004983829.1|  PREDICTED: mitogen-activated protein kinase ...    129   1e-32   
ref|XP_010455540.1|  PREDICTED: mitogen-activated protein kinase ...    129   1e-32   
gb|KJB20597.1|  hypothetical protein B456_003G155700                    129   1e-32   
ref|XP_004511562.1|  PREDICTED: mitogen-activated protein kinase ...    129   1e-32   
dbj|BAJ95789.1|  predicted protein                                      129   2e-32   
ref|XP_002467591.1|  hypothetical protein SORBIDRAFT_01g030680          129   2e-32   
ref|XP_004511561.1|  PREDICTED: mitogen-activated protein kinase ...    129   2e-32   
ref|XP_006829066.1|  hypothetical protein AMTR_s00001p00258560          129   2e-32   
ref|XP_006662544.1|  PREDICTED: mitogen-activated protein kinase ...    129   2e-32   
ref|NP_172266.2|  mitogen-activated protein kinase 13                   127   2e-32   
gb|KHG05791.1|  Mitogen-activated protein kinase 4                      129   2e-32   
ref|XP_010513793.1|  PREDICTED: mitogen-activated protein kinase ...    126   2e-32   
gb|ACT63867.1|  mitogen activated protein kinase 13                     129   2e-32   
ref|NP_567378.4|  mitogen-activated protein kinase 5                    129   2e-32   
gb|KHN29324.1|  Mitogen-activated protein kinase like MMK2              129   2e-32   
ref|XP_002320818.1|  MAP kinase family protein                          129   2e-32   
gb|AJA29675.1|  mitogen-activated protein kinase 17                     129   2e-32   
ref|XP_003534546.1|  PREDICTED: mitogen-activated protein kinase ...    129   2e-32   
gb|EYU23463.1|  hypothetical protein MIMGU_mgv1a008362mg                129   2e-32   
ref|XP_011089377.1|  PREDICTED: mitogen-activated protein kinase ...    129   2e-32   
ref|XP_004503681.1|  PREDICTED: mitogen-activated protein kinase ...    129   3e-32   
ref|XP_008796911.1|  PREDICTED: mitogen-activated protein kinase ...    129   3e-32   
ref|XP_009138897.1|  PREDICTED: mitogen-activated protein kinase ...    129   3e-32   
gb|ACJ85138.1|  unknown                                                 129   3e-32   
gb|KEH21120.1|  MAP kinase                                              129   3e-32   
gb|ABR18392.1|  unknown                                                 128   3e-32   
ref|NP_001266830.1|  uncharacterized protein LOC100839224               129   3e-32   
emb|CDY45782.1|  BnaC04g22680D                                          129   3e-32   
emb|CDX89034.1|  BnaA04g01520D                                          129   3e-32   
gb|ABG54332.1|  double HA-tagged mitogen activated protein kinase 5     129   3e-32   
ref|XP_009108179.1|  PREDICTED: mitogen-activated protein kinase 5      128   4e-32   
gb|AGH89467.1|  mitogen-activated protein kinase 1                      128   4e-32   
ref|XP_011023289.1|  PREDICTED: mitogen-activated protein kinase ...    128   4e-32   
dbj|BAC99508.1|  putative mitogen-activated protein kinase 4            128   4e-32   
ref|NP_001061028.2|  Os08g0157000                                       128   4e-32   
ref|XP_009138896.1|  PREDICTED: mitogen-activated protein kinase ...    128   4e-32   
gb|AHH30831.1|  mitogen-activated protein kinase 4                      128   4e-32   
ref|XP_006659134.1|  PREDICTED: mitogen-activated protein kinase ...    128   4e-32   
ref|NP_001105239.1|  salt-induced MAP kinase 1                          128   4e-32   
emb|CDX86793.1|  BnaA09g21830D                                          129   4e-32   
gb|ACG31917.1|  MPK4 - putative MAPK                                    128   4e-32   
gb|AIX47138.1|  MAPK1                                                   128   5e-32   
gb|AAO16999.1|  Putative MAP kinase 1                                   127   5e-32   
ref|XP_008238948.1|  PREDICTED: mitogen-activated protein kinase ...    128   5e-32   
ref|XP_004298829.1|  PREDICTED: mitogen-activated protein kinase ...    128   5e-32   
ref|XP_006396275.1|  hypothetical protein EUTSA_v10028738mg             128   6e-32   
ref|NP_001065156.1|  Os10g0533600                                       128   6e-32   
gb|EEC82924.1|  hypothetical protein OsI_27877                          128   6e-32   
dbj|BAA04868.1|  MAP kinase                                             128   6e-32   
ref|XP_002511904.1|  big map kinase/bmk, putative                       127   6e-32   
ref|XP_004972803.1|  PREDICTED: mitogen-activated protein kinase ...    128   7e-32   
gb|AAM88622.1|  putative serine/threonine protein kinase                127   7e-32   
gb|ABB69023.1|  mitogen-activated protein kinase 4                      127   8e-32   
gb|ACE80627.1|  MAP kinase 4                                            127   8e-32   
ref|XP_009134529.1|  PREDICTED: mitogen-activated protein kinase 4      127   8e-32   
gb|ADP24129.1|  mitogen-activaed protein kinase 4                       127   8e-32   
ref|XP_002284710.1|  PREDICTED: mitogen-activated protein kinase ...    127   8e-32   
ref|XP_008790283.1|  PREDICTED: mitogen-activated protein kinase ...    127   8e-32   
dbj|BAJ97968.1|  predicted protein                                      127   9e-32   
ref|XP_008375978.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    127   9e-32   
ref|XP_003574247.1|  PREDICTED: mitogen-activated protein kinase 6      127   1e-31   
ref|XP_004505940.1|  PREDICTED: mitogen-activated protein kinase ...    127   1e-31   
ref|XP_009396576.1|  PREDICTED: mitogen-activated protein kinase ...    127   1e-31   
ref|XP_009138899.1|  PREDICTED: mitogen-activated protein kinase ...    127   1e-31   
ref|NP_001030990.1|  mitogen-activated protein kinase 13                127   1e-31   
ref|NP_001233897.1|  mitogen-activated protein kinase 7                 127   1e-31   
ref|XP_003611065.1|  Mitogen-activated protein kinase                   127   1e-31   
ref|XP_010544396.1|  PREDICTED: mitogen-activated protein kinase ...    127   1e-31   
gb|ACJ85289.1|  unknown                                                 127   1e-31   
gb|ABO65100.1|  mitogen-activated protein kinase 4                      126   1e-31   
ref|XP_010253473.1|  PREDICTED: mitogen-activated protein kinase ...    126   2e-31   
emb|CDP08955.1|  unnamed protein product                                126   2e-31   
dbj|BAJ33841.1|  unnamed protein product                                126   2e-31   
ref|XP_007158526.1|  hypothetical protein PHAVU_002G159500g             125   2e-31   
gb|ABR16152.1|  unknown                                                 126   2e-31   
emb|CDP12066.1|  unnamed protein product                                126   2e-31   
ref|XP_006584732.1|  PREDICTED: mitogen-activated protein kinase ...    126   2e-31   
ref|XP_006417757.1|  hypothetical protein EUTSA_v10008001mg             126   2e-31   
ref|XP_003532933.1|  PREDICTED: mitogen-activated protein kinase ...    126   2e-31   
gb|ABG54340.1|  double HA-tagged mitogen activated protein kinase 13    126   2e-31   
ref|XP_010427457.1|  PREDICTED: mitogen-activated protein kinase ...    126   2e-31   
gb|AGA37188.1|  mitogen-activated protein kinase 5.1                    126   2e-31   
ref|XP_010323646.1|  PREDICTED: mitogen-activated protein kinase ...    126   2e-31   
gb|ABD77415.1|  osmotic and salt stimulation MAPK1                      126   2e-31   
ref|XP_010419634.1|  PREDICTED: mitogen-activated protein kinase 4      126   2e-31   
ref|XP_010456244.1|  PREDICTED: mitogen-activated protein kinase ...    126   2e-31   
ref|XP_006290113.1|  hypothetical protein CARUB_v10003760mg             126   2e-31   
ref|XP_002892423.1|  predicted protein                                  126   3e-31   
gb|AGS78126.1|  mitogen activated protein kinase 5                      126   3e-31   
ref|XP_008222472.1|  PREDICTED: mitogen-activated protein kinase ...    125   3e-31   
gb|AJP75153.1|  mitogen-activated protein kinase 4                      125   3e-31   
ref|XP_009358274.1|  PREDICTED: mitogen-activated protein kinase ...    125   3e-31   
ref|XP_008358115.1|  PREDICTED: mitogen-activated protein kinase ...    125   3e-31   
ref|XP_002443888.1|  hypothetical protein SORBIDRAFT_07g003810          125   4e-31   
ref|XP_007206294.1|  hypothetical protein PRUPE_ppa007376mg             125   4e-31   
gb|ADT91692.1|  mitogen-activated protein kinase 4                      125   4e-31   
ref|XP_007158527.1|  hypothetical protein PHAVU_002G159500g             125   4e-31   
gb|AJA29674.1|  mitogen-activated protein kinase 16                     125   4e-31   
gb|KHG15804.1|  Mitogen-activated protein kinase NTF6                   125   4e-31   
dbj|BAA04867.1|  MAP kinase                                             125   4e-31   
ref|XP_009118413.1|  PREDICTED: mitogen-activated protein kinase 13     125   4e-31   
ref|XP_008662854.1|  PREDICTED: mitogen-activated protein kinase 2      125   4e-31   
gb|AJA29671.1|  mitogen-activated protein kinase 12                     125   4e-31   
ref|NP_192046.1|  mitogen-activated protein kinase 4                    125   4e-31   
gb|KJB56029.1|  hypothetical protein B456_009G103800                    125   4e-31   
gb|ABR46148.1|  mitogen-activated protein kinase 4                      125   4e-31   
gb|ABR46146.1|  mitogen-activated protein kinase 4                      125   4e-31   
gb|ABR46162.1|  mitogen-activated protein kinase 4                      125   4e-31   
ref|XP_010253840.1|  PREDICTED: mitogen-activated protein kinase ...    125   5e-31   
gb|ABR46165.1|  mitogen-activated protein kinase 4                      125   5e-31   
emb|CDY22716.1|  BnaC08g43500D                                          125   5e-31   
ref|XP_002874986.1|  mitogen-activated protein kinase 4                 125   5e-31   
gb|EYU18893.1|  hypothetical protein MIMGU_mgv1a008467mg                125   5e-31   
gb|KFK30715.1|  hypothetical protein AALP_AA6G018100                    125   6e-31   
ref|XP_007160100.1|  hypothetical protein PHAVU_002G292400g             125   6e-31   
ref|XP_010112322.1|  Mitogen-activated protein kinase-NTF6-like p...    125   7e-31   
gb|AIP87138.1|  mitogen-activated protein kinase                        125   7e-31   
gb|ABG54331.1|  double HA-tagged mitogen activated protein kinase 4     125   7e-31   
ref|NP_001280773.1|  mitogen-activated protein kinase homolog NTF...    124   7e-31   
ref|XP_011092840.1|  PREDICTED: mitogen-activated protein kinase ...    124   9e-31   
gb|KFK31909.1|  hypothetical protein AALP_AA6G174800                    124   9e-31   
dbj|BAE46985.1|  mitogen-activated protein kinase                       124   1e-30   
ref|XP_002530237.1|  big map kinase/bmk, putative                       124   1e-30   
ref|XP_003525376.1|  PREDICTED: mitogen-activated protein kinase ...    124   1e-30   
ref|XP_010475563.1|  PREDICTED: mitogen-activated protein kinase 13     124   1e-30   
gb|ACM50325.1|  mitogen-activated protein kinase 4                      124   2e-30   
ref|XP_010669962.1|  PREDICTED: mitogen-activated protein kinase ...    124   2e-30   
gb|EYU32159.1|  hypothetical protein MIMGU_mgv1a0097902mg               117   2e-30   
emb|CAC13967.1|  MAPK2 protein                                          124   2e-30   
ref|XP_003538304.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    124   2e-30   
gb|KJB52190.1|  hypothetical protein B456_008G249800                    123   2e-30   
gb|KFK43102.1|  hypothetical protein AALP_AA1G080400                    123   2e-30   
gb|AJA29680.1|  mitogen-activated protein kinase 26                     123   2e-30   
gb|AHN53385.1|  MAPK4_2 protein                                         123   3e-30   
ref|XP_010512256.1|  PREDICTED: mitogen-activated protein kinase ...    123   3e-30   
ref|NP_001189755.1|  mitogen-activated protein kinase 12                122   3e-30   
ref|XP_009767886.1|  PREDICTED: mitogen-activated protein kinase ...    123   3e-30   
gb|KHG30595.1|  Mitogen-activated protein kinase 2                      123   3e-30   
gb|AJA29681.1|  mitogen-activated protein kinase 27                     123   3e-30   
gb|ADI52627.1|  mitogen-activated protein kinase 4                      123   3e-30   
ref|XP_010689413.1|  PREDICTED: mitogen-activated protein kinase ...    123   3e-30   
gb|KDP44143.1|  hypothetical protein JCGZ_05610                         123   3e-30   



>gb|ACJ84523.1| unknown [Medicago truncatula]
Length=193

 Score =   198 bits (503),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIM  330
            M+GG A PADTVMS+AAP  PP  GI+NIPATLSHGGRFIQYNIFGN+FEVTAKYKPPIM
Sbjct  1    MEGGGAPPADTVMSDAAP-APPQMGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIM  59

Query  331  PIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIGKGAYGIVCSA NSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   PIGKGAYGIVCSAHNSETNEHVAVKKIANAFDNKIDAKRTLREIKLLRHMD  110



>ref|XP_003608101.1| Mitogen-activated protein kinase [Medicago truncatula]
 gb|AES90298.1| MAP kinase-like Ntf4 protein [Medicago truncatula]
Length=279

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIM  330
            M+GG A PADTVMS+AAP  PP  GI+NIPATLSHGGRFIQYNIFGN+FEVTAKYKPPIM
Sbjct  1    MEGGGAPPADTVMSDAAP-APPQMGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIM  59

Query  331  PIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIGKGAYGIVCSA NSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   PIGKGAYGIVCSAHNSETNEHVAVKKIANAFDNKIDAKRTLREIKLLRHMD  110



>gb|AHJ80962.1| mitogen-activated protein kinase 2 [Morus notabilis]
Length=398

 Score =   202 bits (513),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 107/121 (88%), Gaps = 10/121 (8%)
 Frame = +1

Query  151  MDG-GSAQPADTVMSEAAPPQ-----PPVP----GIDNIPATLSHGGRFIQYNIFGNVFE  300
            M+G G+AQP+DTVMSEAAPPQ     PP P    G++NIPATLSHGGRFIQYNIFGN+FE
Sbjct  1    MEGAGAAQPSDTVMSEAAPPQGEHQNPPPPQQHIGMENIPATLSHGGRFIQYNIFGNIFE  60

Query  301  VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            VTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHM
Sbjct  61   VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHM  120

Query  481  D  483
            D
Sbjct  121  D  121



>ref|XP_010101362.1| Mitogen-activated protein kinase-MMK1-like protein [Morus notabilis]
 gb|EXB88309.1| Mitogen-activated protein kinase-MMK1-like protein [Morus notabilis]
Length=393

 Score =   202 bits (513),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 107/121 (88%), Gaps = 10/121 (8%)
 Frame = +1

Query  151  MDG-GSAQPADTVMSEAAPPQ-----PPVP----GIDNIPATLSHGGRFIQYNIFGNVFE  300
            M+G G+AQP+DTVMSEAAPPQ     PP P    G++NIPATLSHGGRFIQYNIFGN+FE
Sbjct  1    MEGAGAAQPSDTVMSEAAPPQGEHQNPPPPQQHIGMENIPATLSHGGRFIQYNIFGNIFE  60

Query  301  VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            VTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHM
Sbjct  61   VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHM  120

Query  481  D  483
            D
Sbjct  121  D  121



>emb|CAN72393.1| hypothetical protein VITISV_019292 [Vitis vinifera]
Length=205

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 102/120 (85%), Gaps = 9/120 (8%)
 Frame = +1

Query  151  MDGGSAQP-ADTVMSEAAPP--------QPPVPGIDNIPATLSHGGRFIQYNIFGNVFEV  303
            MDG +  P ADTVMS+A PP          PVPG++NIPATLSHGGRFIQYNIFGN+FEV
Sbjct  1    MDGEAPLPDADTVMSDAVPPPDPHHQQQHAPVPGMENIPATLSHGGRFIQYNIFGNIFEV  60

Query  304  TAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            TAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   TAKYKPPIMPIGKGAYGIVCSALNSETNEHVALKKIANAFDNKIDAKRTLREIKLLRHMD  120



>ref|XP_003608100.1| Mitogen-activated protein kinase [Medicago truncatula]
 gb|AES90297.1| MAP kinase-like Ntf4 protein [Medicago truncatula]
Length=387

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIM  330
            M+GG A PADTVMS+AAP  PP  GI+NIPATLSHGGRFIQYNIFGN+FEVTAKYKPPIM
Sbjct  1    MEGGGAPPADTVMSDAAP-APPQMGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIM  59

Query  331  PIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIGKGAYGIVCSA NSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   PIGKGAYGIVCSAHNSETNEHVAVKKIANAFDNKIDAKRTLREIKLLRHMD  110



>gb|KHN31012.1| Mitogen-activated protein kinase like MMK1 [Glycine soja]
Length=391

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 101/111 (91%), Gaps = 2/111 (2%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPP--QPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIM  330
            GG+A PADTVMS+AAPP  Q    GI+NIPATLSHGGRFIQYNIFGN+FEVTAKYKPPIM
Sbjct  4    GGAAPPADTVMSDAAPPPQQAMAMGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIM  63

Query  331  PIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  64   PIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  114



>gb|AID46462.1| MAP kinase 1 [Vigna mungo]
Length=396

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 103/115 (90%), Gaps = 6/115 (5%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAP-PQPPVP-----GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYK  318
            GG+A PADTVMS+AAP P+P  P     GIDNIPATLSHGGRFIQYNIFGN+FEVTAKYK
Sbjct  5    GGAAPPADTVMSDAAPHPEPHQPPAAAMGIDNIPATLSHGGRFIQYNIFGNIFEVTAKYK  64

Query  319  PPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  65   PPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  119



>ref|NP_001235426.1| mitogen-activated protein kinase 2 [Glycine max]
 ref|XP_006574473.1| PREDICTED: mitogen-activated protein kinase 2 isoform X1 [Glycine 
max]
 ref|XP_006574474.1| PREDICTED: mitogen-activated protein kinase 2 isoform X2 [Glycine 
max]
 gb|AAQ14867.1|AF329506_1 mitogen-activated protein kinase 2 [Glycine max]
Length=391

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 101/111 (91%), Gaps = 2/111 (2%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPP--QPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIM  330
            GG+A PADTVMS+AAPP  Q    GI+NIPATLSHGGRFIQYNIFGN+FEVTAKYKPPIM
Sbjct  4    GGAAPPADTVMSDAAPPPQQAMAMGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIM  63

Query  331  PIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  64   PIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  114



>gb|KHN32349.1| Mitogen-activated protein kinase like MMK1 [Glycine soja]
Length=430

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 101/111 (91%), Gaps = 2/111 (2%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPP--QPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIM  330
            GG+A PADTVMS+AAPP  Q    GI+NIPATLSHGGRFIQYNIFGN+FEVTAKYKPPIM
Sbjct  4    GGAAPPADTVMSDAAPPPQQAMAMGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIM  63

Query  331  PIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  64   PIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  114



>sp|Q07176.1|MMK1_MEDSA RecName: Full=Mitogen-activated protein kinase homolog MMK1; 
AltName: Full=MAP kinase ERK1; AltName: Full=MAP kinase MSK7 
[Medicago sativa]
 gb|AAB41548.1| MAP kinase [Medicago sativa]
 emb|CAA47099.1| MAP Kinase [Medicago sativa]
Length=387

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 100/111 (90%), Gaps = 1/111 (1%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIM  330
            M+GG A PADTVMS+AAP  PP  GI+NIPA LSHGGRFIQYNIFGN+FEVTAKYKPPIM
Sbjct  1    MEGGGAPPADTVMSDAAP-APPQMGIENIPAVLSHGGRFIQYNIFGNIFEVTAKYKPPIM  59

Query  331  PIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIGKGAYGIVCSA NSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   PIGKGAYGIVCSAHNSETNEHVAVKKIANAFDNKIDAKRTLREIKLLRHMD  110



>sp|Q40532.1|NTF4_TOBAC RecName: Full=Mitogen-activated protein kinase homolog NTF4; 
AltName: Full=P45 [Nicotiana tabacum]
 emb|CAA58761.1| p45Ntf4 serine/threonine protein kinase [Nicotiana tabacum]
Length=393

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 101/116 (87%), Gaps = 6/116 (5%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAA-----PPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKY  315
            MDG + Q  DTVMS+AA     PP  PV GIDNIPATLSHGGRFIQYNIFGN+FEVTAKY
Sbjct  1    MDGPAHQ-TDTVMSDAAGQQPAPPSQPVAGIDNIPATLSHGGRFIQYNIFGNIFEVTAKY  59

Query  316  KPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   KPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>ref|XP_010650725.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Vitis 
vinifera]
Length=398

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 102/120 (85%), Gaps = 9/120 (8%)
 Frame = +1

Query  151  MDGGSAQP-ADTVMSEAAPP--------QPPVPGIDNIPATLSHGGRFIQYNIFGNVFEV  303
            MDG +  P ADTVMS+A PP          PVPG++NIPATLSHGGRFIQYNIFGN+FEV
Sbjct  1    MDGEAPLPDADTVMSDAVPPPDPHHQQQHAPVPGMENIPATLSHGGRFIQYNIFGNIFEV  60

Query  304  TAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            TAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   TAKYKPPIMPIGKGAYGIVCSALNSETNEHVALKKIANAFDNKIDAKRTLREIKLLRHMD  120



>ref|XP_008394276.1| PREDICTED: mitogen-activated protein kinase homolog D5 [Malus 
domestica]
Length=406

 Score =   194 bits (494),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 104/128 (81%), Gaps = 17/128 (13%)
 Frame = +1

Query  151  MDGG--SAQPADTVMSEAAPPQPPVP---------------GIDNIPATLSHGGRFIQYN  279
            M+GG  +AQ ADTVMSEAAPP  P P               G+++IPATLSHGGRFIQYN
Sbjct  1    MEGGGPAAQSADTVMSEAAPPSHPDPNHPQQHPPPPHQAMGGVESIPATLSHGGRFIQYN  60

Query  280  IFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLRE  459
            IFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLRE
Sbjct  61   IFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLRE  120

Query  460  IKLLRHMD  483
            IKLLRHMD
Sbjct  121  IKLLRHMD  128



>ref|NP_181907.1| MAP kinase 6 [Arabidopsis thaliana]
 sp|Q39026.1|MPK6_ARATH RecName: Full=Mitogen-activated protein kinase 6; Short=AtMPK6; 
Short=MAP kinase 6 [Arabidopsis thaliana]
 dbj|BAA04869.1| MAP kinase [Arabidopsis thaliana]
 gb|AAB64027.1| MAP kinase (ATMPK6) [Arabidopsis thaliana]
 gb|AAM53295.1| MAP kinase ATMPK6 [Arabidopsis thaliana]
 gb|AAP68294.1| At2g43790 [Arabidopsis thaliana]
 gb|AEC10325.1| MAP kinase 6 [Arabidopsis thaliana]
Length=395

 Score =   194 bits (493),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 102/118 (86%), Gaps = 7/118 (6%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA------APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            MDGGS QPA DT M+EA      A P P +PGI+NIPATLSHGGRFIQYNIFGN+FEVTA
Sbjct  1    MDGGSGQPAADTEMTEAPGGFPAAAPSPQMPGIENIPATLSHGGRFIQYNIFGNIFEVTA  60

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   KYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  118



>ref|XP_004505140.1| PREDICTED: mitogen-activated protein kinase homolog D5-like isoform 
X1 [Cicer arietinum]
 ref|XP_004505141.1| PREDICTED: mitogen-activated protein kinase homolog D5-like isoform 
X2 [Cicer arietinum]
Length=393

 Score =   194 bits (492),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 101/116 (87%), Gaps = 5/116 (4%)
 Frame = +1

Query  151  MDG-GSAQPADTVMSEAAPPQPPVP----GIDNIPATLSHGGRFIQYNIFGNVFEVTAKY  315
            MDG G A PADTVMS+AAPP    P    GI+NIPATLSHGGRFIQYNIFGN+FEVTAKY
Sbjct  1    MDGEGGAPPADTVMSDAAPPPQADPQVAMGIENIPATLSHGGRFIQYNIFGNIFEVTAKY  60

Query  316  KPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KPPIMPIGKGAYGIVCSA NSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   KPPIMPIGKGAYGIVCSAHNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  116



>ref|NP_001275113.1| mitogen-activated protein kinase homolog NTF4-like [Solanum tuberosum]
 dbj|BAB93530.1| mitogen-activated protein kinase [Solanum tuberosum]
Length=394

 Score =   194 bits (492),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 101/114 (89%), Gaps = 6/114 (5%)
 Frame = +1

Query  160  GSAQPADTVMSEAA----PPQPPVP--GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKP  321
            GSAQ  DTVMS+AA    P  PP+P  G++NIPATLSHGGRFIQYNIFGN+FEVTAKYKP
Sbjct  3    GSAQQTDTVMSDAAAGQQPATPPLPMAGMENIPATLSHGGRFIQYNIFGNIFEVTAKYKP  62

Query  322  PIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  63   PIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  116



>ref|XP_007153722.1| hypothetical protein PHAVU_003G059500g [Phaseolus vulgaris]
 gb|ESW25716.1| hypothetical protein PHAVU_003G059500g [Phaseolus vulgaris]
Length=394

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 100/114 (88%), Gaps = 5/114 (4%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAP-PQPPVP----GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKP  321
            GG+A PADTVMS+A P P P  P    GI+NIPATLSHGGRFIQYNIFGN+FEVTAKYKP
Sbjct  4    GGAAPPADTVMSDAVPHPDPHQPPAAMGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKP  63

Query  322  PIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIMPIGKGAYGIVCSALNSET EHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  64   PIMPIGKGAYGIVCSALNSETKEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  117



>gb|ABG54333.1| double HA-tagged mitogen activated protein kinase 6 [synthetic 
construct]
Length=416

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 102/118 (86%), Gaps = 7/118 (6%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA------APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            MDGGS QPA DT M+EA      A P P +PGI+NIPATLSHGGRFIQYNIFGN+FEVTA
Sbjct  1    MDGGSGQPAADTEMTEAPGGFPAAAPSPQMPGIENIPATLSHGGRFIQYNIFGNIFEVTA  60

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   KYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  118



>gb|KCW63920.1| hypothetical protein EUGRSUZ_G01599 [Eucalyptus grandis]
Length=352

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 102/118 (86%), Gaps = 7/118 (6%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVP-------GIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            MDGG+ QPADTVMSEAAP Q           GI+NIPATLSHGGRFIQYNIFGN+FEVTA
Sbjct  1    MDGGAPQPADTVMSEAAPAQQQQQPQQAQPQGIENIPATLSHGGRFIQYNIFGNIFEVTA  60

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   KYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  118



>ref|XP_009358393.1| PREDICTED: mitogen-activated protein kinase homolog MMK1-like 
[Pyrus x bretschneideri]
Length=406

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 104/128 (81%), Gaps = 17/128 (13%)
 Frame = +1

Query  151  MDGG--SAQPADTVMSEAAPPQPPVP---------------GIDNIPATLSHGGRFIQYN  279
            M+GG  +AQ ADTVMSEAAPP  P P               G+++IPATLSHGGRFIQYN
Sbjct  1    MEGGGPAAQSADTVMSEAAPPSHPDPNHPQQHPPPPHQAMGGVESIPATLSHGGRFIQYN  60

Query  280  IFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLRE  459
            IFGNVFEVTAKYKPPIMPIGKGAYGIVCS+LNSETNEHV  KKIANAFDN+IDA RTLRE
Sbjct  61   IFGNVFEVTAKYKPPIMPIGKGAYGIVCSSLNSETNEHVAIKKIANAFDNRIDAKRTLRE  120

Query  460  IKLLRHMD  483
            IKLLRHMD
Sbjct  121  IKLLRHMD  128



>ref|XP_002880067.1| hypothetical protein ARALYDRAFT_903782 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56326.1| hypothetical protein ARALYDRAFT_903782 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 102/121 (84%), Gaps = 10/121 (8%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA---------APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFE  300
            MDGGS QPA DT M+EA         + P P +PGI+NIPATLSHGGRFIQYNIFGN+FE
Sbjct  1    MDGGSGQPAADTEMTEALGGVPAAASSQPSPQMPGIENIPATLSHGGRFIQYNIFGNIFE  60

Query  301  VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            VTAKYKPPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHM
Sbjct  61   VTAKYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHM  120

Query  481  D  483
            D
Sbjct  121  D  121



>ref|XP_007202173.1| hypothetical protein PRUPE_ppa006536mg [Prunus persica]
 gb|EMJ03372.1| hypothetical protein PRUPE_ppa006536mg [Prunus persica]
Length=407

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 101/125 (81%), Gaps = 16/125 (13%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPP----------------VPGIDNIPATLSHGGRFIQYNIFG  288
            G +AQ ADTVMSEAAPP                   +PG+++IPATLSHGGRFIQYNIFG
Sbjct  5    GAAAQSADTVMSEAAPPPAQADSTHPQQQPPPPHPVMPGVESIPATLSHGGRFIQYNIFG  64

Query  289  NVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKL  468
            NVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKL
Sbjct  65   NVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKL  124

Query  469  LRHMD  483
            LRHMD
Sbjct  125  LRHMD  129



>ref|XP_008445483.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 isoform 
X1 [Cucumis melo]
Length=405

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 101/125 (81%), Gaps = 15/125 (12%)
 Frame = +1

Query  154  DGGSAQPADTVMSEAAPPQPPVP---------------GIDNIPATLSHGGRFIQYNIFG  288
            DGG++QP DTVMSEAA   PP                 G++NIPATLSHGGRFIQYNIFG
Sbjct  3    DGGASQPDDTVMSEAASVPPPQHDPAAQQQHQHQPPSMGMENIPATLSHGGRFIQYNIFG  62

Query  289  NVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKL  468
            N+FEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKL
Sbjct  63   NIFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKL  122

Query  469  LRHMD  483
            LRHMD
Sbjct  123  LRHMD  127



>ref|XP_004144187.1| PREDICTED: mitogen-activated protein kinase homolog MMK1-like 
[Cucumis sativus]
 ref|XP_004163946.1| PREDICTED: mitogen-activated protein kinase homolog MMK1-like 
[Cucumis sativus]
 gb|KGN47626.1| hypothetical protein Csa_6G365750 [Cucumis sativus]
Length=405

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 101/125 (81%), Gaps = 15/125 (12%)
 Frame = +1

Query  154  DGGSAQPADTVMSEAAPPQPPVP---------------GIDNIPATLSHGGRFIQYNIFG  288
            DGG++QP DTVMSEAA   PP                 G++NIPATLSHGGRFIQYNIFG
Sbjct  3    DGGASQPDDTVMSEAASVPPPQHDPAAQQQHQHQPPSMGMENIPATLSHGGRFIQYNIFG  62

Query  289  NVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKL  468
            N+FEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKL
Sbjct  63   NIFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKL  122

Query  469  LRHMD  483
            LRHMD
Sbjct  123  LRHMD  127



>ref|XP_008243044.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Prunus 
mume]
Length=407

 Score =   192 bits (489),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 101/125 (81%), Gaps = 16/125 (13%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPP----------------VPGIDNIPATLSHGGRFIQYNIFG  288
            G +AQ ADTVMSEAAPP                   +PG+++IPATLSHGGRFIQYNIFG
Sbjct  5    GSAAQSADTVMSEAAPPPAQADSTHPQQHPPPPHPVMPGVESIPATLSHGGRFIQYNIFG  64

Query  289  NVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKL  468
            NVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKL
Sbjct  65   NVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKL  124

Query  469  LRHMD  483
            LRHMD
Sbjct  125  LRHMD  129



>gb|ACG60597.1| mitogen activated protein kinase 2 [Solanum peruvianum]
Length=394

 Score =   191 bits (486),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 102/117 (87%), Gaps = 7/117 (6%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAA----PPQPPVP--GIDNIPATLSHGGRFIQYNIFGNVFEVTAK  312
            MDG + Q  DTVMS+AA    P  PP+P  G++NIPATLSHGGRFIQYNIFGN+FEVTAK
Sbjct  1    MDGSAPQ-TDTVMSDAAAGQQPAMPPLPMAGMENIPATLSHGGRFIQYNIFGNIFEVTAK  59

Query  313  YKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            YKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   YKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  116



>emb|CDX83459.1| BnaA03g20470D [Brassica napus]
Length=395

 Score =   191 bits (485),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 100/115 (87%), Gaps = 4/115 (3%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA---APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYK  318
            MDGG+ QPA DT MSEA   A P  P+PGI+NIPATLSHGG FIQYNIFGN+FEVTAKY 
Sbjct  1    MDGGTGQPAADTEMSEATGGAAPSQPMPGIENIPATLSHGGMFIQYNIFGNIFEVTAKYS  60

Query  319  PPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   PPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>ref|NP_001234355.1| mitogen-activated protein kinase 2 [Solanum lycopersicum]
 gb|AAP20420.1| mitogen-activated protein kinase 2 [Solanum lycopersicum]
Length=394

 Score =   191 bits (485),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 102/117 (87%), Gaps = 7/117 (6%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAA----PPQPPVP--GIDNIPATLSHGGRFIQYNIFGNVFEVTAK  312
            MDG + Q  DTVMS+AA    P  PP+P  G++NIPATLSHGGRFIQYNIFGN+FEVTAK
Sbjct  1    MDGSAPQ-TDTVMSDAAAGQQPAMPPLPMAGMENIPATLSHGGRFIQYNIFGNIFEVTAK  59

Query  313  YKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            YKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   YKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  116



>gb|ADM89008.1| MPK6 protein [Brassica napus]
Length=394

 Score =   191 bits (485),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 100/115 (87%), Gaps = 4/115 (3%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA---APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYK  318
            MDGG+ QPA DT MSEA   A P  P+PGI+NIPATLSHGG FIQYNIFGN+FEVTAKY 
Sbjct  1    MDGGTGQPAADTEMSEATGGAAPSQPMPGIENIPATLSHGGMFIQYNIFGNIFEVTAKYS  60

Query  319  PPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   PPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>ref|XP_010066116.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Eucalyptus 
grandis]
 gb|KCW63918.1| hypothetical protein EUGRSUZ_G01599 [Eucalyptus grandis]
Length=395

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 102/118 (86%), Gaps = 7/118 (6%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVP-------GIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            MDGG+ QPADTVMSEAAP Q           GI+NIPATLSHGGRFIQYNIFGN+FEVTA
Sbjct  1    MDGGAPQPADTVMSEAAPAQQQQQPQQAQPQGIENIPATLSHGGRFIQYNIFGNIFEVTA  60

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   KYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  118



>emb|CDY17911.1| BnaC04g03080D [Brassica napus]
Length=392

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA-APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPP  324
            MDG + QPA DT MSEA + P P +PG++NIPATLSHGG+FIQYNIFGN+FEVTAKYKPP
Sbjct  1    MDGNAGQPAADTEMSEAPSQPSPQMPGVENIPATLSHGGKFIQYNIFGNIFEVTAKYKPP  60

Query  325  IMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            IMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   IMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  113



>ref|XP_009133635.1| PREDICTED: mitogen-activated protein kinase 6-like [Brassica 
rapa]
Length=395

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 100/115 (87%), Gaps = 4/115 (3%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA---APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYK  318
            MDGG+ QPA DT MSEA   A P  P+PGI+NIPATLSHGG FIQYNIFGN+FEVTAKY 
Sbjct  1    MDGGTGQPAADTEMSEATGGAAPSQPMPGIENIPATLSHGGMFIQYNIFGNIFEVTAKYS  60

Query  319  PPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   PPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>ref|NP_001280856.1| mitogen-activated protein kinase homolog D5 [Malus domestica]
 gb|ACY82513.1| mitogen-activated protein kinase [Malus domestica]
Length=394

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 101/117 (86%), Gaps = 7/117 (6%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAA------PPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAK  312
            MDG + Q  DTVMS+AA      PP  P+ G+++IPATLSHGGRFIQYNIFGNVFEVTAK
Sbjct  1    MDGSAPQ-TDTVMSDAAAGQQPAPPPLPMAGVESIPATLSHGGRFIQYNIFGNVFEVTAK  59

Query  313  YKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            YKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   YKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  116



>emb|CDX79801.1| BnaA05g03550D [Brassica napus]
Length=392

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA-APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPP  324
            MDG + QPA DT MSEA + P P VPGI+NIPATLSHGG+FIQYNIFGN+FEVT KYKPP
Sbjct  1    MDGNAGQPAADTEMSEAPSNPSPQVPGIENIPATLSHGGKFIQYNIFGNIFEVTVKYKPP  60

Query  325  IMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            IMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   IMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  113



>ref|XP_011097634.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
homolog MMK1-like [Sesamum indicum]
Length=394

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 102/120 (85%), Gaps = 13/120 (11%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAP---------PQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEV  303
            M+GG AQPADTVMSEA P         P+ P   ID+IPATLSHGGRFIQYNIFGN+FEV
Sbjct  1    MEGG-AQPADTVMSEAEPRLLPSSISNPRRP---IDHIPATLSHGGRFIQYNIFGNIFEV  56

Query  304  TAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            T+KYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  57   TSKYKPPIMPIGKGAYGIVCSALNSETNEHVALKKIANAFDNKIDAKRTLREIKLLRHMD  116



>ref|XP_009142961.1| PREDICTED: mitogen-activated protein kinase 6 [Brassica rapa]
Length=392

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA-APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPP  324
            MDG + QPA DT MSEA + P P VPGI+NIPATLSHGG+FIQYNIFGN+FEVT KYKPP
Sbjct  1    MDGNAGQPAADTEMSEAPSNPSPQVPGIENIPATLSHGGKFIQYNIFGNIFEVTVKYKPP  60

Query  325  IMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            IMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   IMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  113



>ref|XP_006397553.1| hypothetical protein EUTSA_v10001439mg [Eutrema salsugineum]
 gb|ESQ39006.1| hypothetical protein EUTSA_v10001439mg [Eutrema salsugineum]
Length=454

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 103/121 (85%), Gaps = 10/121 (8%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA-------AP--PQPPVPGIDNIPATLSHGGRFIQYNIFGNVFE  300
            MDGG+ QPA DT M+EA       AP  P P +PGI+NIPATLSHGGRFIQYNIFGN+FE
Sbjct  57   MDGGAGQPAADTEMTEATGGASAAAPSHPSPQIPGIENIPATLSHGGRFIQYNIFGNIFE  116

Query  301  VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            VTAKYKPPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHM
Sbjct  117  VTAKYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHM  176

Query  481  D  483
            D
Sbjct  177  D  177



>ref|XP_010508373.1| PREDICTED: mitogen-activated protein kinase 6 [Camelina sativa]
Length=397

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 101/118 (86%), Gaps = 7/118 (6%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA------APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            MDGGS QPA DT M+EA      A P P +PGI+NIPATLSHGG FIQYNIFGN+FEVTA
Sbjct  1    MDGGSNQPAADTEMTEAPVGVSAAAPSPQMPGIENIPATLSHGGTFIQYNIFGNIFEVTA  60

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPI+PIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   KYKPPILPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  118



>ref|XP_008384112.1| PREDICTED: mitogen-activated protein kinase homolog MMK1-like 
[Malus domestica]
Length=403

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 102/126 (81%), Gaps = 16/126 (13%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVP---------------GIDNIPATLSHGGRFIQYNIF  285
            M+GG  + ADT+MSEAAPP  P P               G+++IPATLSHGGRFIQYNIF
Sbjct  1    MEGG-GRSADTMMSEAAPPSQPDPNHPQQHPPPPHXAMGGVESIPATLSHGGRFIQYNIF  59

Query  286  GNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIK  465
            GNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDN+IDA RTLREIK
Sbjct  60   GNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAVKKIANAFDNRIDAKRTLREIK  119

Query  466  LLRHMD  483
            LLRHMD
Sbjct  120  LLRHMD  125



>gb|AGA37189.1| mitogen-activated protein kinase 6.1 [Brassica napus]
Length=395

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 99/115 (86%), Gaps = 4/115 (3%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSE---AAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYK  318
            MDGG+ QPA DT MSE    A P  P+PGI+NIPATLSHGG FIQYNIFGN+FEVTAKY 
Sbjct  1    MDGGTGQPAADTEMSEVTGGAAPSQPMPGIENIPATLSHGGMFIQYNIFGNIFEVTAKYS  60

Query  319  PPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   PPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>gb|AAN65179.1| mitogen-activated protein kinase 6 [Petroselinum crispum]
Length=387

 Score =   189 bits (480),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = +1

Query  160  GSAQPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIG  339
            GS QP+DTVMS+AAP      GI+NIPA+LSHGGRFIQYNIFGN+FEVTAKYKPPI+PIG
Sbjct  3    GSTQPSDTVMSDAAPASQ-TAGIENIPASLSHGGRFIQYNIFGNIFEVTAKYKPPILPIG  61

Query  340  KGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KGAYGIVCSALN ETNEHV  KKIANAFDNK+DA RTLREIKLLRHMD
Sbjct  62   KGAYGIVCSALNLETNEHVAIKKIANAFDNKVDAKRTLREIKLLRHMD  109



>ref|XP_010506280.1| PREDICTED: mitogen-activated protein kinase 6-like [Camelina 
sativa]
Length=397

 Score =   189 bits (480),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 101/118 (86%), Gaps = 7/118 (6%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA------APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            M+GGS QPA DT M+EA      A P P +PGI+NIPATLSHGG FIQYNIFGN+FEVTA
Sbjct  1    MEGGSNQPAADTEMTEAPVGVSAAAPSPQMPGIENIPATLSHGGMFIQYNIFGNIFEVTA  60

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   KYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  118



>ref|XP_009366225.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Pyrus 
x bretschneideri]
Length=403

 Score =   189 bits (480),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 102/126 (81%), Gaps = 16/126 (13%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVP---------------GIDNIPATLSHGGRFIQYNIF  285
            M+GG  + ADT+MSEAAPP  P P               G+++IPATLSHGGRFIQYNIF
Sbjct  1    MEGG-GRSADTMMSEAAPPSQPDPNHPQQHRPPPHQAMGGVESIPATLSHGGRFIQYNIF  59

Query  286  GNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIK  465
            GNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDN+IDA RTLREIK
Sbjct  60   GNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAVKKIANAFDNRIDAKRTLREIK  119

Query  466  LLRHMD  483
            LLRHMD
Sbjct  120  LLRHMD  125



>ref|XP_010526635.1| PREDICTED: mitogen-activated protein kinase 6-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010526643.1| PREDICTED: mitogen-activated protein kinase 6-like isoform X2 
[Tarenaya hassleriana]
Length=393

 Score =   189 bits (479),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 98/116 (84%), Gaps = 5/116 (4%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPP-----VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKY  315
            MDGG  QPADT M+EA     P     +PGI+NIPA LSHGGRFIQYNIFGN+FEVTAKY
Sbjct  1    MDGGGPQPADTDMTEAVGGSVPSAAAQMPGIENIPAILSHGGRFIQYNIFGNIFEVTAKY  60

Query  316  KPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KPPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   KPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  116



>gb|EYU23922.1| hypothetical protein MIMGU_mgv1a008052mg [Erythranthe guttata]
Length=386

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 96/106 (91%), Gaps = 2/106 (2%)
 Frame = +1

Query  166  AQPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKG  345
            AQPAD VMS+A P QPP P  D+IPA LSHGGRFIQYNIFGN+FEVT+KYKPPIMPIGKG
Sbjct  5    AQPADAVMSDAEP-QPPPPA-DHIPAVLSHGGRFIQYNIFGNIFEVTSKYKPPIMPIGKG  62

Query  346  AYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            AYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  63   AYGIVCSALNSETNEHVALKKIANAFDNKIDAKRTLREIKLLRHMD  108



>gb|ABO65104.1| mitogen-activated protein kinase Naf4, partial [Nicotiana attenuata]
Length=190

 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 97/114 (85%), Gaps = 6/114 (5%)
 Frame = +1

Query  160  GSAQPADTVMSEAAPPQPP------VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKP  321
            GSA   DTVMS+AA  Q P      V GIDNIPA LSHGGRFIQYNIFGN+FEVTAKYKP
Sbjct  3    GSAHQTDTVMSDAAAAQQPAPPPQPVSGIDNIPAALSHGGRFIQYNIFGNIFEVTAKYKP  62

Query  322  PIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  63   PIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  116



>gb|AHX99575.1| mitogen-activated protein kinase 6 [Betula platyphylla]
Length=393

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 96/111 (86%), Gaps = 2/111 (2%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPP--QPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIM  330
            G  AQPAD  M+EA P   Q P  G++NI ATLSHGGRFIQYNIFGN+FEVTAKYKPPIM
Sbjct  5    GAPAQPADAEMTEAQPEAQQHPAMGMENISATLSHGGRFIQYNIFGNIFEVTAKYKPPIM  64

Query  331  PIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIGKGAYGIVCS+LNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  65   PIGKGAYGIVCSSLNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>ref|XP_010517958.1| PREDICTED: mitogen-activated protein kinase 6-like [Camelina 
sativa]
Length=397

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 101/118 (86%), Gaps = 7/118 (6%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA------APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            M+GGS QPA DT M+EA      A P P +PGI+NIPATLSHGG FIQYNIFGN+FEVTA
Sbjct  1    MEGGSNQPAADTEMTEAPVGVSAAAPSPQMPGIENIPATLSHGGMFIQYNIFGNIFEVTA  60

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPI+PIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   KYKPPILPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  118



>ref|XP_006351058.1| PREDICTED: mitogen-activated protein kinase homolog NTF4-like 
[Solanum tuberosum]
Length=395

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 100/117 (85%), Gaps = 7/117 (6%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAA------PPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAK  312
            MDG + Q  DTVMS+AA       P  P+ G++NIPATLSHGGRFIQYNIFGN+FEVTAK
Sbjct  1    MDGSAPQ-TDTVMSDAAGGQQPATPXLPMAGMENIPATLSHGGRFIQYNIFGNIFEVTAK  59

Query  313  YKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            YKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   YKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  116



>emb|CDY44256.1| BnaC03g24480D [Brassica napus]
Length=395

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 99/115 (86%), Gaps = 4/115 (3%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA---APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYK  318
            MDGG+ QPA DT MSEA   A    P+PG +NIPATLSHGGRFIQYNIFGN+FEVTAKY 
Sbjct  1    MDGGTGQPAADTEMSEASGGAVASQPMPGKENIPATLSHGGRFIQYNIFGNIFEVTAKYN  60

Query  319  PPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   PPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>gb|EYU22909.1| hypothetical protein MIMGU_mgv1a007972mg [Erythranthe guttata]
Length=389

 Score =   186 bits (472),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG-IDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPI  327
            M+GG AQP DT+MSEAAPP PP    ID+IPATLSHGGRFIQYNIFGN+FEVT+KYKPPI
Sbjct  1    MEGG-AQPVDTMMSEAAPPPPPPQPPIDHIPATLSHGGRFIQYNIFGNIFEVTSKYKPPI  59

Query  328  MPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            MPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   MPIGKGAYGIVCSALNSETNEHVALKKIANAFDNKIDAKRTLREIKLLRHMD  111



>ref|XP_006583849.1| PREDICTED: mitogen-activated protein kinase homolog D5-like isoform 
X2 [Glycine max]
Length=392

 Score =   186 bits (472),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 101/112 (90%), Gaps = 3/112 (3%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPPVP---GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPI  327
            GG+A PADTVMS+AAPP    P   GI+NIPATLSHGGRFIQYNIFGN+FEVTAKYKPPI
Sbjct  4    GGAAPPADTVMSDAAPPPQQPPVAMGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPI  63

Query  328  MPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            MPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  64   MPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>ref|XP_003529369.1| PREDICTED: mitogen-activated protein kinase homolog D5-like isoformX1 
[Glycine max]
Length=433

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 104/117 (89%), Gaps = 4/117 (3%)
 Frame = +1

Query  145  RKMDGG-SAQPADTVMSEAAPPQPPVP---GIDNIPATLSHGGRFIQYNIFGNVFEVTAK  312
            R M+GG +A PADTVMS+AAPP    P   GI+NIPATLSHGGRFIQYNIFGN+FEVTAK
Sbjct  40   RAMEGGGAAPPADTVMSDAAPPPQQPPVAMGIENIPATLSHGGRFIQYNIFGNIFEVTAK  99

Query  313  YKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            YKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  100  YKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  156



>ref|XP_010530307.1| PREDICTED: mitogen-activated protein kinase 6 [Tarenaya hassleriana]
Length=396

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 97/118 (82%), Gaps = 7/118 (6%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEA-------APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            MDGG AQP DT M+EA       A     +PG +NIPA LSHGGRFIQYNIFGN+FEVTA
Sbjct  1    MDGGGAQPGDTEMTEAGGGAVPSAAEAAQIPGNENIPAILSHGGRFIQYNIFGNIFEVTA  60

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDN+IDA RTLREIKLLRHMD
Sbjct  61   KYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNRIDAKRTLREIKLLRHMD  118



>ref|XP_009770220.1| PREDICTED: mitogen-activated protein kinase homolog NTF4 [Nicotiana 
sylvestris]
 gb|AAB58396.1| salicylic acid-activated MAP kinase [Nicotiana tabacum]
Length=393

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 97/113 (86%), Gaps = 5/113 (4%)
 Frame = +1

Query  160  GSAQPADTVMSEAAPPQPP-----VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPP  324
            GS Q  DT+MS+A   QPP     V G+DNIPATLSHGGRFIQYNIFGN+FEVTAKYKPP
Sbjct  3    GSGQQTDTMMSDAGAEQPPTAPQPVAGMDNIPATLSHGGRFIQYNIFGNIFEVTAKYKPP  62

Query  325  IMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            I+PIGKGAYGIVCSALNSET E+V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  63   ILPIGKGAYGIVCSALNSETIENVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>dbj|BAG50820.1| MAP kinase [Nicotiana benthamiana]
Length=393

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 97/113 (86%), Gaps = 5/113 (4%)
 Frame = +1

Query  160  GSAQPADTVMSEAAPPQPP-----VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPP  324
            GS Q  DT+MS+A   QPP     V G+DNIPATLSHGGRFIQYNIFGN+FEVTAKYKPP
Sbjct  3    GSGQQTDTMMSDAGAEQPPPAAQPVAGMDNIPATLSHGGRFIQYNIFGNIFEVTAKYKPP  62

Query  325  IMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            I+PIGKGAYGIVCSALNSET E+V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  63   ILPIGKGAYGIVCSALNSETIENVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>dbj|BAC53772.1| salicylic acid-induced protein kinase [Nicotiana benthamiana]
Length=393

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 98/113 (87%), Gaps = 5/113 (4%)
 Frame = +1

Query  160  GSAQPADTVMSEAAPPQPP-----VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPP  324
            GS Q +DT+MS+A   QPP     V G+DNIPATLSHGGRFIQYNIFGN+FEVTAKYKPP
Sbjct  3    GSGQQSDTMMSDAGAEQPPPAAQPVAGMDNIPATLSHGGRFIQYNIFGNIFEVTAKYKPP  62

Query  325  IMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            I+PIG+GAYGIVCSALNSET E+V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  63   ILPIGRGAYGIVCSALNSETIENVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>gb|KJB29907.1| hypothetical protein B456_005G123100 [Gossypium raimondii]
 gb|KJB29909.1| hypothetical protein B456_005G123100 [Gossypium raimondii]
Length=297

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 97/118 (82%), Gaps = 9/118 (8%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPP---------VPGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            GG  Q ADT M+EAA  QP            G++NIPATLSHGGRFIQYNIFGN+FEVTA
Sbjct  4    GGPPQAADTEMAEAAQQQPQHHQQHPPQVAAGLENIPATLSHGGRFIQYNIFGNIFEVTA  63

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  64   KYKPPIMPIGKGAYGIVCSALNSETNEHVALKKIANAFDNKIDAKRTLREIKLLRHMD  121



>gb|ABB16418.1| mitogen-activated protein kinase Ntf4-2 [Nicotiana tabacum]
Length=392

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 100/115 (87%), Gaps = 5/115 (4%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPP----VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYK  318
            MDG + Q ADTVMS+AA    P    V GIDNIPATLSHGGRFIQYNIFGN+FEVTAKYK
Sbjct  1    MDGPAHQ-ADTVMSDAAQQPAPPPQPVAGIDNIPATLSHGGRFIQYNIFGNIFEVTAKYK  59

Query  319  PPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   PPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  114



>gb|AAZ23128.1| mitogen-activated protein kinase 1 [Arachis hypogaea]
Length=397

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 101/121 (83%), Gaps = 10/121 (8%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPV----------PGIDNIPATLSHGGRFIQYNIFGNVFE  300
            M+GG+A PAD VMS+AAPP               G++NIPATLSHGGRFIQYNIFGN+FE
Sbjct  1    MEGGAAPPADAVMSDAAPPPQDHQQQHQQPAAPTGVENIPATLSHGGRFIQYNIFGNIFE  60

Query  301  VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            VTAKYKPPIMPIGKGAYGIVCSALNSET+EHV  KKIANAFDNKIDA RTLREIKLLRHM
Sbjct  61   VTAKYKPPIMPIGKGAYGIVCSALNSETDEHVAIKKIANAFDNKIDAKRTLREIKLLRHM  120

Query  481  D  483
            D
Sbjct  121  D  121



>gb|KFK37200.1| hypothetical protein AALP_AA4G227200 [Arabis alpina]
Length=401

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 100/121 (83%), Gaps = 12/121 (10%)
 Frame = +1

Query  157  GGSAQPA---DTVMSEA--------APPQPP-VPGIDNIPATLSHGGRFIQYNIFGNVFE  300
            GGS QPA   DT M+EA        AP  P  +PGI+NIPATLSHGGRFIQYNIFGN+FE
Sbjct  4    GGSGQPATVADTEMTEATGGGGGVPAPSDPSQMPGIENIPATLSHGGRFIQYNIFGNIFE  63

Query  301  VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            VTAKYKPPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHM
Sbjct  64   VTAKYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHM  123

Query  481  D  483
            D
Sbjct  124  D  124



>ref|XP_002310398.2| mitogen-activated protein kinase 7 [Populus trichocarpa]
 gb|EEE90848.2| mitogen-activated protein kinase 7 [Populus trichocarpa]
Length=398

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 100/123 (81%), Gaps = 14/123 (11%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEA-----APPQP-------PVPGIDNIPATLSHGGRFIQYNIFGNV  294
            MDGG    ADT MS+A     APPQP          G++NIPATLSHGGRFIQYNIFGN+
Sbjct  1    MDGGGT--ADTEMSDAPEQEQAPPQPMGGGGGGGGGGMENIPATLSHGGRFIQYNIFGNI  58

Query  295  FEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLR  474
            FEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLR
Sbjct  59   FEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLR  118

Query  475  HMD  483
            HMD
Sbjct  119  HMD  121



>dbj|BAG50821.1| MAP kinase [Nicotiana benthamiana]
Length=394

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 101/117 (86%), Gaps = 7/117 (6%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPP------VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAK  312
            MDG + Q ADTVMS+AA  Q P      V GIDNIPATLSHGGRFIQYNIFGN+FEVTAK
Sbjct  1    MDGPAHQ-ADTVMSDAAAAQQPAPPPQPVSGIDNIPATLSHGGRFIQYNIFGNIFEVTAK  59

Query  313  YKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            YKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   YKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  116



>ref|XP_006294349.1| hypothetical protein CARUB_v10023366mg [Capsella rubella]
 gb|EOA27247.1| hypothetical protein CARUB_v10023366mg [Capsella rubella]
Length=398

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 102/121 (84%), Gaps = 10/121 (8%)
 Frame = +1

Query  151  MDGGSAQPA-DTVMSEA---------APPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFE  300
            MDGGS QPA DT M++A         + P P +PGI+NIPATLSHGGRFIQYNIFGN+FE
Sbjct  1    MDGGSGQPAADTEMTDAPGGVSAAPPSQPPPQMPGIENIPATLSHGGRFIQYNIFGNIFE  60

Query  301  VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            VTAKYKPPIMPIGKGAYGIVCSA+NSETNE V  KKIANAFDNKIDA RTLREIKLLRHM
Sbjct  61   VTAKYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHM  120

Query  481  D  483
            D
Sbjct  121  D  121



>gb|KJB29908.1| hypothetical protein B456_005G123100 [Gossypium raimondii]
Length=343

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 97/118 (82%), Gaps = 9/118 (8%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPP---------VPGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            GG  Q ADT M+EAA  QP            G++NIPATLSHGGRFIQYNIFGN+FEVTA
Sbjct  4    GGPPQAADTEMAEAAQQQPQHHQQHPPQVAAGLENIPATLSHGGRFIQYNIFGNIFEVTA  63

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  64   KYKPPIMPIGKGAYGIVCSALNSETNEHVALKKIANAFDNKIDAKRTLREIKLLRHMD  121



>ref|XP_010672463.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Beta 
vulgaris subsp. vulgaris]
Length=402

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 97/124 (78%), Gaps = 13/124 (10%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPGIDN-------------IPATLSHGGRFIQYNIFGN  291
            M+  +AQP+DT MS+A  P P  P  D+             IPATLSHGGRFIQYNIFGN
Sbjct  1    MEASAAQPSDTEMSDAGIPAPENPLPDHSQPPQQQQQQQISIPATLSHGGRFIQYNIFGN  60

Query  292  VFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLL  471
            VFEVT KYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNK+DA RTLREIKLL
Sbjct  61   VFEVTVKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKVDAKRTLREIKLL  120

Query  472  RHMD  483
            RHMD
Sbjct  121  RHMD  124



>gb|AJA29666.1| mitogen-activated protein kinase 6 [Gossypium hirsutum]
 gb|KJB29906.1| hypothetical protein B456_005G123100 [Gossypium raimondii]
Length=399

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 97/118 (82%), Gaps = 9/118 (8%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPP---------VPGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            GG  Q ADT M+EAA  QP            G++NIPATLSHGGRFIQYNIFGN+FEVTA
Sbjct  4    GGPPQAADTEMAEAAQQQPQHHQQHPPQVAAGLENIPATLSHGGRFIQYNIFGNIFEVTA  63

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  64   KYKPPIMPIGKGAYGIVCSALNSETNEHVALKKIANAFDNKIDAKRTLREIKLLRHMD  121



>gb|KHG06263.1| Mitogen-activated protein kinase NTF4 [Gossypium arboreum]
Length=399

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 97/118 (82%), Gaps = 9/118 (8%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPP---------VPGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            GG  Q ADT M+EAA  QP            G++NIPATLSHGGRFIQYNIFGN+FEVTA
Sbjct  4    GGPPQAADTEMAEAAQQQPQHHQQHPPQVAAGLENIPATLSHGGRFIQYNIFGNIFEVTA  63

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  64   KYKPPIMPIGKGAYGIVCSALNSETNEHVALKKIANAFDNKIDAKRTLREIKLLRHMD  121



>gb|AAF81420.1| MAP kinase 2 [Capsicum annuum]
Length=394

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 98/114 (86%), Gaps = 6/114 (5%)
 Frame = +1

Query  160  GSAQPADTVMSEAAPPQPP------VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKP  321
            G AQ  DTVM+EAA  Q P      V GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKP
Sbjct  3    GPAQQTDTVMAEAAAAQQPAPPSQPVAGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKP  62

Query  322  PIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  63   PIMPIGKGAYGIVCSALNSETNEHVATKKIANAFDNKIDAKRTLREIKLLRHMD  116



>gb|ADT65136.1| mitogen-activated protein kinase [Gossypium hirsutum]
 gb|ADT65137.1| mitogen-activated protein kinase [Gossypium hirsutum]
Length=399

 Score =   181 bits (460),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 97/118 (82%), Gaps = 9/118 (8%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPP---------VPGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            GG  Q ADT M+EAA  QP            G++NIPATLSHGGRFIQYNIFGN+FEVTA
Sbjct  4    GGPPQAADTEMAEAAQQQPQHHQQRPPQVAAGLENIPATLSHGGRFIQYNIFGNIFEVTA  63

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  64   KYKPPIMPIGKGAYGIVCSALNSETNEHVALKKIANAFDNKIDAKRTLREIKLLRHMD  121



>gb|KDP35142.1| hypothetical protein JCGZ_10676 [Jatropha curcas]
Length=405

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 98/127 (77%), Gaps = 16/127 (13%)
 Frame = +1

Query  151  MDG-GSAQPADTVMSEAAPPQ---------------PPVPGIDNIPATLSHGGRFIQYNI  282
            MDG G  QPADT M EAA P                 P  G++NIPATLSHGGRFIQYNI
Sbjct  1    MDGAGPGQPADTEMEEAAVPAPAPADPQQHHQQQQVSPTGGVENIPATLSHGGRFIQYNI  60

Query  283  FGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREI  462
            FGN+FEVTAKYKPPIMPIGKGAYGIVCSALNSET EHV  KKIANAFDNKIDA RTLREI
Sbjct  61   FGNIFEVTAKYKPPIMPIGKGAYGIVCSALNSETGEHVAIKKIANAFDNKIDAKRTLREI  120

Query  463  KLLRHMD  483
            KLLRHMD
Sbjct  121  KLLRHMD  127



>ref|XP_009389895.1| PREDICTED: mitogen-activated protein kinase 1-like [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 97/114 (85%), Gaps = 4/114 (4%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAA--PPQP-PVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKP  321
            M+GG AQP D  M++A   PPQP P  G ++I ATLSHGGRFIQYNIFGN+FEVT+KYKP
Sbjct  1    MEGG-AQPTDAEMADAGGQPPQPVPSQGQESIQATLSHGGRFIQYNIFGNIFEVTSKYKP  59

Query  322  PIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIMPIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   PIMPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRHMD  113



>gb|ABB16417.1| mitogen-activated protein kinase Ntf4-1 [Nicotiana tabacum]
Length=394

 Score =   179 bits (453),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 99/117 (85%), Gaps = 7/117 (6%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPP------VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAK  312
            MDG + Q  DTVMS+AA  Q P      V GIDNIPA LSHGGRFIQYNIFGN+FEVTAK
Sbjct  1    MDGPAHQ-TDTVMSDAAAAQQPAPPTQPVAGIDNIPAMLSHGGRFIQYNIFGNIFEVTAK  59

Query  313  YKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            YKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDN+IDA RTLREIKLLRHMD
Sbjct  60   YKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNRIDAKRTLREIKLLRHMD  116



>ref|XP_006492790.1| PREDICTED: mitogen-activated protein kinase homolog D5-like [Citrus 
sinensis]
Length=398

 Score =   178 bits (452),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 98/121 (81%), Gaps = 11/121 (9%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAP-PQPPVP---------GIDNIPATLSHGGRFIQYNIFGNVFE  300
            M+GG    ADT M+EA P PQ             GI++IPATLSHGGRFIQYNIFGN+FE
Sbjct  1    MEGGPP-AADTEMAEAQPDPQQTAAPAAAAPAAGGIESIPATLSHGGRFIQYNIFGNIFE  59

Query  301  VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            VTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHM
Sbjct  60   VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHM  119

Query  481  D  483
            D
Sbjct  120  D  120



>ref|XP_011001813.1| PREDICTED: mitogen-activated protein kinase homolog NTF4-like 
[Populus euphratica]
Length=395

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 98/119 (82%), Gaps = 10/119 (8%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEA--APPQPPV------PGIDNIPATLSHGGRFIQYNIFGNVFEVT  306
            M+GGS   ADT M++A     QPP        G++NIPATLSHGGRFIQYNIFGN+FEVT
Sbjct  1    MEGGSQ--ADTEMTDAPKQQQQPPFMGGGGGGGMENIPATLSHGGRFIQYNIFGNIFEVT  58

Query  307  AKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            AKYKPPIMPIGKGAYGIVCSALNSET EHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  59   AKYKPPIMPIGKGAYGIVCSALNSETTEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  117



>ref|XP_007033688.1| Mitogen-activated protein kinase 6 [Theobroma cacao]
 gb|EOY04614.1| Mitogen-activated protein kinase 6 [Theobroma cacao]
Length=427

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 96/122 (79%), Gaps = 13/122 (11%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPPVPG-------------IDNIPATLSHGGRFIQYNIFGNVF  297
            GG  QPADT M++AA P                   ++NIPATLSHGGRFIQYNIFGN+F
Sbjct  4    GGPPQPADTEMTDAAQPPHSQQPQQSDPQHQQQPPQMENIPATLSHGGRFIQYNIFGNIF  63

Query  298  EVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRH  477
            EVTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRH
Sbjct  64   EVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAVKKIANAFDNKIDAKRTLREIKLLRH  123

Query  478  MD  483
            MD
Sbjct  124  MD  125



>emb|CDP08056.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 99/126 (79%), Gaps = 16/126 (13%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVP---------------GIDNIPATLSHGGRFIQYNIF  285
            M+GG AQP+DTVM+EA    P  P               G++N+PA LSHGGRFIQYNIF
Sbjct  1    MEGG-AQPSDTVMTEAGAAPPQPPQAQQQQQHQAYAAAAGVENVPAVLSHGGRFIQYNIF  59

Query  286  GNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIK  465
            GN+FEVTAKYKPPIMPIGKGAYGIVCSALNSET EHV  KKIANAFDN+IDA RTLREIK
Sbjct  60   GNIFEVTAKYKPPIMPIGKGAYGIVCSALNSETTEHVALKKIANAFDNRIDAKRTLREIK  119

Query  466  LLRHMD  483
            LLRHMD
Sbjct  120  LLRHMD  125



>gb|AAF65766.1|AF242308_1 mitogen-activated protein kinase [Euphorbia esula]
Length=389

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  211  PPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNE  390
            PP  GI+NIPATLSHGGRFIQYNIFGN+FEVTAKY+PPIMPIGKGAYGIVCSALNSET E
Sbjct  21   PPTAGIENIPATLSHGGRFIQYNIFGNIFEVTAKYRPPIMPIGKGAYGIVCSALNSETGE  80

Query  391  HVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            HV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  81   HVAIKKIANAFDNKIDAKRTLREIKLLRHMD  111



>ref|XP_006442196.1| hypothetical protein CICLE_v10020481mg [Citrus clementina]
 gb|ESR55436.1| hypothetical protein CICLE_v10020481mg [Citrus clementina]
Length=398

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 94/113 (83%), Gaps = 10/113 (9%)
 Frame = +1

Query  175  ADTVMSEAAP-PQPPVP---------GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPP  324
            ADT M+EA P PQ             GI++IPATLSHGGRFIQYNIFGN+FEVTAKYKPP
Sbjct  8    ADTEMAEAQPDPQQTAAPAAAAPAAGGIESIPATLSHGGRFIQYNIFGNIFEVTAKYKPP  67

Query  325  IMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            IMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  68   IMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  120



>ref|NP_001152745.1| ABA stimulation MAP kinase [Zea mays]
 gb|ACF35309.1| ABA stimulation MAP kinase [Zea mays]
Length=397

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 98/122 (80%), Gaps = 12/122 (10%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEA--------APPQPPVPG---IDNIPATLSHGGRFIQYNIFGNVF  297
            MDGG  QP DT M++A        +PPQ P  G   ++NI ATLSHGGRFIQYNIFGNVF
Sbjct  1    MDGG-GQPPDTEMTDAGAGGGGQPSPPQQPASGAGMMENIHATLSHGGRFIQYNIFGNVF  59

Query  298  EVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRH  477
            EVT+KYKPPI+PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLRH
Sbjct  60   EVTSKYKPPILPIGKGAYGIVCSALNSETAEQVAIKKIANAFDNKIDAKRTLREIKLLRH  119

Query  478  MD  483
            MD
Sbjct  120  MD  121



>gb|ABJ89812.1| salicylic acid-activated MAP kinase [Nicotiana attenuata]
Length=393

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 97/113 (86%), Gaps = 5/113 (4%)
 Frame = +1

Query  160  GSAQPADTVMSEAAPPQPP-----VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPP  324
            GS Q  DT+MS+A   QPP     V G+DNIPATLSHGGRFIQYNIFGN+FEVTAKYKPP
Sbjct  3    GSGQQTDTMMSDAGAEQPPPAPQPVAGMDNIPATLSHGGRFIQYNIFGNIFEVTAKYKPP  62

Query  325  IMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            I+PIGKGAYGIVCSALNSET E+V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  63   ILPIGKGAYGIVCSALNSETIENVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>ref|XP_004287157.1| PREDICTED: mitogen-activated protein kinase homolog D5 [Fragaria 
vesca subsp. vesca]
Length=391

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 92/108 (85%), Gaps = 3/108 (3%)
 Frame = +1

Query  169  QPADTVMSEAAPPQPPVPGI---DNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIG  339
            Q  DTVMSEA P Q     +   + IPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIG
Sbjct  6    QSGDTVMSEAGPTQQQQQAVAQPEAIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIG  65

Query  340  KGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KGAYGIVCSALNSET+EHV  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  66   KGAYGIVCSALNSETSEHVAIKKIANAFDNKIDAKRTLREIKLLRHMD  113



>gb|AHN53386.1| MAPK6 protein [Solanum tuberosum]
Length=396

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  217  VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  396
            +PG+DNIPATLSHGGRFIQYNIFGN+FEVTAKYKPPIMPIGKGAYGIVCSALNSETNE+V
Sbjct  30   LPGMDNIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSALNSETNENV  89

Query  397  TXKKIANAFDNKIDAXRTLREIKLLRHMD  483
              KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  90   AIKKIANAFDNKIDAKRTLREIKLLRHMD  118



>ref|NP_001275321.1| mitogen-activated protein kinase homolog NTF4-like [Solanum tuberosum]
 dbj|BAB93529.1| mitogen-activated protein kinase [Solanum tuberosum]
Length=396

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  217  VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  396
            +PG+DNIPATLSHGGRFIQYNIFGN+FEVTAKYKPPIMPIGKGAYGIVCSALNSETNE+V
Sbjct  30   LPGMDNIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSALNSETNENV  89

Query  397  TXKKIANAFDNKIDAXRTLREIKLLRHMD  483
              KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  90   AIKKIANAFDNKIDAKRTLREIKLLRHMD  118



>ref|XP_011074877.1| PREDICTED: mitogen-activated protein kinase homolog MMK1-like 
[Sesamum indicum]
Length=391

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 94/109 (86%), Gaps = 3/109 (3%)
 Frame = +1

Query  166  AQPADTVMSEAAPPQPPVPGI---DNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPI  336
            AQPAD +MSEA P   P       D+IPATLSHGGRFIQYNIFGN+FEVT+KYKPPIMPI
Sbjct  5    AQPADAIMSEAEPQSTPPQQQPSNDHIPATLSHGGRFIQYNIFGNIFEVTSKYKPPIMPI  64

Query  337  GKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            GKGAYGIVCSALNSETNE+V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  65   GKGAYGIVCSALNSETNENVAIKKIANAFDNKIDAKRTLREIKLLRHMD  113



>gb|KHG30807.1| Mitogen-activated protein kinase MMK1 [Gossypium arboreum]
Length=397

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 94/116 (81%), Gaps = 7/116 (6%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPPVP-------GIDNIPATLSHGGRFIQYNIFGNVFEVTAKY  315
            GG  Q ADT M+E   PQ           G++NIPATLSHGGRFIQYNIFGN+FEVTAKY
Sbjct  4    GGPPQAADTEMAEQPNPQNHQQQPPQMAIGLENIPATLSHGGRFIQYNIFGNIFEVTAKY  63

Query  316  KPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KPPIMPIGKGAYGIVCSALNSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  64   KPPIMPIGKGAYGIVCSALNSETNEQVALKKIANAFDNKIDAKRTLREIKLLRHMD  119



>gb|AEG64802.1| mitogen-activated protein kinase [Gossypium hirsutum]
 gb|AJA29663.1| mitogen-activated protein kinase 3 [Gossypium hirsutum]
Length=397

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 94/116 (81%), Gaps = 7/116 (6%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPPVP-------GIDNIPATLSHGGRFIQYNIFGNVFEVTAKY  315
            GG  Q ADT M+E   PQ           G++NIPATLSHGGRFIQYNIFGN+FEVTAKY
Sbjct  4    GGPPQAADTEMAEQPNPQHHQQQPPQMGIGLENIPATLSHGGRFIQYNIFGNIFEVTAKY  63

Query  316  KPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KPPIMPIGKGAYGIVCSALNSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  64   KPPIMPIGKGAYGIVCSALNSETNEQVALKKIANAFDNKIDAKRTLREIKLLRHMD  119



>ref|XP_004964813.1| PREDICTED: mitogen-activated protein kinase 1-like [Setaria italica]
Length=399

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 97/124 (78%), Gaps = 14/124 (11%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAA---------PPQPPVPGI----DNIPATLSHGGRFIQYNIFGN  291
            MDGG AQP DT M++A          PPQ P  G     DNI ATLSHGGRFIQYNIFGN
Sbjct  1    MDGG-AQPPDTEMTDAGAGAGGGGGHPPQQPAGGGGGMMDNIQATLSHGGRFIQYNIFGN  59

Query  292  VFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLL  471
            VFEVTAKYKPPI+PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLL
Sbjct  60   VFEVTAKYKPPILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLL  119

Query  472  RHMD  483
            RHMD
Sbjct  120  RHMD  123



>ref|NP_001234011.1| Mitogen-activated protein kinase [Solanum lycopersicum]
 emb|CAD59691.1| Mitogen-activated protein kinase [Solanum lycopersicum]
Length=396

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 96/119 (81%), Gaps = 9/119 (8%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPP--------VPGIDNIPATLSHGGRFIQYNIFGNVFEVT  306
            MDG   Q  DT+MS+ A P           + G+DNIPATLSHGGRFIQYNIFGN+FEVT
Sbjct  1    MDGSVPQ-TDTMMSDVAAPPAQQPPPPSQPLAGMDNIPATLSHGGRFIQYNIFGNIFEVT  59

Query  307  AKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            AKYKPPIMPIGKGAYGIVCSALNSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   AKYKPPIMPIGKGAYGIVCSALNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  118



>ref|XP_010271099.1| PREDICTED: mitogen-activated protein kinase homolog NTF4-like 
[Nelumbo nucifera]
Length=293

 Score =   171 bits (434),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 95/114 (83%), Gaps = 7/114 (6%)
 Frame = +1

Query  163  SAQPADTVMSEAAPPQP-------PVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKP  321
            +AQ +DTVM+EAAPP         P PG D IP TLSHGGRFIQYNIFGN+FE+T+KYKP
Sbjct  3    AAQSSDTVMAEAAPPPEPPPAAGVPQPGFDGIPMTLSHGGRFIQYNIFGNIFEITSKYKP  62

Query  322  PIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIMPIGKGAYGIVCSALNSETNE V  KKIANAFDN+ID  RTLREIKLLRHMD
Sbjct  63   PIMPIGKGAYGIVCSALNSETNEQVAIKKIANAFDNRIDGKRTLREIKLLRHMD  116



>gb|AAP20419.1| mitogen-activated protein kinase 1 [Solanum lycopersicum]
Length=396

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 96/119 (81%), Gaps = 9/119 (8%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPP--------VPGIDNIPATLSHGGRFIQYNIFGNVFEVT  306
            MDG   Q  DT+MS+ A P           + G+DNIPATLSHGGRFIQYNIFGN+FEVT
Sbjct  1    MDGSVPQ-TDTMMSDVAAPPAQQPPPPSQPLAGMDNIPATLSHGGRFIQYNIFGNIFEVT  59

Query  307  AKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            AKYKPPIMPIGKGAYGIVCSALNSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   AKYKPPIMPIGKGAYGIVCSALNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMD  118



>ref|XP_009606346.1| PREDICTED: mitogen-activated protein kinase homolog NTF4 [Nicotiana 
tomentosiformis]
Length=393

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 97/113 (86%), Gaps = 5/113 (4%)
 Frame = +1

Query  160  GSAQPADTVMSEAAPPQPP-----VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPP  324
            GS Q  DT+MS+A   QPP     V G+DNIPATLS+GGRFIQYNIFGN+FEVTAKYKPP
Sbjct  3    GSGQQTDTMMSDAGAEQPPPAPQPVAGMDNIPATLSYGGRFIQYNIFGNIFEVTAKYKPP  62

Query  325  IMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            I+PIGKGAYGIVCSALNSET E+V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  63   ILPIGKGAYGIVCSALNSETIENVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>gb|EPS60369.1| hypothetical protein M569_14432, partial [Genlisea aurea]
Length=397

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 99/120 (83%), Gaps = 10/120 (8%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVP---------GIDNIPATLSHGGRFIQYNIFGNVFEV  303
            MDGG  QP D VMSEA P  PP P          +D+IPATLSHGGRFIQYNI+GN+FEV
Sbjct  1    MDGG-VQPPDAVMSEAEPAPPPPPPPQTQQPHPSMDHIPATLSHGGRFIQYNIYGNIFEV  59

Query  304  TAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            T+KYKPPIMPIGKGAYGIVCSALNSETNE+V  KKI+NAFDN+IDA RTLREIKLLRHMD
Sbjct  60   TSKYKPPIMPIGKGAYGIVCSALNSETNENVALKKISNAFDNRIDAKRTLREIKLLRHMD  119



>emb|CAH05023.1| putative MAP kinase [Papaver rhoeas]
Length=403

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 96/126 (76%), Gaps = 15/126 (12%)
 Frame = +1

Query  151  MDG-GSAQPADTVMSEAAP-------PQPPVPG-------IDNIPATLSHGGRFIQYNIF  285
            MDG   A   DTVM EA         PQPP          ++NIPATLSHGG+FIQYNIF
Sbjct  1    MDGTQEAAATDTVMGEAPSGVIAGEGPQPPPASEGGGGGGMENIPATLSHGGKFIQYNIF  60

Query  286  GNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIK  465
            GN+FEVTAKYKPPIMPIGKGAYGIVCSALNSET+E V  KKIANAFDNKIDA RTLREIK
Sbjct  61   GNIFEVTAKYKPPIMPIGKGAYGIVCSALNSETSEQVAIKKIANAFDNKIDAKRTLREIK  120

Query  466  LLRHMD  483
            LLRHMD
Sbjct  121  LLRHMD  126



>gb|KJB27807.1| hypothetical protein B456_005G011100 [Gossypium raimondii]
Length=397

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 93/116 (80%), Gaps = 7/116 (6%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPPVP-------GIDNIPATLSHGGRFIQYNIFGNVFEVTAKY  315
            GG  Q ADT M+E   PQ           G++NIPATLSHGGRFIQYNIFGN+FEVTAKY
Sbjct  4    GGPPQAADTEMAEQPNPQHHQQQPPQMGIGLENIPATLSHGGRFIQYNIFGNIFEVTAKY  63

Query  316  KPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KPPIMPIGKGAYGIVCSALNS TNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  64   KPPIMPIGKGAYGIVCSALNSVTNEQVALKKIANAFDNKIDAKRTLREIKLLRHMD  119



>ref|XP_002524853.1| big map kinase/bmk, putative [Ricinus communis]
 gb|EEF37477.1| big map kinase/bmk, putative [Ricinus communis]
Length=402

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G++NIPATLSHGGRFIQYNIFGN+FEVTAKYKPPIMPIGKGAYGIVCSALNSET EHV  
Sbjct  38   GMENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSALNSETAEHVAI  97

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  98   KKIANAFDNKIDAKRTLREIKLLRHMD  124



>ref|XP_011047652.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Populus 
euphratica]
 ref|XP_011047653.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Populus 
euphratica]
 ref|XP_011047654.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Populus 
euphratica]
Length=396

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 96/121 (79%), Gaps = 12/121 (10%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG----------IDNIPATLSHGGRFIQYNIFGNVFE  300
            MDGG    ADT MS+A   +   P           +++IPATLSHGGRFIQYNIFGN+FE
Sbjct  1    MDGGGT--ADTEMSDAPQQEQAPPQPMVGGGGGGGMESIPATLSHGGRFIQYNIFGNIFE  58

Query  301  VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            VTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  KKIANAFDNKIDA RTLREIKLLRHM
Sbjct  59   VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHM  118

Query  481  D  483
            D
Sbjct  119  D  119



>ref|XP_002323707.2| mitogen-activated protein kinase 7 [Populus trichocarpa]
 gb|EEF03840.2| mitogen-activated protein kinase 7 [Populus trichocarpa]
Length=399

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 95/123 (77%), Gaps = 14/123 (11%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG------------IDNIPATLSHGGRFIQYNIFGNV  294
            M+GGS   ADT M++A   Q                 ++NIPATLSHGGRFIQYNIFGN+
Sbjct  1    MEGGSQ--ADTEMADAPQQQQLQQQPPFMGGGGGGGGMENIPATLSHGGRFIQYNIFGNI  58

Query  295  FEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLR  474
            FEVTAKYKPPIMPIGKGAYGIVCSALNSET EHV  KKIANAFDNKIDA RTLREIKLLR
Sbjct  59   FEVTAKYKPPIMPIGKGAYGIVCSALNSETTEHVAIKKIANAFDNKIDAKRTLREIKLLR  118

Query  475  HMD  483
            HMD
Sbjct  119  HMD  121



>sp|Q06060.1|MPK_PEA RecName: Full=Mitogen-activated protein kinase homolog D5 [Pisum 
sativum]
 emb|CAA50036.1| MAP kinase homologue [Pisum sativum]
Length=394

 Score =   170 bits (431),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            GI+NIPATLSHGGRFIQYNIFGN+FEVTAKY+PPIMPIGKGAYGIVCSA NSETNEHV  
Sbjct  31   GIENIPATLSHGGRFIQYNIFGNIFEVTAKYRPPIMPIGKGAYGIVCSAHNSETNEHVAV  90

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDNKIDA RTLREIKL+RHMD
Sbjct  91   KKIANAFDNKIDAKRTLREIKLVRHMD  117



>ref|XP_009399824.1| PREDICTED: mitogen-activated protein kinase 1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399825.1| PREDICTED: mitogen-activated protein kinase 1 [Musa acuminata 
subsp. malaccensis]
Length=393

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 95/117 (81%), Gaps = 7/117 (6%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAA------PPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAK  312
            M+GG AQP DT M+EA          PP  G++NI  TLSHGGRFIQYN+FGNVFEVT+K
Sbjct  1    MEGG-AQPTDTEMAEAGGQPPPSAAAPPSQGLENIQETLSHGGRFIQYNMFGNVFEVTSK  59

Query  313  YKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            YKPPIMPIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLRH+D
Sbjct  60   YKPPIMPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRHLD  116



>gb|ACN39979.1| unknown [Picea sitchensis]
Length=344

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +1

Query  151  MDGGSA--QPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPP  324
            M+  +A  Q +DT+MS+A       P +DNIPA LSHGGRF+QYNIFGN+FEVTAKYKPP
Sbjct  1    MEAAAAPVQSSDTLMSDAPQAAGSNP-MDNIPAVLSHGGRFVQYNIFGNIFEVTAKYKPP  59

Query  325  IMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            ++PIGKGAYGIVCS+LNSET E V  KKIANAFDN+IDA RTLREIKLLRHMD
Sbjct  60   LLPIGKGAYGIVCSSLNSETKEQVAIKKIANAFDNRIDAKRTLREIKLLRHMD  112



>gb|ACN39845.1| unknown [Picea sitchensis]
Length=390

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +1

Query  151  MDGGSA--QPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPP  324
            M+  +A  Q +DT+MS+A       P +DNIPA LSHGGRF+QYNIFGN+FEVTAKYKPP
Sbjct  1    MEAAAAPVQSSDTLMSDAPQAAGSNP-MDNIPAVLSHGGRFVQYNIFGNIFEVTAKYKPP  59

Query  325  IMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            ++PIGKGAYGIVCS+LNSET E V  KKIANAFDN+IDA RTLREIKLLRHMD
Sbjct  60   LLPIGKGAYGIVCSSLNSETKEQVAIKKIANAFDNRIDAKRTLREIKLLRHMD  112



>gb|ACT63866.1| mitogen activated protein kinase 6 [Pinus taeda]
Length=390

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 93/113 (82%), Gaps = 3/113 (3%)
 Frame = +1

Query  151  MDGGSA--QPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPP  324
            M+  +A  Q  DT+MS+A       P +DNIPA LSHGGRF+QYNIFGN+FEVTAKYKPP
Sbjct  1    MEAAAAPVQSTDTLMSDAPQAAGSNP-MDNIPAVLSHGGRFVQYNIFGNIFEVTAKYKPP  59

Query  325  IMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            ++PIGKGAYGIVCSA+NSET E V  KKIANAFDN+IDA RTLREIKLLRHMD
Sbjct  60   LLPIGKGAYGIVCSAMNSETKEQVAIKKIANAFDNRIDAKRTLREIKLLRHMD  112



>gb|AAO16560.1| mitogen-activated protein kinase [Triticum aestivum]
Length=403

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG------IDNIPATLSHGGRFIQYNIFGNVFEVTAK  312
            MD G AQP D+ M+EA        G      +DNI ATL+HGGRFIQYNIFGNVFEVTAK
Sbjct  1    MDAGGAQPPDSEMAEAGAGAAAAAGTAPGGAMDNIQATLTHGGRFIQYNIFGNVFEVTAK  60

Query  313  YKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            YKPPI+PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   YKPPILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRHMD  117



>gb|AFW85791.1| putative MAP kinase family protein [Zea mays]
Length=398

 Score =   167 bits (424),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 94/123 (76%), Gaps = 13/123 (11%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPP---------VPG---IDNIPATLSHGGRFIQYNIFGNV  294
            MDGG  QP DT MSEA               V G   +DNI ATLSHGGRFIQYNIFGNV
Sbjct  1    MDGG-GQPPDTEMSEAGAGGGGQPPQQPLPPVGGGVMLDNIQATLSHGGRFIQYNIFGNV  59

Query  295  FEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLR  474
            FEVTAKYKPP++PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLR
Sbjct  60   FEVTAKYKPPVLPIGKGAYGIVCSALNSETAEQVAIKKIANAFDNKIDAKRTLREIKLLR  119

Query  475  HMD  483
            HMD
Sbjct  120  HMD  122



>gb|AAY90121.1| mitogen-activated protein kinase [Rheum australe]
Length=407

 Score =   168 bits (425),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            NIPATLSHGGRFIQYNIFGN+FEVTAKYKPPIMPIGKGAYGIVCSALNSET+EHV  KKI
Sbjct  46   NIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSALNSETSEHVAIKKI  105

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDNK+DA RTLREIKLLRHMD
Sbjct  106  ANAFDNKVDAKRTLREIKLLRHMD  129



>gb|ACG37232.1| MPK6 - putative MAPK [Zea mays]
Length=398

 Score =   167 bits (424),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 94/123 (76%), Gaps = 13/123 (11%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPP---------VPG---IDNIPATLSHGGRFIQYNIFGNV  294
            MDGG  QP DT MSEA               V G   +DNI ATLSHGGRFIQYNIFGNV
Sbjct  1    MDGG-GQPPDTEMSEAGAGGGGQPPQQPLPPVGGGVMLDNIQATLSHGGRFIQYNIFGNV  59

Query  295  FEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLR  474
            FEVTAKYKPP++PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLR
Sbjct  60   FEVTAKYKPPVLPIGKGAYGIVCSALNSETAEQVAIKKIANAFDNKIDAKRTLREIKLLR  119

Query  475  HMD  483
            HMD
Sbjct  120  HMD  122



>gb|AEM97899.1| sucrose-activated protein kinase [Cephalostachyum fuchsianum]
Length=382

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 91/114 (80%), Gaps = 11/114 (10%)
 Frame = +1

Query  151  MDGGSA---QPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKP  321
            MDGG A   QPA       AP   P   ++NI ATLSHGGRFIQYNIFGNVFEVTAKYKP
Sbjct  1    MDGGGAGGLQPA------VAPA--PAGMMENIQATLSHGGRFIQYNIFGNVFEVTAKYKP  52

Query  322  PIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PI+PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  53   PILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRHMD  106



>gb|EEC80038.1| hypothetical protein OsI_21727 [Oryza sativa Indica Group]
Length=369

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 93/126 (74%), Gaps = 16/126 (13%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG---------------IDNIPATLSHGGRFIQYNIF  285
            MD G AQP+DT M+EA                        ++NI ATLSHGGRFIQYNIF
Sbjct  1    MDAG-AQPSDTEMAEAGGGGGGGQQPPAAAASAAGAGAGMMENIQATLSHGGRFIQYNIF  59

Query  286  GNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIK  465
            GNVFEVTAKYKPPI+PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIK
Sbjct  60   GNVFEVTAKYKPPILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIK  119

Query  466  LLRHMD  483
            LLRHMD
Sbjct  120  LLRHMD  125



>emb|CAC79662.1| mitogen activated protein kinase [Capsicum annuum]
Length=392

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 96/115 (83%), Gaps = 5/115 (4%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVP----GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYK  318
            MDG   Q ADT+MS+AA  QPP P    GIDNIPATLSHGGRFIQ N FG +F+VTAKY 
Sbjct  1    MDGSCYQ-ADTMMSDAAADQPPPPHPVPGIDNIPATLSHGGRFIQSNFFGTIFDVTAKYN  59

Query  319  PPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PPI+PIG+GAYGIVCSALNSET+E+V   KIANAFDN+IDA RTLREIKLLRHMD
Sbjct  60   PPILPIGRGAYGIVCSALNSETSENVPIYKIANAFDNEIDAKRTLREIKLLRHMD  114



>ref|NP_001056846.1| Os06g0154500 [Oryza sativa Japonica Group]
 sp|Q84UI5.1|MPK1_ORYSJ RecName: Full=Mitogen-activated protein kinase 1; Short=MAP kinase 
1; AltName: Full=MAP kinase 6; AltName: Full=OsMAPK6; 
AltName: Full=OsSIPK [Oryza sativa Japonica Group]
 emb|CAD59793.1| mitogen-activated protein kinase [Oryza sativa Japonica Group]
 dbj|BAD34534.1| MAP kinase 6 [Oryza sativa Japonica Group]
 dbj|BAD69291.1| MAP kinase 6 [Oryza sativa Japonica Group]
 dbj|BAF18760.1| Os06g0154500 [Oryza sativa Japonica Group]
Length=398

 Score =   165 bits (418),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 94/123 (76%), Gaps = 13/123 (11%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG------------IDNIPATLSHGGRFIQYNIFGNV  294
            MD G AQP DT M+EA   Q P               ++NI ATLSHGGRFIQYNIFGNV
Sbjct  1    MDAG-AQPPDTEMAEAGGGQQPPAAAAAAGAGAGAGMMENIQATLSHGGRFIQYNIFGNV  59

Query  295  FEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLR  474
            FEVTAKYKPPI+PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLR
Sbjct  60   FEVTAKYKPPILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLR  119

Query  475  HMD  483
            HMD
Sbjct  120  HMD  122



>ref|XP_009419763.1| PREDICTED: mitogen-activated protein kinase 1-like [Musa acuminata 
subsp. malaccensis]
Length=393

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 94/117 (80%), Gaps = 7/117 (6%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAA------PPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAK  312
            M+GG A+P DT M+EA           P  G++++ AT SHGGRF+QYNIFGN+FEVT+K
Sbjct  1    MEGG-AKPTDTEMAEAGGQPPPPQAALPQQGLESVQATPSHGGRFVQYNIFGNIFEVTSK  59

Query  313  YKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            Y+PPIMPIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   YQPPIMPIGKGAYGIVCSALNSETQEQVAIKKIANAFDNKIDAKRTLREIKLLRHMD  116



>ref|XP_006655804.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
1-like [Oryza brachyantha]
Length=402

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 92/117 (79%), Gaps = 7/117 (6%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG------IDNIPATLSHGGRFIQYNIFGNVFEVTAK  312
            MD G AQP DT M++A               ++NI ATLSHGGRFIQYNIFGNVFEVTAK
Sbjct  1    MDAG-AQPPDTEMAQAGAGAXXXXXXXXXXXMENIQATLSHGGRFIQYNIFGNVFEVTAK  59

Query  313  YKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            YKPPI+PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   YKPPILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRHMD  116



>ref|XP_010925649.1| PREDICTED: mitogen-activated protein kinase 1-like [Elaeis guineensis]
Length=397

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 94/121 (78%), Gaps = 11/121 (9%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPV----------PGIDNIPATLSHGGRFIQYNIFGNVFE  300
            MD G  QP+DT M EA PP               G++++ ATLSHGGRFIQYNIFGN+FE
Sbjct  1    MDAG-FQPSDTDMVEAGPPPQKAPAAAAAAPPSTGLESLQATLSHGGRFIQYNIFGNIFE  59

Query  301  VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            VT+KYKPPIMPIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLRHM
Sbjct  60   VTSKYKPPIMPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRHM  119

Query  481  D  483
            D
Sbjct  120  D  120



>ref|NP_001266884.1| uncharacterized protein LOC100834779 [Brachypodium distachyon]
 gb|AFS18261.1| MPK6 [Brachypodium distachyon]
Length=391

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 92/116 (79%), Gaps = 6/116 (5%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG-----IDNIPATLSHGGRFIQYNIFGNVFEVTAKY  315
            MDGG AQP D  M++A    P         ++NI ATLSHGGRFIQYNIFGNVFEVT KY
Sbjct  1    MDGG-AQPPDAEMADAGAAVPGAGAGAAGTMENIQATLSHGGRFIQYNIFGNVFEVTVKY  59

Query  316  KPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KPPI+PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   KPPILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRHMD  115



>ref|XP_010246606.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Nelumbo 
nucifera]
 ref|XP_010246608.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Nelumbo 
nucifera]
Length=395

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 95/115 (83%), Gaps = 7/115 (6%)
 Frame = +1

Query  160  GSAQPADTVMSEAAPPQPPVPG-------IDNIPATLSHGGRFIQYNIFGNVFEVTAKYK  318
             +AQ +DTVM+EAAPP  P P         D+IP  LSHGGRFIQYNIFGN+FE+T+KYK
Sbjct  3    AAAQSSDTVMAEAAPPPEPPPPAGAPQPGFDSIPMILSHGGRFIQYNIFGNIFEITSKYK  62

Query  319  PPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PPIMPIGKGAYGIVCSALNSETNE V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  63   PPIMPIGKGAYGIVCSALNSETNEQVAIKKIANAFDNKIDAKRTLREIKLLRHMD  117



>ref|XP_008781104.1| PREDICTED: mitogen-activated protein kinase 1-like isoform X2 
[Phoenix dactylifera]
Length=317

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 94/123 (76%), Gaps = 13/123 (11%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG------------IDNIPATLSHGGRFIQYNIFGNV  294
            MD G  QP+DT M+EA PP                  +++I ATLSHGGRFIQYNIFGN+
Sbjct  1    MDAG-VQPSDTDMAEAGPPPQQAAAPAAAAAATPPPGLESIQATLSHGGRFIQYNIFGNI  59

Query  295  FEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLR  474
            FEVT+KYKPPIMPIGKGAYGIVCSALNSE+ E V  KKIANAFDNKIDA RTLREIKLLR
Sbjct  60   FEVTSKYKPPIMPIGKGAYGIVCSALNSESGEKVAIKKIANAFDNKIDAKRTLREIKLLR  119

Query  475  HMD  483
            HMD
Sbjct  120  HMD  122



>dbj|BAJ90351.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86277.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07440.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   162 bits (410),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 89/118 (75%), Gaps = 7/118 (6%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPGID-------NIPATLSHGGRFIQYNIFGNVFEVTA  309
            MD G AQP D  M+EA                  NI ATLSHGGRFIQYNIFGNVFEVTA
Sbjct  1    MDAGGAQPPDAEMAEAGGAAAAAAAAGAPGGAMENIQATLSHGGRFIQYNIFGNVFEVTA  60

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            KYKPPI+PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  61   KYKPPILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRHMD  118



>gb|ACF85409.1| unknown [Zea mays]
 gb|AFW75553.1| putative MAP kinase family protein isoform 1 [Zea mays]
 gb|AFW75554.1| putative MAP kinase family protein isoform 2 [Zea mays]
Length=398

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 93/123 (76%), Gaps = 13/123 (11%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG------------IDNIPATLSHGGRFIQYNIFGNV  294
            MDGG  QP DT M++A       P             ++NI ATLSHGGRFIQYNIFGNV
Sbjct  1    MDGG-GQPPDTEMTDAGLGGGGQPPPPPQQPAGGAGMMENIHATLSHGGRFIQYNIFGNV  59

Query  295  FEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLR  474
            FEVT+KYKPPI+PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLR
Sbjct  60   FEVTSKYKPPILPIGKGAYGIVCSALNSETAEQVAIKKIANAFDNKIDAKRTLREIKLLR  119

Query  475  HMD  483
            HMD
Sbjct  120  HMD  122



>ref|XP_002437855.1| hypothetical protein SORBIDRAFT_10g003810 [Sorghum bicolor]
 gb|EER89222.1| hypothetical protein SORBIDRAFT_10g003810 [Sorghum bicolor]
Length=402

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 92/127 (72%), Gaps = 17/127 (13%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG----------------IDNIPATLSHGGRFIQYNI  282
            MDGG  QP DT M++A                         ++NI ATLSHGGRFIQYNI
Sbjct  1    MDGG-GQPPDTEMTDAGAGGGGQQPPPAQQQPQQAAGGGGMMENIQATLSHGGRFIQYNI  59

Query  283  FGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREI  462
            FGNVFEVTAKYKPPI+PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREI
Sbjct  60   FGNVFEVTAKYKPPILPIGKGAYGIVCSALNSETAEQVAIKKIANAFDNKIDAKRTLREI  119

Query  463  KLLRHMD  483
            KLLRHMD
Sbjct  120  KLLRHMD  126



>gb|KHG09868.1| Mitogen-activated protein kinase MMK1 [Gossypium arboreum]
Length=398

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 89/117 (76%), Gaps = 10/117 (9%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPPV---------PGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            GG  QP DT M+EAAPPQ PV         P +  IPAT S+GGRF QYNIFGN+FEVTA
Sbjct  4    GGRPQPPDTQMAEAAPPQQPVYQNALPLMFPRM-QIPATPSYGGRFTQYNIFGNIFEVTA  62

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            KYKPPIMPIG+ AYG VCSALNSETNE    KKI NAF NK+DA RTLREIKLLR+M
Sbjct  63   KYKPPIMPIGEDAYGTVCSALNSETNESAAIKKIVNAFGNKVDAKRTLREIKLLRYM  119



>ref|XP_008780958.1| PREDICTED: mitogen-activated protein kinase 1-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008781033.1| PREDICTED: mitogen-activated protein kinase 1-like isoform X1 
[Phoenix dactylifera]
Length=399

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 94/123 (76%), Gaps = 13/123 (11%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG------------IDNIPATLSHGGRFIQYNIFGNV  294
            MD G  QP+DT M+EA PP                  +++I ATLSHGGRFIQYNIFGN+
Sbjct  1    MDAG-VQPSDTDMAEAGPPPQQAAAPAAAAAATPPPGLESIQATLSHGGRFIQYNIFGNI  59

Query  295  FEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLR  474
            FEVT+KYKPPIMPIGKGAYGIVCSALNSE+ E V  KKIANAFDNKIDA RTLREIKLLR
Sbjct  60   FEVTSKYKPPIMPIGKGAYGIVCSALNSESGEKVAIKKIANAFDNKIDAKRTLREIKLLR  119

Query  475  HMD  483
            HMD
Sbjct  120  HMD  122



>ref|XP_010915532.1| PREDICTED: mitogen-activated protein kinase 1 [Elaeis guineensis]
Length=396

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 93/120 (78%), Gaps = 10/120 (8%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG---------IDNIPATLSHGGRFIQYNIFGNVFEV  303
            MD G AQP D  M+EA  PQ              +++I ATLSHGGRFIQYNIFGN+FEV
Sbjct  1    MDAG-AQPTDADMAEAGAPQQAAAPAAAAPPPPGLESIQATLSHGGRFIQYNIFGNIFEV  59

Query  304  TAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            T+KYKPPIMPIGKGAYGIV SALNSET+E V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  60   TSKYKPPIMPIGKGAYGIVSSALNSETSEQVAIKKIANAFDNKIDAKRTLREIKLLRHMD  119



>gb|KJB71607.1| hypothetical protein B456_011G132800 [Gossypium raimondii]
Length=300

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 88/117 (75%), Gaps = 10/117 (9%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPPV---------PGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            GG  QP D  M+EAAPPQ PV         P +  IPAT S+GGRF QYNIFGN+FEVTA
Sbjct  4    GGRPQPPDPQMAEAAPPQQPVYQNALPLMFPRM-QIPATPSYGGRFTQYNIFGNIFEVTA  62

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            KYKPPIMPIG+ AYG VCSALNSETNE    KKI NAF NK+DA RTLREIKLLR+M
Sbjct  63   KYKPPIMPIGEDAYGTVCSALNSETNESAAIKKIVNAFGNKVDAKRTLREIKLLRYM  119



>gb|KJB71606.1| hypothetical protein B456_011G132800 [Gossypium raimondii]
Length=347

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 88/117 (75%), Gaps = 10/117 (9%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPPV---------PGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            GG  QP D  M+EAAPPQ PV         P +  IPAT S+GGRF QYNIFGN+FEVTA
Sbjct  4    GGRPQPPDPQMAEAAPPQQPVYQNALPLMFPRM-QIPATPSYGGRFTQYNIFGNIFEVTA  62

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            KYKPPIMPIG+ AYG VCSALNSETNE    KKI NAF NK+DA RTLREIKLLR+M
Sbjct  63   KYKPPIMPIGEDAYGTVCSALNSETNESAAIKKIVNAFGNKVDAKRTLREIKLLRYM  119



>gb|ACD76439.1| mitogen activated protein kinase 6 [Oryza sativa Indica Group]
Length=368

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 84/111 (76%), Gaps = 19/111 (17%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIM  330
            MD G AQP+DT M E                  SHGGRFIQYNIFGNVFEVTAKYKPPI+
Sbjct  1    MDAG-AQPSDTEMME------------------SHGGRFIQYNIFGNVFEVTAKYKPPIL  41

Query  331  PIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  42   PIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRHMD  92



>gb|KJB71605.1| hypothetical protein B456_011G132800 [Gossypium raimondii]
Length=398

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 88/117 (75%), Gaps = 10/117 (9%)
 Frame = +1

Query  157  GGSAQPADTVMSEAAPPQPPV---------PGIDNIPATLSHGGRFIQYNIFGNVFEVTA  309
            GG  QP D  M+EAAPPQ PV         P +  IPAT S+GGRF QYNIFGN+FEVTA
Sbjct  4    GGRPQPPDPQMAEAAPPQQPVYQNALPLMFPRM-QIPATPSYGGRFTQYNIFGNIFEVTA  62

Query  310  KYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            KYKPPIMPIG+ AYG VCSALNSETNE    KKI NAF NK+DA RTLREIKLLR+M
Sbjct  63   KYKPPIMPIGEDAYGTVCSALNSETNESAAIKKIVNAFGNKVDAKRTLREIKLLRYM  119



>ref|XP_008812083.1| PREDICTED: mitogen-activated protein kinase 1 [Phoenix dactylifera]
Length=398

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 92/121 (76%), Gaps = 11/121 (9%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPG----------IDNIPATLSHGGRFIQYNIFGNVFE  300
            MD G AQP+D  M+EA PP                +++I ATLSHGG FIQYNIFGN+FE
Sbjct  1    MDAG-AQPSDADMAEAGPPPGGPAPPAAAAPPPPGLESIQATLSHGGSFIQYNIFGNIFE  59

Query  301  VTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHM  480
            VT+KYKPPIMPIGKGAYGIVCSA NSET E V  KKIANAFDN+IDA RTLREIKLLRHM
Sbjct  60   VTSKYKPPIMPIGKGAYGIVCSAWNSETGEQVAIKKIANAFDNRIDAKRTLREIKLLRHM  119

Query  481  D  483
            D
Sbjct  120  D  120



>ref|NP_001104843.1| MAP kinase2 [Zea mays]
 dbj|BAA74734.1| MAP kinase 5 [Zea mays]
Length=399

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 93/124 (75%), Gaps = 14/124 (11%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPP---------VPG---IDNIPATLSHGGRFIQYNIFGNV  294
            MDGG  QP DT MSEA               V G   +DNI ATLSHGGRFIQYNIFGNV
Sbjct  1    MDGG-GQPPDTEMSEAGAGGGGQPPQQPLPPVGGGVMLDNIQATLSHGGRFIQYNIFGNV  59

Query  295  FEVTAKYKPPIMPIGKGAYGIVCSALNSET-NEHVTXKKIANAFDNKIDAXRTLREIKLL  471
            FEVTAKYKPP++PIGKGAYGIVCSA+NSET  E    KKIANAFDNKIDA RTLREIKLL
Sbjct  60   FEVTAKYKPPLLPIGKGAYGIVCSAVNSETAAEGGPSKKIANAFDNKIDAKRTLREIKLL  119

Query  472  RHMD  483
            RHMD
Sbjct  120  RHMD  123



>ref|XP_006845036.1| hypothetical protein AMTR_s00058p00218380 [Amborella trichopoda]
 gb|ERN06711.1| hypothetical protein AMTR_s00058p00218380 [Amborella trichopoda]
Length=400

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +1

Query  178  DTVM--SEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAY  351
            D VM  SE A P    PG+D +P+  +HGGRF+QY+IFGNVFEVTA Y+ PIMPIGKGAY
Sbjct  8    DVVMGESEMAQPNTQQPGMD-VPSVTTHGGRFVQYDIFGNVFEVTAHYQLPIMPIGKGAY  66

Query  352  GIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            GIVCSA NS+ NE V  KKIANAFDNK+DA RTLREIKLLRHMD
Sbjct  67   GIVCSAFNSKLNELVAIKKIANAFDNKMDAKRTLREIKLLRHMD  110



>ref|NP_001237882.1| mitogen-activated protein kinase 1 [Glycine max]
 gb|AAQ13491.1|AF104247_1 mitogen-activated protein kinase 1 [Glycine max]
Length=371

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G+ + PAT +HGG+FIQYNIFGN+FEVTAKY+PPIMP+G+GAYGIVCS LN+ETNE V  
Sbjct  8    GVADFPATPTHGGQFIQYNIFGNLFEVTAKYRPPIMPVGRGAYGIVCSLLNTETNELVAV  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  68   KKIANAFDNHMDAKRTLREIKLLRHLD  94



>gb|KHN22030.1| Mitogen-activated protein kinase 3 [Glycine soja]
Length=371

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G+ + PAT +HGG+FIQYNIFGN+FEVTAKY+PPIMP+G+GAYGIVCS LN+ETNE V  
Sbjct  8    GVADFPATPTHGGQFIQYNIFGNLFEVTAKYRPPIMPVGRGAYGIVCSLLNTETNELVAV  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  68   KKIANAFDNHMDAKRTLREIKLLRHLD  94



>gb|AFK40694.1| unknown [Lotus japonicus]
Length=199

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G+    A  SHGG+FIQYNIFGN+FEVT+KY+PPIMPIG+GAYGIVCS LN+ETNE V  
Sbjct  8    GVAEFQAVPSHGGQFIQYNIFGNLFEVTSKYRPPIMPIGRGAYGIVCSLLNTETNELVAV  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  68   KKIANAFDNHMDAKRTLREIKLLRHLD  94



>gb|AGS78125.1| mitogen activated protein kinase 1 [Curcuma longa]
Length=369

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 83/111 (75%), Gaps = 15/111 (14%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIM  330
            MD G AQP DT M+EA   Q  +             GRFIQYNIFGN FEVTAKYKPPI+
Sbjct  1    MDAG-AQPPDTEMAEAGGGQGAI-------------GRFIQYNIFGN-FEVTAKYKPPIL  45

Query  331  PIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA RTLREIKLLRHMD
Sbjct  46   PIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRHMD  96



>gb|ACU19570.1| unknown [Glycine max]
Length=164

 Score =   142 bits (358),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G+ +  A  +HGG+FIQYNIFGN+FEVT KY+PPIMPIG+GAYGIVCS LN+ETNE V  
Sbjct  8    GVADFAAVPTHGGQFIQYNIFGNLFEVTTKYRPPIMPIGRGAYGIVCSLLNTETNELVAV  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  68   KKIANAFDNHMDAKRTLREIKLLRHLD  94



>gb|ACJ84868.1| unknown [Medicago truncatula]
Length=330

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G+   PA  +HGG+F+QYN+FGN+FEVTAKY+PPIMPIG+GAYGIVCS LN+ETNE V  
Sbjct  8    GVAEFPAVQTHGGQFVQYNVFGNLFEVTAKYRPPIMPIGRGAYGIVCSLLNTETNELVAV  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  68   KKIANAFDNHMDAKRTLREIKLLRHLD  94



>ref|XP_003606509.1| Mitogen-activated protein kinase [Medicago truncatula]
 gb|AES88706.1| MAP kinase I [Medicago truncatula]
Length=356

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G+   PA  +HGG+F+QYN+FGN+FEVTAKY+PPIMPIG+GAYGIVCS LN+ETNE V  
Sbjct  8    GVAEFPAVQTHGGQFVQYNVFGNLFEVTAKYRPPIMPIGRGAYGIVCSLLNTETNELVAV  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  68   KKIANAFDNHMDAKRTLREIKLLRHLD  94



>emb|CAA57721.1| protein kinase [Medicago sativa]
Length=371

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G+   PA  +HGG+F+QYN+FGN+FEVTAKY+PPIMPIG+GAYGIVCS LN+ETNE V  
Sbjct  8    GVAEFPAVQTHGGQFVQYNVFGNLFEVTAKYRPPIMPIGRGAYGIVCSLLNTETNELVAV  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  68   KKIANAFDNHMDAKRTLREIKLLRHLD  94



>gb|AAF73236.1|AF153061_1 MAP kinase 3 [Pisum sativum]
Length=371

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G+   PA  +HGG+F+QYN+FGN+FEVTAKY+PPIMPIG+GAYGIVCS LN+ETNE V  
Sbjct  8    GVAEFPAVQTHGGQFVQYNVFGNLFEVTAKYRPPIMPIGRGAYGIVCSLLNTETNELVAV  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  68   KKIANAFDNHMDAKRTLREIKLLRHLD  94



>ref|XP_009596748.1| PREDICTED: mitogen-activated protein kinase 3-like [Nicotiana 
tomentosiformis]
Length=115

 Score =   138 bits (348),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + P+ L+HGG+++QY+IFGN FE+T KY+PPIMPIG+GAYGIVCS LN+E NE V  KKI
Sbjct  15   DFPSVLTHGGQYVQYDIFGNFFEITTKYRPPIMPIGRGAYGIVCSVLNTELNEMVAVKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  75   ANAFDNYMDAKRTLREIKLLRHLD  98



>ref|XP_007132166.1| hypothetical protein PHAVU_011G071400g [Phaseolus vulgaris]
 gb|ESW04160.1| hypothetical protein PHAVU_011G071400g [Phaseolus vulgaris]
Length=328

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G+ + PA  +HGG+FIQYNIFGN+FEVT KY+PPIMPIG+GAYGIVCS LN+ETNE V  
Sbjct  8    GVADFPAVPTHGGQFIQYNIFGNLFEVTTKYRPPIMPIGRGAYGIVCSLLNTETNELVAV  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLL+H+D
Sbjct  68   KKIANAFDNHMDAKRTLREIKLLKHLD  94



>gb|AAZ23129.1| mitogen-activated protein kinase 2 [Arachis hypogaea]
 gb|ABX80392.2| mitogen-activated protein kinase 3 [Arachis hypogaea]
Length=371

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G  + PA  +HGG+FIQYNIFGN+FEVTAKY+PPIMPIG+GAYGIVCS LN+ETNE V  
Sbjct  8    GAADFPAVPTHGGQFIQYNIFGNLFEVTAKYRPPIMPIGRGAYGIVCSVLNTETNELVAV  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLRE KLLRH+D
Sbjct  68   KKIANAFDNHMDAKRTLREFKLLRHLD  94



>gb|ABM67698.1| mitogen-activated protein kinase [Citrus sinensis]
Length=375

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FIQYNIFGN+FE+TAKY+PPIMPIG+GAYGIVCS LN+ETNE V  KKI
Sbjct  15   DFPAVPTHGGQFIQYNIFGNLFEITAKYRPPIMPIGRGAYGIVCSVLNTETNELVAIKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  75   ANAFDNHMDAKRTLREIKLLRHLD  98



>gb|AEV89968.1| mitogen activated protein kinase [Humulus lupulus]
Length=380

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  SHGG++IQYNIFGN+FE+T+KY+PPIMPIG+GAYGIVCS LNSETNE V  KKI
Sbjct  20   DFPAIPSHGGQYIQYNIFGNLFEITSKYRPPIMPIGRGAYGIVCSVLNSETNEMVAMKKI  79

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  80   ANAFDNHMDAKRTLREIKLLRHLD  103



>ref|XP_010032056.1| PREDICTED: mitogen-activated protein kinase 3 [Eucalyptus grandis]
 gb|KCW51443.1| hypothetical protein EUGRSUZ_J00966 [Eucalyptus grandis]
Length=373

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FIQYNIFGN FE+TAKY+PPIMPIG+GAYGIVCS LNSETNE V  KKI
Sbjct  13   DFPAVPTHGGQFIQYNIFGNHFEITAKYRPPIMPIGRGAYGIVCSVLNSETNEMVAIKKI  72

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  73   ANAFDNHMDAKRTLREIKLLRHLD  96



>ref|XP_007132165.1| hypothetical protein PHAVU_011G071400g [Phaseolus vulgaris]
 gb|ESW04159.1| hypothetical protein PHAVU_011G071400g [Phaseolus vulgaris]
Length=371

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G+ + PA  +HGG+FIQYNIFGN+FEVT KY+PPIMPIG+GAYGIVCS LN+ETNE V  
Sbjct  8    GVADFPAVPTHGGQFIQYNIFGNLFEVTTKYRPPIMPIGRGAYGIVCSLLNTETNELVAV  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLL+H+D
Sbjct  68   KKIANAFDNHMDAKRTLREIKLLKHLD  94



>gb|KJB20239.1| hypothetical protein B456_003G139900 [Gossypium raimondii]
Length=332

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  226  IDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXK  405
            + + P   +HGG+FIQYNIFGN+FEVT+KY+PPIMPIG+GAYGIVCS LNSETNE V  K
Sbjct  13   LGDFPTIHTHGGQFIQYNIFGNLFEVTSKYRPPIMPIGRGAYGIVCSVLNSETNEMVAVK  72

Query  406  KIANAFDNKIDAXRTLREIKLLRHMD  483
            KIANAFDN +DA RTLREIKLLRH+D
Sbjct  73   KIANAFDNHMDAKRTLREIKLLRHLD  98



>ref|XP_010261325.1| PREDICTED: mitogen-activated protein kinase homolog MMK2-like 
[Nelumbo nucifera]
Length=105

 Score =   137 bits (344),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  229  DNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKK  408
            +NI   L+HGGR++QYN++GN+FEV  KY PPI P+G+GAYGIVC+A+NSET E V  KK
Sbjct  13   NNIRGILTHGGRYVQYNVYGNLFEVPTKYVPPIRPVGRGAYGIVCAAVNSETREEVAIKK  72

Query  409  IANAFDNKIDAXRTLREIKLLRHMD  483
            I+NAFDN+IDA RTLREIKLLRHMD
Sbjct  73   ISNAFDNRIDAKRTLREIKLLRHMD  97



>gb|AGO61959.1| MAPK FLRS, partial [Triticum aestivum]
Length=350

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  262  RFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDA  441
            RFIQYNIFGNVFEVTAKYKPPI+PIGKGAYGIVCSALNSET E V  KKIANAFDNKIDA
Sbjct  1    RFIQYNIFGNVFEVTAKYKPPILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDA  60

Query  442  XRTLREIKLLRHMD  483
             RTLREIKLLRHMD
Sbjct  61   KRTLREIKLLRHMD  74



>ref|XP_010260161.1| PREDICTED: mitogen-activated protein kinase 3-like [Nelumbo nucifera]
Length=387

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +H GRFIQYNIFGN+FE+TAKY+PPIMPIG+GAYGIVCS +NSETNE V  KKI
Sbjct  25   DFPAFPTHDGRFIQYNIFGNLFEITAKYRPPIMPIGRGAYGIVCSVMNSETNEMVAIKKI  84

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  85   ANAFDNHMDAKRTLREIKLLRHLD  108



>ref|XP_004294685.1| PREDICTED: mitogen-activated protein kinase 3 [Fragaria vesca 
subsp. vesca]
Length=371

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G  + PA  SHGG++IQYNIFGN+FE+T KY+PPIMPIG+GAYGIVCS LNSETNE V  
Sbjct  8    GNGDFPAVPSHGGQYIQYNIFGNLFEITNKYRPPIMPIGRGAYGIVCSVLNSETNEMVAI  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  68   KKIANAFDNHMDAKRTLREIKLLRHLD  94



>gb|AJA29669.1| mitogen-activated protein kinase 9 [Gossypium hirsutum]
Length=375

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + P   +HGG+FIQYNIFGN+FEVT+KY+PPIMPIG+GAYGIVCS LNSETNE V  KKI
Sbjct  15   DFPTIHTHGGQFIQYNIFGNLFEVTSKYRPPIMPIGRGAYGIVCSVLNSETNEMVAVKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  75   ANAFDNHMDAKRTLREIKLLRHLD  98



>ref|XP_009358265.1| PREDICTED: mitogen-activated protein kinase 3 [Pyrus x bretschneideri]
Length=370

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +1

Query  217  VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  396
            VP   + PA  SHGG++IQYNIFGN+FE+T KY+PPIMPIG+GAYGIVCS LNSET E V
Sbjct  5    VPANGDFPAVPSHGGQYIQYNIFGNLFEITNKYRPPIMPIGRGAYGIVCSVLNSETKEMV  64

Query  397  TXKKIANAFDNKIDAXRTLREIKLLRHMD  483
              KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  65   AIKKIANAFDNHMDAKRTLREIKLLRHLD  93



>gb|KJB20241.1| hypothetical protein B456_003G139900 [Gossypium raimondii]
Length=375

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  226  IDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXK  405
            + + P   +HGG+FIQYNIFGN+FEVT+KY+PPIMPIG+GAYGIVCS LNSETNE V  K
Sbjct  13   LGDFPTIHTHGGQFIQYNIFGNLFEVTSKYRPPIMPIGRGAYGIVCSVLNSETNEMVAVK  72

Query  406  KIANAFDNKIDAXRTLREIKLLRHMD  483
            KIANAFDN +DA RTLREIKLLRH+D
Sbjct  73   KIANAFDNHMDAKRTLREIKLLRHLD  98



>gb|KHG08689.1| Mitogen-activated protein kinase 3 [Gossypium arboreum]
Length=375

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + P   +HGG+FIQYNIFGN+FEVT+KY+PPIMPIG+GAYGIVCS LNSETNE V  KKI
Sbjct  15   DFPTIHTHGGQFIQYNIFGNLFEVTSKYRPPIMPIGRGAYGIVCSVLNSETNEMVAVKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  75   ANAFDNHMDAKRTLREIKLLRHLD  98



>ref|XP_010253496.1| PREDICTED: mitogen-activated protein kinase 3-like [Nelumbo nucifera]
Length=387

 Score =   144 bits (362),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = +1

Query  151  MDGGSAQPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIM  330
            M G +A  AD+ MS   P         + PA  +H GRFIQYNIFGN+FE+T+KY+PPIM
Sbjct  1    MQGAAA--ADSGMSNG-PRNMNAGNPSDFPAIRTHDGRFIQYNIFGNLFEITSKYRPPIM  57

Query  331  PIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            PIG+GAYGIVCS +NSETNE V  KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  58   PIGRGAYGIVCSVMNSETNEMVAIKKIANAFDNHMDAKRTLREIKLLRHLD  108



>gb|EYU18887.1| hypothetical protein MIMGU_mgv1a008230mg [Erythranthe guttata]
Length=380

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG++IQYNIFGN+FE+T KY+PPIMPIG+GAYGIVCS LNSETNE V  KKI
Sbjct  13   DFPAAATHGGQYIQYNIFGNMFEITNKYRPPIMPIGRGAYGIVCSVLNSETNEMVAIKKI  72

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  73   ANAFDNYMDAKRTLREIKLLRHLD  96



>ref|XP_006424672.1| hypothetical protein CICLE_v10028667mg [Citrus clementina]
 gb|ESR37912.1| hypothetical protein CICLE_v10028667mg [Citrus clementina]
Length=375

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FIQYNIFGN+FE+TAKY+PPIMPIG+GAYGIVCS LN+ETNE V  KKI
Sbjct  15   DFPAVPTHGGQFIQYNIFGNLFEITAKYRPPIMPIGRGAYGIVCSVLNTETNELVAMKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLL+H+D
Sbjct  75   ANAFDNHMDAKRTLREIKLLQHLD  98



>ref|XP_002314017.1| kinase MMK4 family protein [Populus trichocarpa]
 gb|EEE87972.1| kinase MMK4 family protein [Populus trichocarpa]
Length=371

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G  + PA  +HGG+FIQYNIFGN+FE+T+KY+PPI PIG+GAYGIVCS LNSETNE V  
Sbjct  7    GNGDFPAIPTHGGQFIQYNIFGNLFEITSKYRPPITPIGRGAYGIVCSVLNSETNEMVAV  66

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN++DA RTLREIKLLRH+D
Sbjct  67   KKIANAFDNQMDAKRTLREIKLLRHLD  93



>ref|XP_007205387.1| hypothetical protein PRUPE_ppa007370mg [Prunus persica]
 ref|XP_008224929.1| PREDICTED: mitogen-activated protein kinase 3 [Prunus mume]
 gb|EMJ06586.1| hypothetical protein PRUPE_ppa007370mg [Prunus persica]
Length=370

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 2/91 (2%)
 Frame = +1

Query  211  PPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNE  390
            PP  G  + PA  SHGG++IQYNIFGN+FE+T KY+PPIMPIG+GAYGIVCS LNSET E
Sbjct  5    PPSSG--DFPAVPSHGGQYIQYNIFGNLFEITNKYRPPIMPIGRGAYGIVCSVLNSETKE  62

Query  391  HVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
             V  KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  63   MVAMKKIANAFDNHMDAKRTLREIKLLRHLD  93



>ref|XP_009416271.1| PREDICTED: mitogen-activated protein kinase 5-like [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  229  DNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKK  408
            ++ P  L+HGGR++QYNIFGN+FE+T+KY+PPIMPIG+GAYGIVCS +NSET E V  KK
Sbjct  7    NDFPVALTHGGRYLQYNIFGNLFEITSKYRPPIMPIGRGAYGIVCSVMNSETGEMVAIKK  66

Query  409  IANAFDNKIDAXRTLREIKLLRHMD  483
            IANAFDN +DA RTLREIKLLRH+D
Sbjct  67   IANAFDNHMDAKRTLREIKLLRHLD  91



>ref|XP_010689418.1| PREDICTED: mitogen-activated protein kinase 3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +1

Query  187  MSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCS  366
            MSE A  Q         P   +HGG+FIQYNIFGN+FEVT+KY+PPIMPIG+GAYGIVCS
Sbjct  1    MSEVAQNQMAAGLSPEFPTAFTHGGQFIQYNIFGNLFEVTSKYRPPIMPIGRGAYGIVCS  60

Query  367  ALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
             LNSET E V  KKIANAFDN +DA RTLREIK+LRH D
Sbjct  61   VLNSETKEMVAMKKIANAFDNYMDAKRTLREIKILRHFD  99



>gb|AAN65181.1| mitogen-activated protein kinase 3b [Petroselinum crispum]
Length=370

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  214  PVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEH  393
            P  G  + PA  +HGGRFIQYNIF N+FEVTAKY+PPIMPIG+GAYGIVCS +N+E NE 
Sbjct  4    PGDGQYDFPAIATHGGRFIQYNIFENLFEVTAKYRPPIMPIGRGAYGIVCSIMNTEANEM  63

Query  394  VTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            V  KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  64   VAIKKIANAFDNYMDAKRTLREIKLLRHLD  93



>ref|XP_003539740.1| PREDICTED: mitogen-activated protein kinase 3-like [Glycine max]
Length=371

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G+ +  A  +HGG+FIQYNIFGN+FEVT KY+PPIMPIG+GAYGIVCS LN+ETNE V  
Sbjct  8    GVADFAAVPTHGGQFIQYNIFGNLFEVTTKYRPPIMPIGRGAYGIVCSLLNTETNELVAV  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  68   KKIANAFDNHMDAKRTLREIKLLRHLD  94



>gb|KJB56017.1| hypothetical protein B456_009G104600 [Gossypium raimondii]
Length=266

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  ++GG+FIQY+IFGN+FE+T+KY+PPIMPIG+GAYGIVCS LNSETNE V  KKI
Sbjct  15   DFPAFHTYGGQFIQYSIFGNLFEITSKYRPPIMPIGRGAYGIVCSVLNSETNEMVAVKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  75   ANAFDNHMDAKRTLREIKLLRHLD  98



>gb|ABB51133.1| mitogen-activated protein kinase 2 [Rheum australe]
Length=377

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +1

Query  175  ADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYG  354
            AD  M   AP    +P   + P   ++GG+FIQYNIFGN+FEVTAKY+PPI+PIG+GAYG
Sbjct  2    ADVAMQNPAPVAGQIP---DFPTVSTYGGQFIQYNIFGNMFEVTAKYRPPILPIGRGAYG  58

Query  355  IVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            IVCS LN+ETNE +  KKIANAFDN +DA RTLREIKLLRH D
Sbjct  59   IVCSVLNTETNEMMAMKKIANAFDNYMDAKRTLREIKLLRHFD  101



>ref|NP_001275822.1| mitogen-activated protein kinase 1 [Citrus sinensis]
 gb|AFG26277.1| mitogen-activated protein kinase 1 [Citrus sinensis]
Length=375

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FIQYNIFGN+FE+TAKY+PPIMPIG+GAYGIVCS LN+ETNE V  KKI
Sbjct  15   DFPAVPTHGGQFIQYNIFGNLFEITAKYRPPIMPIGRGAYGIVCSVLNTETNELVAMKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLL+H D
Sbjct  75   ANAFDNHMDAKRTLREIKLLQHFD  98



>ref|NP_001265988.1| mitogen-activated protein kinase 3-like [Cicer arietinum]
 gb|ABF82263.1| MAP kinase [Cicer arietinum]
Length=371

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G+    A  +HGG+F+QYN+FGN+FEVTAKY+PPIMPIG+GAYGIVCS LN+ETNE V  
Sbjct  8    GVAEFVAVPTHGGQFVQYNVFGNLFEVTAKYRPPIMPIGRGAYGIVCSLLNTETNELVAV  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  68   KKIANAFDNHMDAKRTLREIKLLRHLD  94



>ref|XP_008385257.1| PREDICTED: mitogen-activated protein kinase 3 [Malus domestica]
 ref|XP_008366347.1| PREDICTED: mitogen-activated protein kinase 3 [Malus domestica]
Length=370

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +1

Query  220  PGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVT  399
            P   + PA  SHGG++IQYNIFGN+FE+T KY+PPIMPIG+GAYGIVCS LNSET E V 
Sbjct  6    PSNGDFPAVPSHGGQYIQYNIFGNLFEITNKYRPPIMPIGRGAYGIVCSVLNSETKEMVA  65

Query  400  XKKIANAFDNKIDAXRTLREIKLLRHMD  483
             KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  66   IKKIANAFDNHMDAKRTLREIKLLRHLD  93



>gb|AGI60283.1| mitogen-activated protein kinase 4 [Dendrobium catenatum]
Length=369

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 76/88 (86%), Gaps = 1/88 (1%)
 Frame = +1

Query  220  PGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVT  399
            P +D  PA L+HGGRF+QYNIFGN+FE++AKY+PPIMPIG+GAYGIVCS +NSE  E V 
Sbjct  5    PAMD-FPAVLTHGGRFLQYNIFGNLFEISAKYRPPIMPIGRGAYGIVCSVMNSENGEMVA  63

Query  400  XKKIANAFDNKIDAXRTLREIKLLRHMD  483
             KKIANAFDN +D+ RTLREIKLL+H+D
Sbjct  64   IKKIANAFDNHMDSKRTLREIKLLKHLD  91



>ref|XP_009352415.1| PREDICTED: mitogen-activated protein kinase 3-like [Pyrus x bretschneideri]
Length=370

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 6/99 (6%)
 Frame = +1

Query  187  MSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCS  366
            M++  PP        + PA  SHGG++IQYNIFGN+FE+T KY+PPIMPIG+GAYGIVCS
Sbjct  1    MADLTPPN------GDFPAVPSHGGQYIQYNIFGNLFEITNKYRPPIMPIGRGAYGIVCS  54

Query  367  ALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
             LNSET E V  KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  55   VLNSETKEMVAIKKIANAFDNHMDAKRTLREIKLLRHLD  93



>ref|XP_002284807.1| PREDICTED: mitogen-activated protein kinase 3 [Vitis vinifera]
Length=375

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  226  IDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXK  405
            + + PA  +HGG F Q+NIFGN+FE+TAKY+PPIMPIG+GAYGIVCS LNSETNE V  K
Sbjct  13   LSDFPAVPTHGGLFFQHNIFGNLFEITAKYRPPIMPIGRGAYGIVCSVLNSETNEMVAIK  72

Query  406  KIANAFDNKIDAXRTLREIKLLRHMD  483
            KIANAFDN +DA RTLREIKLLRH+D
Sbjct  73   KIANAFDNHMDAKRTLREIKLLRHLD  98



>ref|XP_011089373.1| PREDICTED: mitogen-activated protein kinase 3 [Sesamum indicum]
Length=374

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 78/99 (79%), Gaps = 5/99 (5%)
 Frame = +1

Query  187  MSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCS  366
            M  AA  Q P     + PA  +HGG +IQYNIFGN+FE+T KY+PPI+PIG+GAYGIVCS
Sbjct  4    MGAAAGGQYP-----DFPAVATHGGHYIQYNIFGNMFEITTKYRPPIIPIGRGAYGIVCS  58

Query  367  ALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
             LNSETNE V  KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  59   VLNSETNEMVAIKKIANAFDNYMDAKRTLREIKLLRHLD  97



>ref|NP_001267653.1| mitogen-activated protein kinase 3-like [Cucumis sativus]
 gb|AAZ57337.1| Trichoderma-induced protein kinase [Cucumis sativus]
 gb|ABG89857.1| NO3-stress-induced mitogen activated protein kinase [Cucumis 
sativus]
 gb|KGN65657.1| hypothetical protein Csa_1G479630 [Cucumis sativus]
Length=370

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+++QYNIFGN FE+T+KY+PPIMPIG+GAYGIVCS LNSETNE V  KKI
Sbjct  11   DFPALPTHGGQYVQYNIFGNPFEITSKYRPPIMPIGRGAYGIVCSVLNSETNEMVAVKKI  70

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  71   ANAFDNHMDAKRTLREIKLLRHLD  94



>ref|XP_002976336.1| hypothetical protein SELMODRAFT_449423 [Selaginella moellendorffii]
 ref|XP_002994058.1| hypothetical protein SELMODRAFT_449420 [Selaginella moellendorffii]
 gb|EFJ04892.1| hypothetical protein SELMODRAFT_449420 [Selaginella moellendorffii]
 gb|EFJ22596.1| hypothetical protein SELMODRAFT_449423 [Selaginella moellendorffii]
Length=374

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            N    L H GR++QYNIFGN+FEVTAKY PPI PIG+GAYGIVCSA+NSETNE V  KKI
Sbjct  11   NFTGVLVHSGRYVQYNIFGNLFEVTAKYVPPIRPIGRGAYGIVCSAVNSETNEEVAIKKI  70

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
             NAFDN+IDA RTLREIKLLRHMD
Sbjct  71   GNAFDNRIDAKRTLREIKLLRHMD  94



>ref|NP_001284376.1| mitogen-activated protein kinase 3 [Cucumis melo]
 gb|AEG89601.1| mitogen-activated protein [Cucumis melo]
Length=370

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+++QYNIFGN FE+T+KY+PPIMPIG+GAYGIVCS LNSETNE V  KKI
Sbjct  11   DFPALPTHGGQYVQYNIFGNPFEITSKYRPPIMPIGRGAYGIVCSVLNSETNEMVAVKKI  70

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  71   ANAFDNHMDAKRTLREIKLLRHLD  94



>ref|NP_001288546.1| mitogen-activated protein kinase 5 [Zea mays]
 ref|XP_008660259.1| PREDICTED: mitogen-activated protein kinase 5 isoform X1 [Zea 
mays]
 ref|XP_008660260.1| PREDICTED: mitogen-activated protein kinase 5 isoform X1 [Zea 
mays]
 gb|ACF81103.1| unknown [Zea mays]
 gb|AFW88745.1| putative MAP kinase family protein isoform 1 [Zea mays]
 gb|AFW88746.1| putative MAP kinase family protein isoform 2 [Zea mays]
Length=374

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 5/92 (5%)
 Frame = +1

Query  223  GIDNIPA-----TLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETN  387
            G+D  P      T++HGGRF+QYNIFGN+FE+T KY+PPIMPIG+GAYGIVCS +NSET 
Sbjct  5    GVDGAPVAEFRQTVTHGGRFLQYNIFGNLFEITHKYQPPIMPIGRGAYGIVCSVMNSETK  64

Query  388  EHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            E V  KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  65   EMVAIKKIANAFDNHMDAKRTLREIKLLRHLD  96



>gb|ACG38361.1| MPK3 - putative MAPK [Zea mays]
Length=374

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 5/92 (5%)
 Frame = +1

Query  223  GIDNIPA-----TLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETN  387
            G+D  P      T++HGGRF+QYNIFGN+FE+T KY+PPIMPIG+GAYGIVCS +NSET 
Sbjct  5    GVDGAPVAEFRQTVTHGGRFLQYNIFGNLFEITHKYQPPIMPIGRGAYGIVCSVMNSETK  64

Query  388  EHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            E V  KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  65   EMVAIKKIANAFDNHMDAKRTLREIKLLRHLD  96



>ref|XP_010112333.1| Mitogen-activated protein kinase 3 [Morus notabilis]
 gb|AHJ80961.1| mitogen-activated protein kinase 1 [Morus notabilis]
 gb|EXC33222.1| Mitogen-activated protein kinase 3 [Morus notabilis]
Length=379

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
              PA  S+GG++IQYNIFGN+FE+T KY+PPIMPIG+GAYGIVCS LNSETNE V  KKI
Sbjct  19   EFPAVASYGGQYIQYNIFGNLFEITNKYRPPIMPIGRGAYGIVCSVLNSETNEVVAIKKI  78

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  79   ANAFDNHMDAKRTLREIKLLRHLD  102



>emb|CAA73323.1| MAP kinase I [Petroselinum crispum]
Length=371

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FIQYNIFGN+F+VT KY+PPIMPIG+GAYGIVCS +N+ETNE V  KKI
Sbjct  11   DFPAIQTHGGQFIQYNIFGNLFQVTKKYRPPIMPIGRGAYGIVCSIMNTETNEMVAVKKI  70

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  71   ANAFDNYMDAKRTLREIKLLRHLD  94



>ref|XP_011025027.1| PREDICTED: mitogen-activated protein kinase 3-like isoform X3 
[Populus euphratica]
Length=266

 Score =   139 bits (349),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G  + PA  +HGG FIQYNIFGN FE+T+KY+PPI PIG+GAYGIVCS LNSETNE V  
Sbjct  7    GNGDFPAIPTHGGLFIQYNIFGNPFEITSKYRPPITPIGRGAYGIVCSVLNSETNEKVAI  66

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  67   KKIANAFDNYMDAKRTLREIKLLRHLD  93



>ref|XP_009406947.1| PREDICTED: mitogen-activated protein kinase 5 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  226  IDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXK  405
            ++  P  L+HGGR++QY+IFGN+FE+T+KY+PPIMPIG+GAYGIVCS +NSET + V  K
Sbjct  6    VNEFPVALTHGGRYLQYDIFGNLFEITSKYRPPIMPIGRGAYGIVCSVMNSETGDMVAIK  65

Query  406  KIANAFDNKIDAXRTLREIKLLRHMD  483
            KIANAFDN +DA RTLREIKLLRH+D
Sbjct  66   KIANAFDNHMDAKRTLREIKLLRHLD  91



>ref|XP_007016654.1| Mitogen-activated protein kinase 3 [Theobroma cacao]
 gb|EOY34273.1| Mitogen-activated protein kinase 3 [Theobroma cacao]
Length=375

 Score =   141 bits (355),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  226  IDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXK  405
            + + PA  +HGG++IQY+IFGN+F++T+KY+PPIMPIG+GAYGIVCS LNSETNE V  K
Sbjct  13   LGDFPAIHTHGGQYIQYSIFGNLFQITSKYRPPIMPIGRGAYGIVCSVLNSETNEMVAVK  72

Query  406  KIANAFDNKIDAXRTLREIKLLRHMD  483
            KIANAFDN +DA RTLREIKLLRH+D
Sbjct  73   KIANAFDNHMDAKRTLREIKLLRHLD  98



>gb|KJB56016.1| hypothetical protein B456_009G104600 [Gossypium raimondii]
Length=376

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  ++GG+FIQY+IFGN+FE+T+KY+PPIMPIG+GAYGIVCS LNSETNE V  KKI
Sbjct  15   DFPAFHTYGGQFIQYSIFGNLFEITSKYRPPIMPIGRGAYGIVCSVLNSETNEMVAVKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  75   ANAFDNHMDAKRTLREIKLLRHLD  98



>gb|KHG13782.1| Mitogen-activated protein kinase 3 [Gossypium arboreum]
Length=376

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  ++GG+FIQY+IFGN+FE+T+KY+PPIMPIG+GAYGIVCS LNSETNE V  KKI
Sbjct  15   DFPAFHTYGGQFIQYSIFGNLFEITSKYRPPIMPIGRGAYGIVCSVLNSETNEMVAVKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  75   ANAFDNHMDAKRTLREIKLLRHLD  98



>ref|XP_011007365.1| PREDICTED: mitogen-activated protein kinase 3-like [Populus euphratica]
Length=371

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G  + PA  + GGRFI+YNIFGN+FE+T+KY+PPI PIG+GAYGIVCS LNSETNE V  
Sbjct  7    GNGDFPAIPTRGGRFIRYNIFGNLFEITSKYRPPITPIGRGAYGIVCSVLNSETNEMVAV  66

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN++DA RTLREIKLLRH+D
Sbjct  67   KKIANAFDNQMDAKRTLREIKLLRHLD  93



>ref|XP_006402656.1| hypothetical protein EUTSA_v10006460mg [Eutrema salsugineum]
 gb|ESQ44109.1| hypothetical protein EUTSA_v10006460mg [Eutrema salsugineum]
Length=402

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +1

Query  154  DGGSAQPADTVMSEAAP-PQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIM  330
            D  + +  D   ++  P P P +   ++IPA  SH GR+IQYNIFG++FEVTAKYKPPIM
Sbjct  6    DAETVKSHDGDTTDELPYPSPEMLEAEHIPANPSHDGRYIQYNIFGSIFEVTAKYKPPIM  65

Query  331  PIGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
             IG+GAYGIVCSA+NSETNE V  KKI  AFDN +DA RTLREIKLLRH +
Sbjct  66   LIGRGAYGIVCSAMNSETNEKVAIKKIVYAFDNIVDAKRTLREIKLLRHFN  116



>gb|ACP31204.1| MAP kinase 1 [Solanum melongena]
Length=136

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
              P  ++HGG+++QY+IFGN FE+T KY+PPIMPIG+GAYGIVCS  N+E NE V  KKI
Sbjct  4    EFPRIVTHGGQYVQYDIFGNFFEITTKYRPPIMPIGRGAYGIVCSVFNAELNEMVAVKKI  63

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  64   ANAFDNYMDAKRTLREIKLLRHLD  87



>gb|ABO84839.1| putative MAP kinase 3 [Catharanthus roseus]
Length=372

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G  + P   +HGG+F+QY+IFGN+FE+T KY+PPIMPIG+GAYGIVCS LN ETNE V  
Sbjct  9    GFPDFPVLATHGGQFVQYDIFGNLFEITTKYRPPIMPIGRGAYGIVCSVLNVETNEMVAI  68

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  69   KKIANAFDNFMDAKRTLREIKLLRHLD  95



>ref|XP_011025026.1| PREDICTED: mitogen-activated protein kinase 3-like isoform X2 
[Populus euphratica]
Length=361

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G  + PA  +HGG FIQYNIFGN FE+T+KY+PPI PIG+GAYGIVCS LNSETNE V  
Sbjct  7    GNGDFPAIPTHGGLFIQYNIFGNPFEITSKYRPPITPIGRGAYGIVCSVLNSETNEKVAI  66

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  67   KKIANAFDNYMDAKRTLREIKLLRHLD  93



>gb|AHY02158.1| mitogen-activated protein kinase 3 [Betula platyphylla]
Length=376

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +H G+F+QYNIFGN+FE+TAKY+PPI+PIG+GAYGIVCS LNSETNE V  KKI
Sbjct  15   DFPAIPTHRGQFVQYNIFGNLFEITAKYRPPIIPIGRGAYGIVCSVLNSETNEMVAMKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH D
Sbjct  75   ANAFDNHMDAKRTLREIKLLRHFD  98



>gb|AJA29672.1| mitogen-activated protein kinase 13 [Gossypium hirsutum]
Length=376

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  ++GG+FIQY IFGN+FE+T+KY+PPIMPIG+GAYGIVCS LNSETNE V  KKI
Sbjct  15   DFPAFHTYGGQFIQYGIFGNLFEITSKYRPPIMPIGRGAYGIVCSVLNSETNEMVAVKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  75   ANAFDNHMDAKRTLREIKLLRHLD  98



>ref|XP_011025025.1| PREDICTED: mitogen-activated protein kinase 3-like isoform X1 
[Populus euphratica]
Length=370

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G  + PA  +HGG FIQYNIFGN FE+T+KY+PPI PIG+GAYGIVCS LNSETNE V  
Sbjct  7    GNGDFPAIPTHGGLFIQYNIFGNPFEITSKYRPPITPIGRGAYGIVCSVLNSETNEKVAI  66

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  67   KKIANAFDNYMDAKRTLREIKLLRHLD  93



>ref|XP_002298450.1| kinase MMK4 family protein [Populus trichocarpa]
 gb|EEE83255.1| kinase MMK4 family protein [Populus trichocarpa]
Length=370

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  220  PGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVT  399
            PG  + PA  ++GG+FIQ+NIFGN+FE+T+KY+PPI PIG+GAYGIVCS LNSETNE V 
Sbjct  6    PGNGDFPAIPTNGGQFIQHNIFGNLFEITSKYRPPITPIGRGAYGIVCSVLNSETNEKVA  65

Query  400  XKKIANAFDNKIDAXRTLREIKLLRHMD  483
             KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  66   IKKIANAFDNYMDAKRTLREIKLLRHLD  93



>gb|ADU54564.1| wound-induced mitogen-activated protein kinase [Nicotiana glutinosa]
Length=374

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + P+ L+HGG+++QY+IFGN FE+T KY+PPIMPIG+GAYGIVCS LN+E NE V  KKI
Sbjct  14   DFPSVLTHGGQYVQYDIFGNFFEITTKYRPPIMPIGRGAYGIVCSVLNTELNEMVAVKKI  73

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  74   ANAFDNYMDAKRTLREIKLLRHLD  97



>gb|KDP44133.1| hypothetical protein JCGZ_05600 [Jatropha curcas]
Length=372

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + P   +H G+F+QYNIFGN+FE+T+KY+PPIMPIG+GAYGIVCS LNSETNE V  KKI
Sbjct  12   DFPVIPTHCGQFVQYNIFGNLFEITSKYRPPIMPIGRGAYGIVCSVLNSETNEMVAVKKI  71

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  72   ANAFDNHMDAKRTLREIKLLRHLD  95



>dbj|BAC53771.1| wound-inuduced protein kinase [Nicotiana benthamiana]
Length=376

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + P+ L+HGG+++QY+IFGN FE+T KY+PPIMPIG+GAYGIVCS LN+E NE V  KKI
Sbjct  16   DFPSVLTHGGQYVQYDIFGNFFEITTKYRPPIMPIGRGAYGIVCSVLNTELNEMVAVKKI  75

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  76   ANAFDNYMDAKRTLREIKLLRHLD  99



>ref|XP_008792346.1| PREDICTED: mitogen-activated protein kinase 5 [Phoenix dactylifera]
Length=369

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  229  DNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKK  408
            +  P  ++HGGR++QYNIF N+FE+TAKY+PP+MPIG+GAYGIVCS +NSET E V  KK
Sbjct  7    NEFPVVVTHGGRYLQYNIFNNLFEITAKYQPPVMPIGRGAYGIVCSVMNSETGEMVAIKK  66

Query  409  IANAFDNKIDAXRTLREIKLLRHMD  483
            IANAFDN +DA RTLREIKLLRH+D
Sbjct  67   IANAFDNHMDAKRTLREIKLLRHLD  91



>gb|ABJ89813.1| wound-induced protein kinase [Nicotiana attenuata]
Length=375

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + P+ L+HGG+++QY+IFGN FE+T KY+PPIMPIG+GAYGIVCS LN+E NE V  KKI
Sbjct  15   DFPSVLTHGGQYVQYDIFGNFFEITTKYRPPIMPIGRGAYGIVCSVLNTELNEMVAVKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  75   ANAFDNYMDAKRTLREIKLLRHLD  98



>ref|XP_008358164.1| PREDICTED: mitogen-activated protein kinase 3-like [Malus domestica]
Length=370

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +1

Query  217  VPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHV  396
            VP   +  A  SHGG++IQYNIFGN+FE+T KY+PPIMPIG+GAYGI+CS LNSET E V
Sbjct  5    VPTNGDFAAVPSHGGQYIQYNIFGNLFEITNKYRPPIMPIGRGAYGILCSVLNSETKEMV  64

Query  397  TXKKIANAFDNKIDAXRTLREIKLLRHMD  483
              KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  65   AIKKIANAFDNHMDAKRTLREIKLLRHLD  93



>ref|XP_009802373.1| PREDICTED: mitogen-activated protein kinase 3 [Nicotiana sylvestris]
 dbj|BAB79636.1| wound induced protein kinase [Nicotiana tabacum]
Length=375

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + P+ L+HGG+++QY+IFGN FE+T KY+PPIMPIG+GAYGIVCS LN+E NE V  KKI
Sbjct  15   DFPSVLTHGGQYVQYDIFGNFFEITTKYRPPIMPIGRGAYGIVCSVLNTELNEMVAVKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  75   ANAFDNYMDAKRTLREIKLLRHLD  98



>ref|XP_010920941.1| PREDICTED: mitogen-activated protein kinase 5 [Elaeis guineensis]
Length=369

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
              P   +HGGR++QYNIF N+FE+TAKY+PPIMPIG+GAYGIVCS +NSET E V  KKI
Sbjct  8    EFPVVATHGGRYLQYNIFNNLFEITAKYQPPIMPIGRGAYGIVCSVMNSETGEMVAIKKI  67

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  68   ANAFDNHMDAKRTLREIKLLRHLD  91



>gb|AEX49899.1| mitogen-activated protein kinase 4 [Saccharum hybrid cultivar 
ROC22]
Length=375

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 75/92 (82%), Gaps = 5/92 (5%)
 Frame = +1

Query  223  GIDNIPA-----TLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETN  387
            G+D  P      T++HGGRF+QYNIFGN+FE+T KY+PPIMPIG+GAYGIVCS +N ET 
Sbjct  5    GMDGAPVAEFRPTVTHGGRFLQYNIFGNLFEITHKYQPPIMPIGRGAYGIVCSVMNFETR  64

Query  388  EHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            E V  KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  65   EMVAIKKIANAFDNHMDAKRTLREIKLLRHLD  96



>emb|CDX99153.1| BnaA06g18440D [Brassica napus]
Length=333

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FEVT+KY+PPI+PIG+GAYGIVCS L+SETNE V  KKI
Sbjct  10   DFPAVQTHGGQFISYDIFGSLFEVTSKYRPPIVPIGRGAYGIVCSVLDSETNELVAMKKI  69

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  70   ANAFDNHMDAKRTLREIKLLRHLD  93



>gb|KDO76322.1| hypothetical protein CISIN_1g017083mg [Citrus sinensis]
Length=260

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +1

Query  187  MSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCS  366
            M+ AA          ++   L+HGG+++QYN++GN+FEV++KY PPI PIG+GAYGIVC+
Sbjct  1    MAAAAKDSSSGGATSSVKGVLTHGGKYVQYNVYGNLFEVSSKYVPPIRPIGRGAYGIVCA  60

Query  367  ALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            A+NSET E V  KKI NAFDN IDA RTLREIKLLRHM+
Sbjct  61   AVNSETREEVAIKKIGNAFDNIIDARRTLREIKLLRHME  99



>ref|XP_006828349.1| hypothetical protein AMTR_s00023p00249950 [Amborella trichopoda]
 gb|ERM95765.1| hypothetical protein AMTR_s00023p00249950 [Amborella trichopoda]
Length=377

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +1

Query  235  IPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIA  414
             PA  +HGGRF++Y+IFGN FE+T+KY PP++PIG+GAYG++CSALNS TNEHV  KKIA
Sbjct  16   FPAIPTHGGRFVEYDIFGNRFEITSKYSPPLIPIGRGAYGLICSALNSVTNEHVAIKKIA  75

Query  415  NAFDNKIDAXRTLREIKLLRHMD  483
             AFDN+IDA RTLREIKLLRH+D
Sbjct  76   RAFDNRIDAKRTLREIKLLRHID  98



>gb|AAW65993.1| mitogen-activated protein kinase [Saccharum hybrid cultivar SP80-3280]
Length=370

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  244  TLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAF  423
            T++HGGRF+QYNIFGN+FE+T KY+PPIMPIG+GAYGIVCS +N ET E V  KKIANAF
Sbjct  12   TVTHGGRFLQYNIFGNLFEITHKYQPPIMPIGRGAYGIVCSVMNFETREMVAIKKIANAF  71

Query  424  DNKIDAXRTLREIKLLRHMD  483
            DN +DA RTLREIKLLRH+D
Sbjct  72   DNHMDAKRTLREIKLLRHLD  91



>gb|ADI52626.1| mitogen-activated protein kinase 3 [Gossypium hirsutum]
Length=376

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  ++GG+FIQY+IFGN+FE+T+KY+PPI PIG+GAYGIVCS LNSETNE V  KKI
Sbjct  15   DFPAFHTYGGQFIQYSIFGNLFEITSKYRPPITPIGRGAYGIVCSVLNSETNEMVAVKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  75   ANAFDNHMDAKRTLREIKLLRHLD  98



>ref|XP_009150063.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
3 [Brassica rapa]
Length=370

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FEVT+KY+PPI+PIG+GAYGIVCS L+SETNE V  KKI
Sbjct  10   DFPAVQTHGGQFISYDIFGSLFEVTSKYRPPIVPIGRGAYGIVCSVLDSETNELVAMKKI  69

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  70   ANAFDNHMDAKRTLREIKLLRHLD  93



>gb|AAV34677.1| mitogen-activated protein kinase 3 [Brassica napus]
Length=370

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FEVT+KY+PPI+PIG+GAYGIVCS L+SETNE V  KKI
Sbjct  10   DFPAVQTHGGQFISYDIFGSLFEVTSKYRPPIVPIGRGAYGIVCSVLDSETNELVAMKKI  69

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  70   ANAFDNHMDAKRTLREIKLLRHLD  93



>emb|CDX86029.1| BnaC03g55440D [Brassica napus]
Length=370

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FEVT+KY+PPI+PIG+GAYGIVCS L+SETNE V  KKI
Sbjct  10   DFPAVQTHGGQFISYDIFGSLFEVTSKYRPPIVPIGRGAYGIVCSVLDSETNELVAMKKI  69

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  70   ANAFDNHMDAKRTLREIKLLRHLD  93



>gb|AGA37186.1| mitogen-activated protein kinase 3.1 [Brassica napus]
Length=370

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FEVT+KY+PPI+PIG+GAYGIVCS L+SETNE V  KKI
Sbjct  10   DFPAVQTHGGQFISYDIFGSLFEVTSKYRPPIVPIGRGAYGIVCSVLDSETNELVAMKKI  69

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  70   ANAFDNHMDAKRTLREIKLLRHLD  93



>ref|XP_002876524.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52783.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=393

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +1

Query  154  DGGSAQPADTVMSEAAPPQPPVPGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMP  333
            D  + +    V +   P    +   +++P TLSH GR+IQYN+FG++FE+TAKYKPPIMP
Sbjct  6    DAETVETQGEVTTALLPSSQMLKTTNDVPETLSHDGRYIQYNLFGHIFELTAKYKPPIMP  65

Query  334  IGKGAYGIVCSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
            IG+GA GIVCSA++SETNE V  KKI + FDN I+A R LREIKLLRH D
Sbjct  66   IGRGACGIVCSAMDSETNEKVAIKKIMHVFDNTIEAKRILREIKLLRHFD  115



>gb|AAV68711.1| mitogen-activated protein kinase 3 [Chorispora bungeana]
Length=369

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FE+T+KY+PPI+PIG+GAYGIVCS L+SETNE V  KKI
Sbjct  9    DFPAVQTHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDSETNELVAMKKI  68

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  69   ANAFDNHMDAKRTLREIKLLRHLD  92



>gb|EPS57900.1| mitogen-activated protein kinase, partial [Genlisea aurea]
Length=362

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG++ QY+I+GN FE+TAKY+PPIMPIG+GAYG+VC+ LNSETNE V  KKI
Sbjct  4    DFPAKATHGGKYTQYDIYGNTFEITAKYRPPIMPIGRGAYGLVCAVLNSETNEMVAVKKI  63

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            +NAF+N IDA RTLREIKL+RH+D
Sbjct  64   SNAFENYIDAKRTLREIKLMRHLD  87



>ref|XP_010276898.1| PREDICTED: mitogen-activated protein kinase homolog MMK2 [Nelumbo 
nucifera]
Length=373

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  229  DNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKK  408
            +N+   L+HGGR++QYN++GN+FEV+ KY PPI P+G+GAYGIVC+A+NSET E V  KK
Sbjct  11   NNMRGVLTHGGRYVQYNVYGNLFEVSTKYVPPIRPVGRGAYGIVCAAVNSETREEVAIKK  70

Query  409  IANAFDNKIDAXRTLREIKLLRHMD  483
            I NAFDN+IDA RTLREIKLLRHMD
Sbjct  71   IGNAFDNRIDAKRTLREIKLLRHMD  95



>gb|AAC28850.1| MAP kinase homolog [Triticum aestivum]
Length=369

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +1

Query  244  TLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAF  423
            T++HGGRF+ YNIFGN FE+TAKY+PPIMPIG+GAYGIVCS +N ET E V  KKIANAF
Sbjct  12   TMTHGGRFLLYNIFGNQFEITAKYQPPIMPIGRGAYGIVCSVMNFETREMVASKKIANAF  71

Query  424  DNKIDAXRTLREIKLLRHMD  483
            DN +DA RTLREIKLLRH+D
Sbjct  72   DNNMDAKRTLREIKLLRHLD  91



>ref|NP_001105599.1| LOC542594 [Zea mays]
 dbj|BAA74733.1| MAP kinase 4 [Zea mays]
Length=406

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  220  PGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVT  399
            P +     T++HGGRF++YNIFGN+FE+T KY+PP+MPIG+GAYGIVCS +N ET E V 
Sbjct  11   PPVAEFQPTVTHGGRFLRYNIFGNLFEITRKYQPPVMPIGRGAYGIVCSVMNFETREMVA  70

Query  400  XKKIANAFDNKIDAXRTLREIKLLRHMD  483
             KKIANAFDN +DA RTLREIKLLRH+D
Sbjct  71   IKKIANAFDNHMDAKRTLREIKLLRHLD  98



>gb|ACJ84655.1| unknown [Medicago truncatula]
Length=247

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  229  DNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKK  408
            +NI    +HGGR++QYNI+GN+FEV+ KY PPI P+G+GAYGIVC+A+N+ET E V  KK
Sbjct  8    NNIRGIPTHGGRYLQYNIYGNLFEVSRKYVPPIRPVGRGAYGIVCAAVNAETREEVAIKK  67

Query  409  IANAFDNKIDAXRTLREIKLLRHMD  483
            I NAFDN+IDA RTLREIKLLRHMD
Sbjct  68   IGNAFDNRIDAKRTLREIKLLRHMD  92



>gb|AGV52329.1| MAPK3 [Brassica juncea]
Length=370

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FE+T+KY+PPI+PIG+GAYGIVCS L+SETNE V  KKI
Sbjct  10   DFPAVQTHGGQFISYDIFGSLFEITSKYRPPIVPIGRGAYGIVCSVLDSETNELVAMKKI  69

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  70   ANAFDNHMDAKRTLREIKLLRHLD  93



>ref|XP_006419018.1| hypothetical protein EUTSA_v10002582mg [Eutrema salsugineum]
 gb|ESQ37454.1| hypothetical protein EUTSA_v10002582mg [Eutrema salsugineum]
Length=337

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FE+T+KY+PPI+PIG+GAYGIVCS L+SETNE V  KKI
Sbjct  9    DFPAVPTHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDSETNELVAMKKI  68

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  69   ANAFDNHMDAKRTLREIKLLRHLD  92



>ref|XP_010425992.1| PREDICTED: mitogen-activated protein kinase 3-like [Camelina 
sativa]
Length=370

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FE+T+KY+PPI+PIG+GAYGIVCS L+SETNE V  KKI
Sbjct  10   DFPAVETHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDSETNELVAMKKI  69

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  70   ANAFDNHMDAKRTLREIKLLRHLD  93



>ref|NP_001266826.1| uncharacterized protein LOC100837420 [Brachypodium distachyon]
 gb|AFS18260.1| MPK3 [Brachypodium distachyon]
Length=369

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +1

Query  244  TLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAF  423
            T++HGGRF+ YNIFGN FE+TAKY+PPIMPIG+GAYGIVCS +N ET E V  KKIANAF
Sbjct  12   TMTHGGRFLLYNIFGNQFEITAKYQPPIMPIGRGAYGIVCSVMNFETREMVAIKKIANAF  71

Query  424  DNKIDAXRTLREIKLLRHMD  483
            DN +DA RTLREIKLLRH+D
Sbjct  72   DNNMDAKRTLREIKLLRHLD  91



>gb|ABY85198.2| mitogen activated protein kinase 1 [Datura metel]
Length=375

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + P  ++HGG+++QY+IFGN+FE+T KY+PPIMPIG+GAYGIVCS  N+E NE V  KKI
Sbjct  15   DFPKVVTHGGQYVQYDIFGNLFEITTKYRPPIMPIGRGAYGIVCSVFNAELNEMVAVKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  75   ANAFDNYMDAKRTLREIKLLRHLD  98



>gb|ABS11090.1| MAP kinase [Triticum aestivum]
Length=369

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +1

Query  244  TLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAF  423
            T++HGGRF+ YNIFGN FE+TAKY+PPIMPIG+GAYGIVCS +N ET E V  KKIANAF
Sbjct  12   TMTHGGRFLLYNIFGNQFEITAKYQPPIMPIGRGAYGIVCSVMNFETREMVAIKKIANAF  71

Query  424  DNKIDAXRTLREIKLLRHMD  483
            DN +DA RTLREIKLLRH+D
Sbjct  72   DNNMDAKRTLREIKLLRHLD  91



>gb|AAP22124.1| wound-induced protein kinase [Humulus lupulus]
Length=267

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + P+ L+HGG+++Q++IFGN FE+T KY+PPIMPIG+GAYGIVCS LN+E NE V  KKI
Sbjct  15   DFPSVLTHGGQYVQFDIFGNFFEITTKYRPPIMPIGRGAYGIVCSVLNTELNEMVAVKKI  74

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFD  +DA RTLREIKLLRH+D
Sbjct  75   ANAFDIYMDAKRTLREIKLLRHLD  98



>gb|ACH63244.1| mitogen activated protein kinase [Rheum australe]
Length=378

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 78/101 (77%), Gaps = 2/101 (2%)
 Frame = +1

Query  187  MSEAAPPQPP-VPG-IDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIV  360
            M++ A   PP V G   + P+  ++ G FIQYNIFGN FEVTAKY+PPIMPIG+GAYGIV
Sbjct  1    MADVAAQNPPAVYGQFPDFPSAFTYQGGFIQYNIFGNKFEVTAKYRPPIMPIGRGAYGIV  60

Query  361  CSALNSETNEHVTXKKIANAFDNKIDAXRTLREIKLLRHMD  483
             S LNSETNE V  KKIANAFDN +DA RTLREIKLLRH D
Sbjct  61   WSVLNSETNEMVAMKKIANAFDNYMDAKRTLREIKLLRHFD  101



>ref|XP_010514890.1| PREDICTED: mitogen-activated protein kinase 3-like [Camelina 
sativa]
Length=370

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FE+T+KY+PPI+PIG+GAYGIVCS L+SETNE V  KKI
Sbjct  10   DFPAVETHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDSETNELVAMKKI  69

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  70   ANAFDNHMDAKRTLREIKLLRHLD  93



>ref|XP_006419019.1| hypothetical protein EUTSA_v10002582mg [Eutrema salsugineum]
 gb|ESQ37455.1| hypothetical protein EUTSA_v10002582mg [Eutrema salsugineum]
Length=369

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FE+T+KY+PPI+PIG+GAYGIVCS L+SETNE V  KKI
Sbjct  9    DFPAVPTHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDSETNELVAMKKI  68

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  69   ANAFDNHMDAKRTLREIKLLRHLD  92



>ref|XP_004984821.1| PREDICTED: mitogen-activated protein kinase 5-like isoform X2 
[Setaria italica]
Length=375

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  220  PGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVT  399
            P +     T++HGGRF+QYNIFGN+FE+T KY+PPIMPIG+GAYGIVCS +N ET E V 
Sbjct  10   PPVAEFRPTVTHGGRFLQYNIFGNLFEITNKYQPPIMPIGRGAYGIVCSVMNFETREMVA  69

Query  400  XKKIANAFDNKIDAXRTLREIKLLRHMD  483
             KKIA+AFDN +DA RTLREIKLLRH+D
Sbjct  70   IKKIASAFDNHMDAKRTLREIKLLRHLD  97



>gb|ACF83548.1| unknown [Zea mays]
 tpg|DAA44799.1| TPA: putative MAP kinase family protein [Zea mays]
Length=376

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  220  PGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVT  399
            P +     T++HGGRF++YNIFGN+FE+T KY+PP+MPIG+GAYGIVCS +N ET E V 
Sbjct  11   PPVAEFQPTVTHGGRFLRYNIFGNLFEITRKYQPPVMPIGRGAYGIVCSVMNFETREMVA  70

Query  400  XKKIANAFDNKIDAXRTLREIKLLRHMD  483
             KKIANAFDN +DA RTLREIKL+RH+D
Sbjct  71   IKKIANAFDNHMDAKRTLREIKLMRHLD  98



>gb|KHN26933.1| Mitogen-activated protein kinase like MMK2 [Glycine soja]
Length=373

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  229  DNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKK  408
            DNI    +HGGR++QYNI+GN+FEV+ KY PPI P+G+GAYGIVC+A+N+ET E V  KK
Sbjct  10   DNIRGVPTHGGRYVQYNIYGNLFEVSRKYVPPIRPVGRGAYGIVCAAVNAETGEEVAIKK  69

Query  409  IANAFDNKIDAXRTLREIKLLRHMD  483
            I NAFDN+IDA RTLREIKLLRHMD
Sbjct  70   IGNAFDNRIDAKRTLREIKLLRHMD  94



>ref|XP_010535564.1| PREDICTED: mitogen-activated protein kinase 3 [Tarenaya hassleriana]
Length=372

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +H GRFI+Y+IFG++FE+T+KY PPI+PIG+GAYGIVCS LNSETNE V  KKI
Sbjct  12   DFPAIQTHDGRFIRYDIFGSLFEITSKYLPPIIPIGRGAYGIVCSVLNSETNELVAMKKI  71

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  72   ANAFDNHMDAKRTLREIKLLRHLD  95



>ref|XP_010503182.1| PREDICTED: mitogen-activated protein kinase 3 [Camelina sativa]
Length=370

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FE+T+KY+PPI+PIG+GAYGIVCS L+SETNE V  KKI
Sbjct  10   DFPAVETHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDSETNELVAMKKI  69

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  70   ANAFDNHMDAKRTLREIKLLRHID  93



>ref|XP_004984820.1| PREDICTED: mitogen-activated protein kinase 5-like isoform X1 
[Setaria italica]
Length=406

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  220  PGIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVT  399
            P +     T++HGGRF+QYNIFGN+FE+T KY+PPIMPIG+GAYGIVCS +N ET E V 
Sbjct  10   PPVAEFRPTVTHGGRFLQYNIFGNLFEITNKYQPPIMPIGRGAYGIVCSVMNFETREMVA  69

Query  400  XKKIANAFDNKIDAXRTLREIKLLRHMD  483
             KKIA+AFDN +DA RTLREIKLLRH+D
Sbjct  70   IKKIASAFDNHMDAKRTLREIKLLRHLD  97



>ref|XP_004492784.1| PREDICTED: mitogen-activated protein kinase homolog MMK2-like 
[Cicer arietinum]
Length=372

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  229  DNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKK  408
            +NI    +HGGR+IQYNI+GN+FEV+ KY PPI P+G+GAYGIVC+A+N+ET E V  KK
Sbjct  9    NNIKGVFTHGGRYIQYNIYGNLFEVSNKYVPPIRPVGRGAYGIVCAAVNAETREEVAIKK  68

Query  409  IANAFDNKIDAXRTLREIKLLRHMD  483
            I NAFDN+IDA RTLREIKLLRHMD
Sbjct  69   IGNAFDNRIDAKRTLREIKLLRHMD  93



>ref|XP_006291331.1| hypothetical protein CARUB_v10017466mg [Capsella rubella]
 gb|EOA24229.1| hypothetical protein CARUB_v10017466mg [Capsella rubella]
Length=370

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FE+T+KY+PPI+PIG+GAYGIVCS L++ETNE V  KKI
Sbjct  10   DFPAVETHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDTETNELVAMKKI  69

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  70   ANAFDNHMDAKRTLREIKLLRHLD  93



>ref|NP_190150.1| mitogen-activated protein kinase 3 [Arabidopsis thaliana]
 sp|Q39023.2|MPK3_ARATH RecName: Full=Mitogen-activated protein kinase 3; Short=AtMPK3; 
Short=MAP kinase 3 [Arabidopsis thaliana]
 gb|AAK62406.1|AF386961_1 mitogen-activated protein kinase 3 [Arabidopsis thaliana]
 emb|CAB75493.1| mitogen-activated protein kinase 3 [Arabidopsis thaliana]
 gb|AAN15326.1| mitogen-activated protein kinase 3 [Arabidopsis thaliana]
 dbj|BAE98771.1| mitogen-activated protein kinase 3 [Arabidopsis thaliana]
 gb|AEE78054.1| mitogen-activated protein kinase 3 [Arabidopsis thaliana]
Length=370

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FE+T+KY+PPI+PIG+GAYGIVCS L++ETNE V  KKI
Sbjct  10   DFPAVETHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDTETNELVAMKKI  69

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  70   ANAFDNHMDAKRTLREIKLLRHLD  93



>ref|XP_003633959.1| PREDICTED: mitogen-activated protein kinase homolog MMK2 [Vitis 
vinifera]
 emb|CAN75543.1| hypothetical protein VITISV_000466 [Vitis vinifera]
 emb|CBI40425.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            NI    +HGGR++QYN++GN+FEV+ KY PPI P+G+GAYGIVC+A+NSET E V  KKI
Sbjct  13   NIRGVSTHGGRYVQYNVYGNLFEVSRKYVPPIRPVGRGAYGIVCAAMNSETREEVAIKKI  72

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
             NAFDN+IDA RTLREIKLLRHMD
Sbjct  73   GNAFDNRIDAKRTLREIKLLRHMD  96



>ref|XP_002875737.1| mitogen-activated protein kinase 3 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51996.1| mitogen-activated protein kinase 3 [Arabidopsis lyrata subsp. 
lyrata]
Length=370

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FE+T+KY+PPI+PIG+GAYGIVCS L++ETNE V  KKI
Sbjct  10   DFPAVETHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDTETNELVAMKKI  69

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  70   ANAFDNHMDAKRTLREIKLLRHLD  93



>emb|CAA56314.1| MAP KINASE [Avena sativa]
Length=369

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +1

Query  244  TLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIANAF  423
            T++HGGRF+ YNIFGN FE+T+KY+PPIMPIG+GAYGIVCS +N ET E V  KKIANAF
Sbjct  12   TMTHGGRFLLYNIFGNQFEITSKYQPPIMPIGRGAYGIVCSVMNFETREMVAIKKIANAF  71

Query  424  DNKIDAXRTLREIKLLRHMD  483
            DN +DA RTLREIKLLRH+D
Sbjct  72   DNNMDAKRTLREIKLLRHLD  91



>ref|XP_007040337.1| MAP kinase 4 [Theobroma cacao]
 gb|EOY24838.1| MAP kinase 4 [Theobroma cacao]
Length=374

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            NI    +HGG+++QYN++GN+FEV++KY PPI PIG+GAYGIVC+A+NSET E V  KKI
Sbjct  13   NIKGVPTHGGKYVQYNVYGNLFEVSSKYVPPIRPIGRGAYGIVCAAVNSETREEVAIKKI  72

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
             NAFDN+IDA RTLREIKLLRHMD
Sbjct  73   GNAFDNRIDAKRTLREIKLLRHMD  96



>gb|KFK33939.1| hypothetical protein AALP_AA5G081200 [Arabis alpina]
Length=369

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FE+T+KY+PPI+PIG+GAYGIVCS L+SETNE V  KKI
Sbjct  9    DFPAVQTHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDSETNELVAMKKI  68

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH++
Sbjct  69   ANAFDNHMDAKRTLREIKLLRHLE  92



>emb|CDP20377.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            NI    +HGGR++QYNI+GN+FEV+ KY PPI P+G+GAYGIVC+A+NSET E V  KKI
Sbjct  17   NIRGVPTHGGRYVQYNIYGNLFEVSRKYVPPIRPVGRGAYGIVCAAMNSETREEVAIKKI  76

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
             NAFDN+IDA RTLREIKLLRHMD
Sbjct  77   GNAFDNRIDAKRTLREIKLLRHMD  100



>ref|XP_006385774.1| hypothetical protein POPTR_0003s13170g [Populus trichocarpa]
 gb|ERP63571.1| hypothetical protein POPTR_0003s13170g [Populus trichocarpa]
Length=322

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  235  IPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKIA  414
            I   L+HGGR++QYN++GN+FEV++KY PPI PIG+GAYGIVC+A+NS+T+E V  KKI 
Sbjct  30   IKGVLTHGGRYVQYNVYGNLFEVSSKYVPPIRPIGRGAYGIVCAAVNSDTHEEVAIKKIG  89

Query  415  NAFDNKIDAXRTLREIKLLRHMD  483
            NAFDN+IDA RTLREI LLRHMD
Sbjct  90   NAFDNRIDAKRTLREIMLLRHMD  112



>dbj|BAA04866.1| MAP kinase [Arabidopsis thaliana]
Length=370

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            + PA  +HGG+FI Y+IFG++FE+T+KY+PPI+PIG+GAYGIVCS L++ETNE V  KKI
Sbjct  10   DFPAVDTHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDTETNELVAMKKI  69

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
            ANAFDN +DA RTLREIKLLRH+D
Sbjct  70   ANAFDNHMDAKRTLREIKLLRHLD  93



>gb|KDP28586.1| hypothetical protein JCGZ_14357 [Jatropha curcas]
Length=370

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            NI    +HGGR++QYN++GN+FEV+ KY PPI P+G+GAYGIVC+A+NSET E V  KKI
Sbjct  11   NIRGIPTHGGRYVQYNVYGNLFEVSRKYSPPIRPVGRGAYGIVCAAVNSETREEVAIKKI  70

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
             NAFDN+IDA RTLREIKLLRHMD
Sbjct  71   GNAFDNRIDAKRTLREIKLLRHMD  94



>ref|XP_010934936.1| PREDICTED: mitogen-activated protein kinase 2 isoform X1 [Elaeis 
guineensis]
Length=372

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +1

Query  223  GIDNIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTX  402
            G  +I    +HGGR++QYN++GN+FEVT+KY PPI P+G+GAYGIVC+A+NS+T E V  
Sbjct  8    GEGHIKGVPTHGGRYVQYNVYGNLFEVTSKYVPPIRPVGRGAYGIVCAAMNSQTREEVAI  67

Query  403  KKIANAFDNKIDAXRTLREIKLLRHMD  483
            KKI NAFDN+IDA RTLREIKLLRHMD
Sbjct  68   KKIGNAFDNRIDAKRTLREIKLLRHMD  94



>ref|XP_002278860.1| PREDICTED: mitogen-activated protein kinase homolog MMK2 [Vitis 
vinifera]
 emb|CBI34380.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  232  NIPATLSHGGRFIQYNIFGNVFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVTXKKI  411
            NI    +HGGR+++YN++GN FEV+AKY PPI P+G+GAYGIVC+A+NSET+E V  KKI
Sbjct  14   NIKGVPTHGGRYVRYNVYGNFFEVSAKYVPPIRPVGRGAYGIVCAAVNSETHEEVAIKKI  73

Query  412  ANAFDNKIDAXRTLREIKLLRHMD  483
             NAFDN+IDA RTLREIKLLRHMD
Sbjct  74   GNAFDNRIDAKRTLREIKLLRHMD  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562360051550