BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF007A22

Length=292
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011085741.1|  PREDICTED: pentatricopeptide repeat-containi...    153   1e-41   Sesamum indicum [beniseed]
ref|XP_009592903.1|  PREDICTED: pentatricopeptide repeat-containi...    150   1e-40   Nicotiana tomentosiformis
ref|XP_009774058.1|  PREDICTED: pentatricopeptide repeat-containi...    150   2e-40   Nicotiana sylvestris
ref|XP_006347992.1|  PREDICTED: pentatricopeptide repeat-containi...    145   6e-39   Solanum tuberosum [potatoes]
ref|XP_004229730.1|  PREDICTED: pentatricopeptide repeat-containi...    145   7e-39   Solanum lycopersicum
gb|EYU40343.1|  hypothetical protein MIMGU_mgv1a004109mg                145   9e-39   Erythranthe guttata [common monkey flower]
emb|CDP09418.1|  unnamed protein product                                140   4e-37   Coffea canephora [robusta coffee]
gb|KHG14992.1|  hypothetical protein F383_17735                         139   1e-36   Gossypium arboreum [tree cotton]
ref|XP_007218971.1|  hypothetical protein PRUPE_ppa003822mg             138   4e-36   Prunus persica
ref|XP_008232381.1|  PREDICTED: pentatricopeptide repeat-containi...    138   4e-36   Prunus mume [ume]
ref|XP_010052788.1|  PREDICTED: pentatricopeptide repeat-containi...    137   5e-36   Eucalyptus grandis [rose gum]
ref|XP_009338668.1|  PREDICTED: pentatricopeptide repeat-containi...    137   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_006445447.1|  hypothetical protein CICLE_v10019658mg             136   2e-35   Citrus clementina [clementine]
ref|XP_008343713.1|  PREDICTED: pentatricopeptide repeat-containi...    136   2e-35   
gb|KJB22842.1|  hypothetical protein B456_004G069400                    136   2e-35   Gossypium raimondii
ref|XP_011017395.1|  PREDICTED: pentatricopeptide repeat-containi...    135   2e-35   Populus euphratica
ref|XP_006418504.1|  hypothetical protein EUTSA_v10007383mg             135   2e-35   Eutrema salsugineum [saltwater cress]
ref|XP_002301239.2|  pentatricopeptide repeat-containing family p...    135   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010496689.1|  PREDICTED: pentatricopeptide repeat-containi...    134   5e-35   
ref|XP_010496474.1|  PREDICTED: pentatricopeptide repeat-containi...    134   6e-35   
ref|XP_006375170.1|  pentatricopeptide repeat-containing family p...    134   6e-35   
ref|XP_011032472.1|  PREDICTED: pentatricopeptide repeat-containi...    134   7e-35   Populus euphratica
ref|XP_010479321.1|  PREDICTED: pentatricopeptide repeat-containi...    134   7e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009119759.1|  PREDICTED: pentatricopeptide repeat-containi...    134   7e-35   Brassica rapa
emb|CDX90079.1|  BnaA10g00030D                                          134   7e-35   
gb|EPS66397.1|  hypothetical protein M569_08380                         134   8e-35   Genlisea aurea
ref|XP_006306047.1|  hypothetical protein CARUB_v10011354mg             134   9e-35   Capsella rubella
ref|XP_002892022.1|  pentatricopeptide repeat-containing protein        134   9e-35   Arabidopsis lyrata subsp. lyrata
gb|KDP28877.1|  hypothetical protein JCGZ_14648                         134   1e-34   Jatropha curcas
ref|XP_010692029.1|  PREDICTED: pentatricopeptide repeat-containi...    134   1e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008344410.1|  PREDICTED: pentatricopeptide repeat-containi...    134   1e-34   
ref|XP_004307244.1|  PREDICTED: pentatricopeptide repeat-containi...    134   1e-34   Fragaria vesca subsp. vesca
emb|CDY15126.1|  BnaC05g00050D                                          133   2e-34   Brassica napus [oilseed rape]
ref|XP_008343643.1|  PREDICTED: pentatricopeptide repeat-containi...    132   2e-34   
ref|XP_007052357.1|  Tetratricopeptide repeat (TPR)-like superfam...    133   2e-34   
ref|XP_008343638.1|  PREDICTED: pentatricopeptide repeat-containi...    132   3e-34   Malus domestica [apple tree]
ref|XP_009375366.1|  PREDICTED: pentatricopeptide repeat-containi...    132   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_010246096.1|  PREDICTED: pentatricopeptide repeat-containi...    132   4e-34   Nelumbo nucifera [Indian lotus]
ref|XP_004133941.1|  PREDICTED: pentatricopeptide repeat-containi...    132   4e-34   Cucumis sativus [cucumbers]
ref|XP_007052358.1|  Tetratricopeptide repeat (TPR)-like superfam...    131   6e-34   
gb|AAM19786.1|  At1g02150/T7I23.8                                       131   8e-34   Arabidopsis thaliana [mouse-ear cress]
emb|CBI16683.3|  unnamed protein product                                130   8e-34   Vitis vinifera
ref|XP_010089787.1|  hypothetical protein L484_008037                   131   1e-33   Morus notabilis
ref|NP_171717.2|  pentatricopeptide repeat-containing protein           130   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002270492.1|  PREDICTED: pentatricopeptide repeat-containi...    130   1e-33   Vitis vinifera
ref|XP_008438222.1|  PREDICTED: pentatricopeptide repeat-containi...    129   4e-33   Cucumis melo [Oriental melon]
gb|KEH18913.1|  PPR containing plant protein                            125   2e-32   Medicago truncatula
emb|CAN75355.1|  hypothetical protein VITISV_002476                     128   4e-32   Vitis vinifera
ref|XP_002526471.1|  pentatricopeptide repeat-containing protein,...    126   5e-32   Ricinus communis
ref|XP_010540211.1|  PREDICTED: pentatricopeptide repeat-containi...    126   8e-32   Tarenaya hassleriana [spider flower]
ref|XP_004515320.1|  PREDICTED: pentatricopeptide repeat-containi...    125   1e-31   Cicer arietinum [garbanzo]
ref|XP_007134411.1|  hypothetical protein PHAVU_010G045500g             124   2e-31   Phaseolus vulgaris [French bean]
ref|XP_003530115.1|  PREDICTED: pentatricopeptide repeat-containi...    124   6e-31   Glycine max [soybeans]
ref|XP_003520417.1|  PREDICTED: pentatricopeptide repeat-containi...    123   9e-31   Glycine max [soybeans]
ref|XP_003636175.1|  ATP-dependent DNA helicase PIF1                    122   7e-30   
ref|XP_010933566.1|  PREDICTED: pentatricopeptide repeat-containi...    119   1e-29   Elaeis guineensis
emb|CAE04345.1|  OSJNBb0038F03.9                                        119   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EAY95037.1|  hypothetical protein OsI_16851                          119   2e-29   Oryza sativa Indica Group [Indian rice]
ref|NP_001053460.2|  Os04g0544400                                       119   2e-29   
gb|EAZ31514.1|  hypothetical protein OsJ_15655                          119   2e-29   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85010.1|  predicted protein                                      118   3e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010919766.1|  PREDICTED: pentatricopeptide repeat-containi...    118   3e-29   Elaeis guineensis
gb|EEC77735.1|  hypothetical protein OsI_16848                          121   4e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_006652599.1|  PREDICTED: pentatricopeptide repeat-containi...    118   5e-29   
ref|XP_002448264.1|  hypothetical protein SORBIDRAFT_06g024190          117   1e-28   Sorghum bicolor [broomcorn]
dbj|BAK02297.1|  predicted protein                                      116   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN31110.1|  Pentatricopeptide repeat-containing protein             116   2e-28   Glycine soja [wild soybean]
gb|KEH17920.1|  PPR containing plant-like protein                       115   2e-28   Medicago truncatula
ref|XP_010227218.1|  PREDICTED: uncharacterized protein LOC100829762    118   4e-28   Brachypodium distachyon [annual false brome]
ref|XP_008786192.1|  PREDICTED: pentatricopeptide repeat-containi...    115   4e-28   Phoenix dactylifera
ref|XP_004956425.1|  PREDICTED: pentatricopeptide repeat-containi...    115   5e-28   
ref|NP_001168310.1|  hypothetical protein                               115   5e-28   Zea mays [maize]
gb|EMT27370.1|  Pentatricopeptide repeat-containing protein             115   2e-27   
ref|XP_008794909.1|  PREDICTED: pentatricopeptide repeat-containi...    113   3e-27   Phoenix dactylifera
ref|XP_009387580.1|  PREDICTED: pentatricopeptide repeat-containi...    111   5e-27   
gb|AGN52922.1|  hypothetical protein                                    110   5e-27   Silene latifolia
ref|XP_006838525.1|  hypothetical protein AMTR_s00002p00190720          100   6e-23   
emb|CBI21840.3|  unnamed protein product                              99.8    2e-22   Vitis vinifera
emb|CAN73453.1|  hypothetical protein VITISV_024964                   99.8    3e-22   Vitis vinifera
ref|XP_002273904.2|  PREDICTED: pentatricopeptide repeat-containi...  99.8    9e-22   Vitis vinifera
ref|XP_008241137.1|  PREDICTED: pentatricopeptide repeat-containi...  95.1    3e-21   
ref|XP_006849761.1|  hypothetical protein AMTR_s00024p00251490        96.3    6e-21   
ref|XP_010272479.1|  PREDICTED: pentatricopeptide repeat-containi...  95.5    9e-21   Nelumbo nucifera [Indian lotus]
gb|KJB50098.1|  hypothetical protein B456_008G153900                  95.5    1e-20   Gossypium raimondii
ref|XP_007198902.1|  hypothetical protein PRUPE_ppa005316mg           94.0    3e-20   Prunus persica
ref|XP_008349216.1|  PREDICTED: pentatricopeptide repeat-containi...  92.8    1e-19   Malus domestica [apple tree]
gb|KDP24136.1|  hypothetical protein JCGZ_25793                       92.0    1e-19   Jatropha curcas
gb|KDP24137.1|  hypothetical protein JCGZ_25794                       92.0    2e-19   Jatropha curcas
ref|XP_009379667.1|  PREDICTED: pentatricopeptide repeat-containi...  92.0    2e-19   
emb|CBI21839.3|  unnamed protein product                              92.0    2e-19   Vitis vinifera
ref|XP_010242929.1|  PREDICTED: pentatricopeptide repeat-containi...  91.7    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_009357846.1|  PREDICTED: pentatricopeptide repeat-containi...  91.7    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_010099566.1|  hypothetical protein L484_011572                 90.5    3e-19   
ref|XP_002517926.1|  pentatricopeptide repeat-containing protein,...  91.3    3e-19   Ricinus communis
ref|XP_007203456.1|  hypothetical protein PRUPE_ppa022158mg           91.3    3e-19   
ref|XP_008366628.1|  PREDICTED: pentatricopeptide repeat-containi...  90.9    4e-19   
ref|XP_008342918.1|  PREDICTED: pentatricopeptide repeat-containi...  91.3    4e-19   
ref|XP_008353787.1|  PREDICTED: pentatricopeptide repeat-containi...  91.3    4e-19   
ref|XP_010555122.1|  PREDICTED: pentatricopeptide repeat-containi...  90.9    4e-19   Tarenaya hassleriana [spider flower]
ref|XP_002884218.1|  pentatricopeptide repeat-containing protein      90.9    5e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_009342634.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  89.7    5e-19   Pyrus x bretschneideri [bai li]
ref|NP_001176986.1|  Os12g0527850                                     88.6    6e-19   
ref|XP_006376506.1|  pentatricopeptide repeat-containing family p...  90.5    7e-19   Populus trichocarpa [western balsam poplar]
ref|XP_007200782.1|  hypothetical protein PRUPE_ppa024012mg           90.1    8e-19   
ref|XP_008229148.1|  PREDICTED: pentatricopeptide repeat-containi...  90.1    8e-19   Prunus mume [ume]
gb|KDP21919.1|  hypothetical protein JCGZ_03057                       88.2    9e-19   Jatropha curcas
gb|KJB46994.1|  hypothetical protein B456_008G004700                  90.1    1e-18   Gossypium raimondii
dbj|BAK02972.1|  predicted protein                                    89.7    1e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_179663.1|  pentatricopeptide repeat-containing protein         89.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004290659.1|  PREDICTED: pentatricopeptide repeat-containi...  89.7    1e-18   Fragaria vesca subsp. vesca
gb|EMT17732.1|  hypothetical protein F775_09007                       89.7    1e-18   
ref|XP_010255941.1|  PREDICTED: pentatricopeptide repeat-containi...  89.4    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_002322749.2|  hypothetical protein POPTR_0016s06320g           89.4    2e-18   
ref|NP_973492.1|  pentatricopeptide repeat-containing protein         88.2    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009354430.1|  PREDICTED: pentatricopeptide repeat-containi...  89.4    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_008381253.1|  PREDICTED: pentatricopeptide repeat-containi...  89.0    2e-18   
gb|KDP24141.1|  hypothetical protein JCGZ_25798                       88.2    3e-18   Jatropha curcas
ref|XP_010237220.1|  PREDICTED: pentatricopeptide repeat-containi...  89.0    3e-18   Brachypodium distachyon [annual false brome]
gb|KDP21918.1|  hypothetical protein JCGZ_03056                       88.6    3e-18   Jatropha curcas
ref|XP_010489001.1|  PREDICTED: pentatricopeptide repeat-containi...  88.2    4e-18   Camelina sativa [gold-of-pleasure]
gb|ABA99305.2|  pentatricopeptide, putative, expressed                88.2    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003594185.1|  Pentatricopeptide repeat-containing protein      83.2    7e-18   
gb|EAY83341.1|  hypothetical protein OsI_38557                        87.0    7e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_009627474.1|  PREDICTED: pentatricopeptide repeat-containi...  87.8    7e-18   
ref|XP_011037317.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    7e-18   Populus euphratica
ref|XP_002442234.1|  hypothetical protein SORBIDRAFT_08g016710        87.4    7e-18   
gb|EMS62788.1|  hypothetical protein TRIUR3_25805                     87.4    1e-17   Triticum urartu
emb|CDY03299.1|  BnaC09g10490D                                        87.0    1e-17   
emb|CDP03624.1|  unnamed protein product                              87.4    1e-17   Coffea canephora [robusta coffee]
gb|KDP24140.1|  hypothetical protein JCGZ_25797                       87.0    1e-17   Jatropha curcas
emb|CDY39781.1|  BnaA09g10330D                                        86.7    1e-17   Brassica napus [oilseed rape]
ref|XP_010556784.1|  PREDICTED: pentatricopeptide repeat-containi...  87.0    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_006827770.1|  hypothetical protein AMTR_s00009p00264540        87.0    1e-17   
ref|XP_002531596.1|  pentatricopeptide repeat-containing protein,...  84.7    1e-17   
emb|CDP14775.1|  unnamed protein product                              86.7    2e-17   Coffea canephora [robusta coffee]
ref|XP_010422532.1|  PREDICTED: pentatricopeptide repeat-containi...  86.7    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_008455539.1|  PREDICTED: uncharacterized protein LOC103495690  87.4    2e-17   
ref|NP_192191.1|  pentatricopeptide repeat-containing protein         86.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430409.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    2e-17   Camelina sativa [gold-of-pleasure]
gb|AAL32523.1|  Unknown protein                                       86.3    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011039574.1|  PREDICTED: uncharacterized protein LOC105136086  87.4    2e-17   Populus euphratica
ref|NP_001151760.1|  tetratricopeptide-like helical                   86.3    2e-17   Zea mays [maize]
ref|XP_004155477.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    2e-17   
ref|XP_010455929.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009112678.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    3e-17   Brassica rapa
ref|XP_006429969.1|  hypothetical protein CICLE_v10013712mg           85.9    3e-17   
ref|XP_002874893.1|  pentatricopeptide repeat-containing protein      86.3    3e-17   
gb|KCW90381.1|  hypothetical protein EUGRSUZ_A02520                   85.9    3e-17   Eucalyptus grandis [rose gum]
gb|KDP21467.1|  hypothetical protein JCGZ_21938                       85.9    3e-17   Jatropha curcas
ref|XP_006664068.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    3e-17   Oryza brachyantha
gb|EYU46589.1|  hypothetical protein MIMGU_mgv1a004554mg              85.9    4e-17   Erythranthe guttata [common monkey flower]
ref|XP_010058578.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    4e-17   Eucalyptus grandis [rose gum]
ref|XP_004137019.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    4e-17   
ref|XP_006287476.1|  hypothetical protein CARUB_v10000687mg           85.9    4e-17   Capsella rubella
ref|XP_008451368.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    4e-17   Cucumis melo [Oriental melon]
ref|XP_011032725.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    4e-17   Populus euphratica
ref|XP_002307578.1|  pentatricopeptide repeat-containing family p...  85.5    4e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010467774.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010467773.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    4e-17   
ref|XP_008790994.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    5e-17   Phoenix dactylifera
ref|XP_009802167.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    5e-17   Nicotiana sylvestris
gb|KDP21920.1|  hypothetical protein JCGZ_03058                       83.2    5e-17   Jatropha curcas
gb|AES60905.2|  PPR containing plant protein                          85.1    6e-17   Medicago truncatula
emb|CDX91277.1|  BnaC02g26880D                                        85.1    6e-17   
ref|XP_009398991.1|  PREDICTED: pentatricopeptide repeat-containi...  85.1    6e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009144540.1|  PREDICTED: pentatricopeptide repeat-containi...  85.1    6e-17   Brassica rapa
ref|XP_002517927.1|  pentatricopeptide repeat-containing protein,...  84.7    7e-17   Ricinus communis
ref|XP_002520753.1|  pentatricopeptide repeat-containing protein,...  85.1    7e-17   
ref|XP_003590654.1|  WD repeat-containing protein                     85.1    7e-17   
ref|XP_002517929.1|  pentatricopeptide repeat-containing protein,...  84.3    7e-17   
ref|XP_009629681.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    8e-17   Nicotiana tomentosiformis
gb|KGN43610.1|  hypothetical protein Csa_7G047450                     84.7    8e-17   Cucumis sativus [cucumbers]
ref|XP_004155478.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    9e-17   
gb|KFK40443.1|  hypothetical protein AALP_AA3G373800                  84.3    9e-17   Arabis alpina [alpine rockcress]
ref|XP_010921943.1|  PREDICTED: pentatricopeptide repeat-containi...  84.7    9e-17   Elaeis guineensis
emb|CDX97288.1|  BnaA02g20790D                                        84.3    1e-16   
ref|XP_009762284.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    1e-16   Nicotiana sylvestris
ref|XP_002322750.1|  hypothetical protein POPTR_0016s06330g           84.0    1e-16   
gb|KHG13694.1|  hypothetical protein F383_19313                       84.0    2e-16   Gossypium arboreum [tree cotton]
ref|XP_010520653.1|  PREDICTED: uncharacterized protein LOC104799713  84.7    2e-16   
ref|XP_008229146.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    2e-16   Prunus mume [ume]
ref|XP_008342919.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    2e-16   
ref|XP_004962880.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    2e-16   Setaria italica
ref|XP_006409008.1|  hypothetical protein EUTSA_v10001972mg           83.6    2e-16   Eutrema salsugineum [saltwater cress]
ref|XP_008353788.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    2e-16   
gb|KFK30887.1|  hypothetical protein AALP_AA6G038700                  83.6    2e-16   Arabis alpina [alpine rockcress]
ref|XP_010091037.1|  hypothetical protein L484_006401                 83.2    2e-16   
ref|XP_006878583.1|  hypothetical protein AMTR_s00011p00250030        82.8    2e-16   
ref|XP_009762286.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    3e-16   Nicotiana sylvestris
ref|XP_010099567.1|  hypothetical protein L484_011573                 83.2    3e-16   Morus notabilis
ref|XP_011077261.1|  PREDICTED: pentatricopeptide repeat-containi...  83.2    3e-16   Sesamum indicum [beniseed]
ref|XP_006299518.1|  hypothetical protein CARUB_v10015690mg           82.8    4e-16   Capsella rubella
ref|NP_001060183.1|  Os07g0598500                                     82.8    4e-16   
ref|XP_004303401.2|  PREDICTED: uncharacterized protein LOC101303140  83.6    4e-16   Fragaria vesca subsp. vesca
ref|XP_009357845.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_009779118.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    4e-16   Nicotiana sylvestris
ref|XP_006481674.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    4e-16   Citrus sinensis [apfelsine]
ref|XP_008337472.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    6e-16   
emb|CDO99769.1|  unnamed protein product                              81.6    6e-16   Coffea canephora [robusta coffee]
ref|XP_008345197.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    7e-16   
ref|XP_009368491.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    7e-16   Pyrus x bretschneideri [bai li]
gb|KHG24373.1|  hypothetical protein F383_30483                       82.0    7e-16   Gossypium arboreum [tree cotton]
ref|XP_004136821.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    7e-16   
ref|XP_008235277.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    8e-16   Prunus mume [ume]
gb|KGN43609.1|  hypothetical protein Csa_7G047440                     81.6    8e-16   Cucumis sativus [cucumbers]
gb|EPS60165.1|  hypothetical protein M569_14638                       81.6    9e-16   Genlisea aurea
ref|XP_004148903.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    9e-16   Cucumis sativus [cucumbers]
ref|XP_008368855.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    9e-16   
ref|XP_011037319.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    1e-15   Populus euphratica
ref|XP_008381254.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    1e-15   
ref|XP_011037318.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    1e-15   Populus euphratica
ref|XP_006444085.1|  hypothetical protein CICLE_v10019771mg           81.3    1e-15   Citrus clementina [clementine]
ref|XP_007029137.1|  Tetratricopeptide repeat-like superfamily pr...  80.1    1e-15   
ref|XP_008452263.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    1e-15   Cucumis melo [Oriental melon]
ref|XP_006396507.1|  hypothetical protein EUTSA_v10028573mg           81.3    1e-15   Eutrema salsugineum [saltwater cress]
ref|XP_010662164.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    1e-15   Vitis vinifera
gb|EMT11631.1|  Pentatricopeptide repeat-containing protein           82.0    2e-15   
gb|KJB23095.1|  hypothetical protein B456_004G080600                  80.9    2e-15   Gossypium raimondii
gb|KDP35619.1|  hypothetical protein JCGZ_09057                       80.9    2e-15   Jatropha curcas
ref|XP_008339193.1|  PREDICTED: putative pentatricopeptide repeat...  81.6    2e-15   
gb|KDO70776.1|  hypothetical protein CISIN_1g011472mg                 80.9    2e-15   Citrus sinensis [apfelsine]
gb|EEE67529.1|  hypothetical protein OsJ_24995                        80.9    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006481675.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    2e-15   Citrus sinensis [apfelsine]
ref|XP_004146598.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    2e-15   
gb|KCW49953.1|  hypothetical protein EUGRSUZ_K03412                   80.5    2e-15   Eucalyptus grandis [rose gum]
ref|XP_010038139.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    2e-15   Eucalyptus grandis [rose gum]
emb|CAN64701.1|  hypothetical protein VITISV_037299                   81.6    2e-15   Vitis vinifera
ref|XP_009615280.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    2e-15   Nicotiana tomentosiformis
ref|XP_006827771.1|  hypothetical protein AMTR_s00009p00264580        79.7    2e-15   
ref|XP_008453822.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    3e-15   Cucumis melo [Oriental melon]
ref|XP_006429968.1|  hypothetical protein CICLE_v10011545mg           80.5    3e-15   
ref|XP_008368256.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    3e-15   Malus domestica [apple tree]
ref|XP_004495206.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    3e-15   Cicer arietinum [garbanzo]
dbj|BAK01251.1|  predicted protein                                    80.1    3e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006661923.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    3e-15   
ref|XP_004240342.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    4e-15   Solanum lycopersicum
ref|XP_007029136.1|  Tetratricopeptide repeat-like superfamily pr...  80.1    4e-15   
ref|XP_007021400.1|  Tetratricopeptide repeat-like superfamily pr...  79.7    4e-15   
ref|XP_006366127.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    4e-15   Solanum tuberosum [potatoes]
gb|AIZ68164.1|  pentatricopeptide repeat-containing protein At1g6...  79.7    5e-15   Ornithogalum longebracteatum [sea-onion]
ref|XP_006644106.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    5e-15   Oryza brachyantha
ref|XP_007050629.1|  Pentatricopeptide repeat (PPR) superfamily p...  79.7    5e-15   
ref|XP_008453823.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    5e-15   Cucumis melo [Oriental melon]
ref|XP_010662166.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    6e-15   
ref|XP_011079842.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    6e-15   Sesamum indicum [beniseed]
ref|XP_008381422.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    6e-15   
ref|XP_008800895.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    6e-15   Phoenix dactylifera
ref|XP_008442434.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    6e-15   Cucumis melo [Oriental melon]
ref|XP_009349931.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    7e-15   Pyrus x bretschneideri [bai li]
ref|XP_009390562.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    7e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004295631.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    7e-15   Fragaria vesca subsp. vesca
ref|NP_001064985.1|  Os10g0501300                                     79.3    7e-15   
ref|XP_006347050.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    8e-15   Solanum tuberosum [potatoes]
gb|KDO82307.1|  hypothetical protein CISIN_1g011226mg                 79.0    8e-15   Citrus sinensis [apfelsine]
ref|XP_006483923.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    8e-15   Citrus sinensis [apfelsine]
ref|XP_006438303.1|  hypothetical protein CICLE_v10031342mg           79.0    8e-15   Citrus clementina [clementine]
ref|XP_003536907.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    8e-15   Glycine max [soybeans]
ref|XP_009768016.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    8e-15   Nicotiana sylvestris
gb|EAY79104.1|  hypothetical protein OsI_34210                        79.0    8e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_009589813.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    8e-15   
ref|XP_004509657.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    8e-15   Cicer arietinum [garbanzo]
gb|ABR18022.1|  unknown                                               79.0    9e-15   Picea sitchensis
ref|XP_007051132.1|  Tetratricopeptide repeat (TPR)-like superfam...  79.0    9e-15   
ref|XP_007153764.1|  hypothetical protein PHAVU_003G063200g           78.6    1e-14   Phaseolus vulgaris [French bean]
ref|XP_010553613.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_010939721.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    1e-14   Elaeis guineensis
ref|XP_004508130.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    1e-14   Cicer arietinum [garbanzo]
ref|XP_007198989.1|  hypothetical protein PRUPE_ppa004422mg           78.6    1e-14   Prunus persica
gb|KGN43608.1|  hypothetical protein Csa_7G047430                     77.8    1e-14   Cucumis sativus [cucumbers]
ref|XP_011037316.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    1e-14   Populus euphratica
ref|XP_003526072.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    1e-14   Glycine max [soybeans]
ref|XP_004243349.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    1e-14   
ref|XP_006357486.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    1e-14   
ref|XP_003567580.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    1e-14   Brachypodium distachyon [annual false brome]
ref|XP_004168984.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    1e-14   
gb|KGN64672.1|  hypothetical protein Csa_1G073790                     78.2    1e-14   Cucumis sativus [cucumbers]
ref|XP_006840979.1|  hypothetical protein AMTR_s00085p00059480        78.2    2e-14   Amborella trichopoda
ref|XP_006376509.1|  hypothetical protein POPTR_0013s13650g           78.2    2e-14   
ref|XP_010539219.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    2e-14   
ref|XP_007044736.1|  Tetratricopeptide repeat (TPR)-like superfam...  78.2    2e-14   
ref|XP_007042879.1|  Tetratricopeptide repeat-like superfamily pr...  77.4    2e-14   
gb|EAZ16588.1|  hypothetical protein OsJ_32060                        77.8    2e-14   
ref|XP_010108201.1|  hypothetical protein L484_014527                 78.2    2e-14   
ref|XP_010249903.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    2e-14   
ref|XP_002457728.1|  hypothetical protein SORBIDRAFT_03g012450        78.2    2e-14   
ref|XP_010241951.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    2e-14   
ref|XP_010100377.1|  hypothetical protein L484_027687                 77.8    2e-14   
ref|XP_008446176.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    2e-14   
ref|XP_004146883.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    2e-14   
gb|KGN53198.1|  Pentatricopeptide repeat-containing protein           77.8    2e-14   
ref|XP_008389701.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    2e-14   
ref|XP_006840468.1|  hypothetical protein AMTR_s00045p00181820        77.8    2e-14   
ref|XP_007144631.1|  hypothetical protein PHAVU_007G171700g           77.8    2e-14   
ref|XP_008227878.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    2e-14   
ref|XP_004133705.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    3e-14   
ref|XP_010245038.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    3e-14   
ref|XP_010039270.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    3e-14   
ref|XP_008812226.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    3e-14   
ref|XP_007198830.1|  hypothetical protein PRUPE_ppa006648mg           77.0    3e-14   
emb|CDP14776.1|  unnamed protein product                              77.4    3e-14   
gb|KJB31193.1|  hypothetical protein B456_005G180200                  77.0    3e-14   
ref|XP_006653269.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    3e-14   
ref|XP_011098322.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    4e-14   
ref|XP_002436399.1|  hypothetical protein SORBIDRAFT_10g001830        77.4    4e-14   
ref|XP_009400074.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    4e-14   
ref|NP_001168600.1|  uncharacterized protein LOC100382384             77.0    4e-14   
ref|XP_008801962.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    4e-14   
ref|XP_006658770.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    4e-14   
ref|XP_011087932.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    5e-14   
ref|XP_007221478.1|  hypothetical protein PRUPE_ppa005037mg           76.6    5e-14   
ref|XP_002438963.1|  hypothetical protein SORBIDRAFT_10g029040        76.6    5e-14   
emb|CDP17058.1|  unnamed protein product                              76.6    5e-14   
ref|XP_006376504.1|  pentatricopeptide repeat-containing family p...  76.6    5e-14   
gb|KJB31192.1|  hypothetical protein B456_005G180200                  76.6    5e-14   
ref|XP_010249890.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    6e-14   
gb|AFW86058.1|  hypothetical protein ZEAMMB73_674343                  77.0    6e-14   
gb|EMT15886.1|  hypothetical protein F775_07739                       76.6    6e-14   
gb|AFW86057.1|  hypothetical protein ZEAMMB73_674343                  76.6    6e-14   
gb|EMT02140.1|  Pentatricopeptide repeat-containing protein           76.3    6e-14   
ref|XP_010925090.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    7e-14   
ref|XP_003557118.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    7e-14   
gb|EYU39860.1|  hypothetical protein MIMGU_mgv1a005194mg              76.3    7e-14   
ref|XP_010924205.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    7e-14   
emb|CBI40661.3|  unnamed protein product                              74.3    7e-14   
ref|XP_009382489.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    7e-14   
ref|XP_009610168.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    7e-14   
ref|XP_010910082.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    7e-14   
ref|XP_004964414.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  76.3    8e-14   
ref|XP_006349176.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    8e-14   
ref|NP_001168643.1|  uncharacterized protein LOC100382430             76.3    8e-14   
ref|XP_003531991.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    8e-14   
ref|XP_008801961.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    8e-14   
emb|CDX91822.1|  BnaC03g31240D                                        76.3    8e-14   
ref|XP_010682416.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    9e-14   
ref|XP_007042878.1|  Tetratricopeptide repeat-like superfamily pr...  74.3    9e-14   
ref|XP_009757638.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    9e-14   
ref|XP_009589051.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    9e-14   
ref|XP_010690204.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    1e-13   
gb|KEH20176.1|  PPR containing plant protein                          75.9    1e-13   
ref|XP_007222350.1|  hypothetical protein PRUPE_ppa004842mg           75.9    1e-13   
gb|EMT12044.1|  hypothetical protein F775_21441                       75.1    1e-13   
ref|XP_009605662.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    1e-13   
gb|ADI88477.1|  PPR protein                                           73.2    1e-13   
ref|NP_001052458.1|  Os04g0320200                                     75.5    1e-13   
emb|CAH66166.1|  H0107B07.5                                           75.5    1e-13   
gb|EYU26391.1|  hypothetical protein MIMGU_mgv1a004262mg              75.5    1e-13   
gb|EAZ04592.1|  hypothetical protein OsI_26742                        75.1    1e-13   
ref|XP_004296672.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    1e-13   
ref|XP_003574143.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-13   
gb|AFK33523.1|  unknown                                               74.3    2e-13   
gb|ABB47839.1|  expressed protein                                     73.9    2e-13   
emb|CDO97403.1|  unnamed protein product                              74.7    2e-13   
gb|AAM93669.1|  putative leaf protein                                 75.5    2e-13   
gb|KHN16203.1|  Pentatricopeptide repeat-containing protein, mito...  75.1    2e-13   
gb|ADI87991.1|  PPR protein                                           72.8    2e-13   
gb|ADI87989.1|  PPR protein                                           72.8    2e-13   
gb|ADI88027.1|  PPR protein                                           72.8    2e-13   
gb|ADI88018.1|  PPR protein                                           72.8    2e-13   
gb|ADI88001.1|  PPR protein                                           72.8    2e-13   
ref|XP_004135263.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    2e-13   
gb|ACU24296.1|  unknown                                               75.1    2e-13   
ref|XP_002268952.2|  PREDICTED: pentatricopeptide repeat-containi...  74.7    2e-13   
ref|XP_004288536.2|  PREDICTED: pentatricopeptide repeat-containi...  75.1    2e-13   
emb|CBI23460.3|  unnamed protein product                              75.1    2e-13   
gb|ADI88017.1|  PPR protein                                           72.8    2e-13   
gb|ADI88006.1|  PPR protein                                           72.8    2e-13   
gb|AFN53641.1|  pentatricopeptide repeat-containing protein           75.1    2e-13   
ref|XP_010693618.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-13   
gb|ADI87986.1|  PPR protein                                           72.8    2e-13   
gb|ADI87999.1|  PPR protein                                           72.8    2e-13   
gb|EAY79103.1|  hypothetical protein OsI_34209                        75.1    2e-13   
gb|ADI88028.1|  PPR protein                                           72.8    2e-13   
gb|ADI88015.1|  PPR protein                                           72.8    2e-13   
gb|ADI88030.1|  PPR protein                                           72.8    2e-13   
gb|ADI87985.1|  PPR protein                                           72.8    2e-13   
gb|ADI88009.1|  PPR protein                                           72.8    2e-13   
ref|XP_010656672.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    2e-13   
gb|KJB79604.1|  hypothetical protein B456_013G057100                  73.6    2e-13   
gb|ADI88010.1|  PPR protein                                           72.8    2e-13   
ref|XP_004229380.2|  PREDICTED: pentatricopeptide repeat-containi...  75.1    2e-13   
ref|XP_006287578.1|  hypothetical protein CARUB_v10000787mg           75.1    2e-13   
ref|XP_010062875.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    2e-13   
gb|ADI88002.1|  PPR protein                                           72.8    2e-13   
gb|KDP27040.1|  hypothetical protein JCGZ_20975                       75.1    2e-13   
ref|XP_010921472.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    2e-13   
gb|ADI88021.1|  PPR protein                                           72.8    2e-13   
gb|ADI88022.1|  PPR protein                                           72.8    2e-13   
ref|XP_010023484.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    2e-13   
ref|XP_002267979.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    2e-13   
emb|CDO99551.1|  unnamed protein product                              74.7    2e-13   
ref|XP_006302183.1|  hypothetical protein CARUB_v10020193mg           74.7    3e-13   
ref|XP_011029462.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    3e-13   
ref|XP_003571944.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    3e-13   
gb|KJB79603.1|  hypothetical protein B456_013G057100                  73.9    3e-13   
ref|XP_009134458.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    3e-13   
ref|XP_002872860.1|  hypothetical protein ARALYDRAFT_490379           74.7    3e-13   
ref|XP_006381714.1|  pentatricopeptide repeat-containing family p...  74.7    3e-13   
emb|CDX90962.1|  BnaA03g26420D                                        74.7    3e-13   
gb|EAZ16585.1|  hypothetical protein OsJ_32057                        73.9    3e-13   
ref|NP_001064983.1|  Os10g0501000                                     74.3    3e-13   
ref|XP_006307239.1|  hypothetical protein CARUB_v10008848mg           74.7    3e-13   
ref|XP_011079543.1|  PREDICTED: pentatricopeptide repeat-containi...  74.3    4e-13   
ref|XP_010422661.1|  PREDICTED: pentatricopeptide repeat-containi...  74.3    4e-13   
emb|CDY50357.1|  BnaA09g13060D                                        71.6    4e-13   
ref|XP_003545705.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    4e-13   
ref|XP_008655858.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  74.3    4e-13   
ref|XP_010510912.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    4e-13   
ref|XP_006597358.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    4e-13   
ref|NP_001288478.1|  uncharacterized protein LOC103635083             74.3    4e-13   
gb|KHN25154.1|  Pentatricopeptide repeat-containing protein           72.4    4e-13   
ref|XP_002527601.1|  pentatricopeptide repeat-containing protein,...  73.9    4e-13   
emb|CDO99549.1|  unnamed protein product                              73.9    4e-13   
ref|XP_010473256.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    5e-13   
gb|KEH40167.1|  PPR containing plant protein                          73.6    5e-13   
ref|XP_010439440.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    5e-13   
ref|XP_009762287.1|  PREDICTED: pentatricopeptide repeat-containi...  71.2    5e-13   
gb|ADI88004.1|  PPR protein                                           71.6    5e-13   
gb|KHN37169.1|  Pentatricopeptide repeat-containing protein, mito...  73.6    5e-13   
gb|ADI87990.1|  PPR protein                                           71.6    5e-13   
ref|XP_002464423.1|  hypothetical protein SORBIDRAFT_01g017970        73.9    5e-13   
gb|ADI88012.1|  PPR protein                                           71.6    5e-13   
ref|XP_008810293.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    6e-13   
gb|ADI88026.1|  PPR protein                                           71.2    6e-13   
ref|XP_011029463.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    6e-13   
ref|XP_010087220.1|  hypothetical protein L484_009729                 73.6    6e-13   
emb|CDY24553.1|  BnaA01g22570D                                        72.0    6e-13   
ref|XP_002515265.1|  pentatricopeptide repeat-containing protein,...  73.6    6e-13   
ref|XP_007148381.1|  hypothetical protein PHAVU_006G203700g           73.2    6e-13   
ref|XP_006492603.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    7e-13   
ref|XP_002316903.2|  hypothetical protein POPTR_0011s12150g           73.6    7e-13   
ref|XP_004967563.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    7e-13   
ref|XP_010449015.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    7e-13   
ref|XP_008237223.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    7e-13   
gb|KHN33548.1|  Pentatricopeptide repeat-containing protein, mito...  73.6    7e-13   
ref|XP_008237222.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    8e-13   
ref|XP_002886593.1|  pentatricopeptide repeat-containing protein      73.2    8e-13   
gb|KDP28274.1|  hypothetical protein JCGZ_14045                       73.2    8e-13   
emb|CDY15237.1|  BnaC05g01160D                                        73.6    8e-13   
ref|XP_010439439.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    8e-13   
ref|XP_004249932.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    8e-13   
gb|AAM93695.1|  putative leaf protein                                 72.4    9e-13   
ref|XP_010087222.1|  hypothetical protein L484_009731                 72.8    1e-12   
ref|NP_001042820.1|  Os01g0301000                                     73.2    1e-12   
ref|XP_003594181.1|  Pentatricopeptide repeat-containing protein      70.9    1e-12   
emb|CDX96239.1|  BnaC02g14120D                                        72.8    1e-12   
ref|XP_010429011.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    1e-12   
ref|XP_011014826.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    1e-12   
ref|XP_006449328.1|  hypothetical protein CICLE_v10015002mg           72.8    1e-12   
ref|XP_011014138.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    1e-12   
ref|XP_006467809.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    1e-12   
ref|XP_010940923.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    1e-12   
ref|XP_010095002.1|  hypothetical protein L484_001063                 71.2    1e-12   
emb|CDP05907.1|  unnamed protein product                              73.2    1e-12   
ref|XP_010542838.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    1e-12   
emb|CDY34141.1|  BnaC01g28810D                                        72.4    1e-12   
ref|XP_009782480.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    1e-12   
ref|XP_008810294.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    1e-12   
ref|XP_004982703.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    2e-12   
gb|KEH37793.1|  PPR containing plant protein                          72.4    2e-12   
ref|XP_009359185.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  72.4    2e-12   
gb|ADI88005.1|  PPR protein                                           70.1    2e-12   
ref|XP_009103962.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    2e-12   
ref|XP_006392119.1|  hypothetical protein EUTSA_v10023426mg           72.4    2e-12   
ref|XP_006396396.1|  hypothetical protein EUTSA_v10029427mg           72.4    2e-12   
dbj|BAK06496.1|  predicted protein                                    72.4    2e-12   
emb|CDY46999.1|  BnaC09g14050D                                        72.4    2e-12   
gb|KHG20865.1|  hypothetical protein F383_27144                       71.6    2e-12   
gb|KFK40762.1|  hypothetical protein AALP_AA2G037700                  72.4    2e-12   
gb|KDP26635.1|  hypothetical protein JCGZ_17793                       72.4    2e-12   
gb|KDO42278.1|  hypothetical protein CISIN_1g015370mg                 72.0    2e-12   
ref|XP_009757637.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    2e-12   
ref|XP_004499170.1|  PREDICTED: pentatricopeptide repeat-containi...  71.6    2e-12   
gb|AAD22661.1|AC007138_25  hypothetical protein                       72.0    2e-12   
ref|NP_567220.1|  pentatricopeptide repeat-containing protein         72.0    2e-12   
ref|XP_007145137.1|  hypothetical protein PHAVU_007G213200g           72.0    2e-12   
ref|XP_003545936.1|  PREDICTED: pentatricopeptide repeat-containi...  72.0    2e-12   
ref|XP_009113186.1|  PREDICTED: pentatricopeptide repeat-containi...  72.0    2e-12   
ref|XP_006350932.1|  PREDICTED: pentatricopeptide repeat-containi...  72.0    2e-12   
gb|KHN08626.1|  Pentatricopeptide repeat-containing protein, mito...  71.6    2e-12   
ref|XP_008781131.1|  PREDICTED: pentatricopeptide repeat-containi...  72.0    2e-12   
ref|XP_004514343.1|  PREDICTED: pentatricopeptide repeat-containi...  72.0    3e-12   
ref|XP_003531533.1|  PREDICTED: pentatricopeptide repeat-containi...  71.2    3e-12   
ref|XP_002446580.1|  hypothetical protein SORBIDRAFT_06g018360        71.2    3e-12   
ref|XP_010677631.1|  PREDICTED: pentatricopeptide repeat-containi...  71.6    3e-12   
ref|XP_006841256.1|  hypothetical protein AMTR_s00135p00094440        71.2    3e-12   
gb|ACN28586.1|  unknown                                               71.2    3e-12   
gb|ABR16456.1|  unknown                                               72.0    3e-12   
ref|XP_003579864.1|  PREDICTED: pentatricopeptide repeat-containi...  71.2    3e-12   
emb|CDX89976.1|  BnaA10g01060D                                        71.6    3e-12   
ref|XP_009119640.1|  PREDICTED: pentatricopeptide repeat-containi...  71.6    4e-12   
ref|XP_008442448.1|  PREDICTED: pentatricopeptide repeat-containi...  71.2    4e-12   
gb|KDO74080.1|  hypothetical protein CISIN_1g011236mg                 71.2    4e-12   
ref|XP_011043365.1|  PREDICTED: pentatricopeptide repeat-containi...  71.2    4e-12   
gb|EAY73658.1|  hypothetical protein OsI_01545                        71.2    4e-12   
ref|XP_008668553.1|  PREDICTED: hypothetical protein isoform X1       71.2    4e-12   
ref|XP_009788488.1|  PREDICTED: pentatricopeptide repeat-containi...  71.2    4e-12   
emb|CBI36964.3|  unnamed protein product                              71.2    5e-12   
emb|CDY35212.1|  BnaA01g08190D                                        69.3    5e-12   
ref|XP_002282230.1|  PREDICTED: pentatricopeptide repeat-containi...  71.2    5e-12   
gb|KHN03794.1|  Pentatricopeptide repeat-containing protein, mito...  70.9    5e-12   



>ref|XP_011085741.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Sesamum indicum]
Length=546

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW+N+RAE Y+ITTSDTAIQLDLI+KVHGIS+AEKYF+ LP++LKD+RIYGSLLNA
Sbjct  131  LEVYEWMNNRAESYRITTSDTAIQLDLIAKVHGISSAEKYFMKLPDALKDKRIYGSLLNA  190

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  MREKAESL D+MR+R Y  + LP+N+M+ LYM
Sbjct  191  YVRARMREKAESLMDKMRDRSYASHALPFNVMMTLYM  227



>ref|XP_009592903.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Nicotiana tomentosiformis]
Length=539

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW+N+RAER+++TTSDTAIQLDLI+KVHGIS+AE+YF+ LP++LKD+RIYGSLLNA
Sbjct  127  LEVYEWMNNRAERFRLTTSDTAIQLDLIAKVHGISSAEEYFVKLPDTLKDKRIYGSLLNA  186

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            +VR   +E+AESL D+MRNRGYT + LP+N+M+ LYM
Sbjct  187  FVRARKKEQAESLIDKMRNRGYTDHALPFNVMMTLYM  223



>ref|XP_009774058.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Nicotiana sylvestris]
Length=538

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW+N+RAER+++TTSDTAIQLDLI+KVHGIS+AE+YF+ LP++LKD+RIYGSLLNA
Sbjct  126  LEVYEWMNNRAERFRLTTSDTAIQLDLIAKVHGISSAEEYFVKLPDTLKDKRIYGSLLNA  185

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            +VR   +E+AESL D+MRNRGYT + LP+N+M+ LYM
Sbjct  186  FVRARKKEQAESLIDKMRNRGYTDHALPFNVMMTLYM  222



>ref|XP_006347992.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Solanum tuberosum]
Length=545

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  4    EVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAY  183
            EV EW+N+R ER+++TTSDTAIQLDLI+KVHGIS+AE+YF  LP++LKD+RIYGSLLNA+
Sbjct  134  EVYEWMNNRPERFRLTTSDTAIQLDLIAKVHGISSAEEYFEKLPDTLKDKRIYGSLLNAF  193

Query  184  VRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            VR   +E+AESL D+MRNRGYT + LP+N+M+ LYM
Sbjct  194  VRSRKKEQAESLLDKMRNRGYTDHALPFNVMMTLYM  229



>ref|XP_004229730.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Solanum lycopersicum]
Length=545

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  4    EVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAY  183
            EV EW+N+R ER+++TTSDTAIQLDLI+KVHGIS+AE+YF  LP++LKD+RIYGSLLNA+
Sbjct  134  EVYEWMNNRPERFRLTTSDTAIQLDLIAKVHGISSAEEYFDKLPDTLKDKRIYGSLLNAF  193

Query  184  VRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            VR   +E+AESL D+MRNRGYT + LP+N+M+ LYM
Sbjct  194  VRSRKKEQAESLLDKMRNRGYTDHALPFNVMMTLYM  229



>gb|EYU40343.1| hypothetical protein MIMGU_mgv1a004109mg [Erythranthe guttata]
Length=543

 Score =   145 bits (366),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+RAERY+ITTSDTAIQLDLI+KVHGI++AE YFL LP++LKD+RIYGSLLN 
Sbjct  131  LEVYDWMNNRAERYRITTSDTAIQLDLIAKVHGIASAEHYFLKLPDALKDKRIYGSLLNV  190

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y R  MREK+ESL D MR++GY  + LP+N+M+ LYM
Sbjct  191  YARSRMREKSESLMDIMRSKGYASHALPFNVMMTLYM  227



>emb|CDP09418.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW+N+R ER++I+TSDTAIQLDLISKVHGIS+AE YFL LP+ LKD+RIYG+LLNA
Sbjct  44   LEVYEWMNNREERFRISTSDTAIQLDLISKVHGISSAEDYFLKLPDPLKDKRIYGALLNA  103

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y R   +E+AESL D+MR+RGY  + LP+N+++ LYM
Sbjct  104  YGRARKKEEAESLMDKMRDRGYACHALPFNVIMTLYM  140



>gb|KHG14992.1| hypothetical protein F383_17735 [Gossypium arboreum]
Length=533

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW+N+R ER++ + SD AIQLDLISKV G+S+AE +FL LP++LKD+RIYG+LLNA
Sbjct  121  LEVYEWMNNRGERFRFSASDAAIQLDLISKVRGVSSAEDFFLQLPDTLKDKRIYGALLNA  180

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  M+EKAESL D MRN+GY  + LP+N+M+ LYM
Sbjct  181  YVRARMQEKAESLIDNMRNKGYALHPLPFNVMMTLYM  217



>ref|XP_007218971.1| hypothetical protein PRUPE_ppa003822mg [Prunus persica]
 gb|EMJ20170.1| hypothetical protein PRUPE_ppa003822mg [Prunus persica]
Length=546

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+++R ER++I+TSD AIQLDL++KV G+++AE YFL+LP++LKDRRIYG+LLNA
Sbjct  123  LEVYDWMSNRGERFRISTSDAAIQLDLVAKVRGVASAENYFLSLPDTLKDRRIYGALLNA  182

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  M+EKAESL D+MR++G+   +LP+N+M+ LYM
Sbjct  183  YVRTRMKEKAESLLDKMRSKGHALQSLPFNVMMTLYM  219



>ref|XP_008232381.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Prunus mume]
Length=546

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+++R ER++I+TSD AIQLDL++KV G+++AE YFL+LP++LKDRRIYG+LLNA
Sbjct  123  LEVYDWMSNRGERFRISTSDAAIQLDLVAKVRGVASAENYFLSLPDTLKDRRIYGALLNA  182

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  M+EKAESL D+MR++G+   +LP+N+M+ LYM
Sbjct  183  YVRTRMKEKAESLLDKMRSKGHALQSLPFNVMMTLYM  219



>ref|XP_010052788.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Eucalyptus grandis]
 gb|KCW76861.1| hypothetical protein EUGRSUZ_D01216 [Eucalyptus grandis]
Length=528

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI+KV GIS+AE +FL LP++LKDRRIYG+LLNA
Sbjct  121  LEVYDWMNNRGERFRLSASDAAIQLDLIAKVRGISSAEDFFLKLPDALKDRRIYGALLNA  180

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  M+EKAESL ++MR +GY  + LP+N+M+ LYM
Sbjct  181  YVRAKMKEKAESLIEKMREKGYAMHALPFNVMMTLYM  217



>ref|XP_009338668.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Pyrus x bretschneideri]
Length=530

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+++R ER++I+TSD AIQLDL++KV G+++AE YFL+LP++LKDRRIYG+LLNA
Sbjct  122  LEVYDWMSNRGERFRISTSDAAIQLDLVAKVRGVASAENYFLSLPDTLKDRRIYGALLNA  181

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  M+EKAE+L D+MR +G+   +LP+N+M+ LYM
Sbjct  182  YVRARMKEKAEALLDKMRTKGHALQSLPFNVMMTLYM  218



>ref|XP_006445447.1| hypothetical protein CICLE_v10019658mg [Citrus clementina]
 ref|XP_006464406.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Citrus sinensis]
 gb|ESR58687.1| hypothetical protein CICLE_v10019658mg [Citrus clementina]
 gb|KDO85468.1| hypothetical protein CISIN_1g009424mg [Citrus sinensis]
Length=535

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI+KVHG+++AE +FL+LP++LKDRR+YG+LLNA
Sbjct  126  LEVYDWMNNRGERFRLSASDAAIQLDLIAKVHGVASAEDFFLSLPDTLKDRRVYGALLNA  185

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  MR  AE L D+MR++GY  ++LPYN+M+ LYM
Sbjct  186  YVRARMRGNAELLIDKMRDKGYAVHSLPYNVMMTLYM  222



>ref|XP_008343713.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Malus domestica]
Length=531

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+++R ER++I+TSD AIQLDL++KV G+++AE YFL+LP +LKDRRIYG+LLNA
Sbjct  118  LEVYDWMSNRGERFRISTSDAAIQLDLVAKVRGVASAENYFLSLPGTLKDRRIYGALLNA  177

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  M+EKAE+L D+MR +G+   +LP+N+M+ LYM
Sbjct  178  YVRARMKEKAEALLDKMRTKGHALQSLPFNVMMTLYM  214



>gb|KJB22842.1| hypothetical protein B456_004G069400 [Gossypium raimondii]
 gb|KJB22843.1| hypothetical protein B456_004G069400 [Gossypium raimondii]
 gb|KJB22844.1| hypothetical protein B456_004G069400 [Gossypium raimondii]
Length=533

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW+N+R ER++ + SD AIQLDLISKV G+S+AE +FL L ++LKD+RIYG+LLNA
Sbjct  121  LEVYEWMNNRGERFRFSASDAAIQLDLISKVRGVSSAEDFFLQLSDTLKDKRIYGALLNA  180

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  M+EKAESL D MRN+GY  + LP+N+M+ LYM
Sbjct  181  YVRARMQEKAESLIDNMRNKGYALHPLPFNVMMTLYM  217



>ref|XP_011017395.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Populus euphratica]
Length=539

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER+ ++ SD AIQLDLI+KV G+S+AE +FL LPN+ KDRRIYG+LLNA
Sbjct  121  LEVYDWMNNRQERFGLSPSDAAIQLDLIAKVRGVSSAEDFFLRLPNTFKDRRIYGALLNA  180

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  MREKAESL DEMR++ Y  + LPYN+M+ LYM
Sbjct  181  YVRNRMREKAESLIDEMRDKDYVTHALPYNVMMTLYM  217



>ref|XP_006418504.1| hypothetical protein EUTSA_v10007383mg [Eutrema salsugineum]
 gb|ESQ36857.1| hypothetical protein EUTSA_v10007383mg [Eutrema salsugineum]
Length=517

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI KV GIS+AE++FL+LP + KDRR+YGSLLNA
Sbjct  117  LEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDAEEFFLSLPENFKDRRVYGSLLNA  176

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR   REKAE+L D+MR +GY  + LP+N+M+ LYM
Sbjct  177  YVRAKSREKAEALIDKMREKGYALHPLPFNVMMTLYM  213



>ref|XP_002301239.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE80512.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=539

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER+ ++ SD AIQLDLI+KV G+S+AE +FL LPN+ KDRRIYG+LLNA
Sbjct  121  LEVYDWMNNRQERFGLSPSDAAIQLDLIAKVRGVSSAEDFFLRLPNTFKDRRIYGALLNA  180

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  MREKAESL DEMR + Y  + LPYN+M+ LYM
Sbjct  181  YVRNRMREKAESLIDEMRGKDYVTHALPYNVMMTLYM  217



>ref|XP_010496689.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Camelina sativa]
Length=447

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI KV GIS+AE++FLTLP + KDRR+YGSLLNA
Sbjct  44   LEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDAEEFFLTLPENFKDRRVYGSLLNA  103

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR   REKAESL   MR +GY  + LP+N+M+ LYM
Sbjct  104  YVRAKSREKAESLLSTMREKGYALHPLPFNVMMTLYM  140



>ref|XP_010496474.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Camelina sativa]
Length=521

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI KV GIS+AE++FLTLP + KDRR+YGSLLNA
Sbjct  117  LEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDAEEFFLTLPENFKDRRVYGSLLNA  176

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR   REKAESL   MR +GY  + LP+N+M+ LYM
Sbjct  177  YVRAKSREKAESLLSTMREKGYALHPLPFNVMMTLYM  213



>ref|XP_006375170.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ERP52967.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=539

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+ +R ER++++ SD AIQLDLI+KV G+S AE +FL+LPN+ KDRR+YG+LLNA
Sbjct  121  LEVYDWMKNRQERFRLSPSDAAIQLDLIAKVRGVSTAEDFFLSLPNTFKDRRVYGALLNA  180

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  MREKAE+LFDEMR++GY  + LP+N+ + LYM
Sbjct  181  YVQNRMREKAETLFDEMRDKGYVTHALPFNVTMTLYM  217



>ref|XP_011032472.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Populus euphratica]
Length=539

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+ +R ER++++ SD AIQLDLI+KV G+S AE +FL+LPN+ KDRR+YG+LLNA
Sbjct  121  LEVYDWMKNRQERFRLSPSDAAIQLDLIAKVRGVSTAEDFFLSLPNTFKDRRVYGALLNA  180

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  MREKAE+LFDEMR++GY  + LP+N+ + LYM
Sbjct  181  YVQNRMREKAETLFDEMRDKGYVTHALPFNVTMTLYM  217



>ref|XP_010479321.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Camelina sativa]
Length=559

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI KV GIS+AE++FLTLP + KDRR+YGSLLNA
Sbjct  155  LEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDAEEFFLTLPENFKDRRVYGSLLNA  214

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR   REKAESL   MR +GY  + LP+N+M+ LYM
Sbjct  215  YVRAKSREKAESLLSTMREKGYALHPLPFNVMMTLYM  251



>ref|XP_009119759.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Brassica rapa]
Length=512

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N R ER++++ SD AIQLDLI KV GIS+AE++FL+LP++ KDRR+YGSLLNA
Sbjct  118  LEVYDWMNKRGERFRLSASDAAIQLDLIGKVRGISDAEEFFLSLPDNFKDRRVYGSLLNA  177

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR   REKAE+L D MR +GY  + LP+N+M+ LYM
Sbjct  178  YVRAKSREKAEALIDIMRQKGYALHPLPFNVMMTLYM  214



>emb|CDX90079.1| BnaA10g00030D [Brassica napus]
Length=512

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N R ER++++ SD AIQLDLI KV GIS+AE++FL+LP++ KDRR+YGSLLNA
Sbjct  118  LEVYDWMNKRGERFRLSASDAAIQLDLIGKVRGISDAEEFFLSLPDNFKDRRVYGSLLNA  177

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR   REKAE+L D MR +GY  + LP+N+M+ LYM
Sbjct  178  YVRAKSREKAEALIDIMRQKGYALHPLPFNVMMTLYM  214



>gb|EPS66397.1| hypothetical protein M569_08380, partial [Genlisea aurea]
Length=447

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++ITTSDTAI+LDLI+KVHGI +AE YF  L + LKD+RIYGSLLN 
Sbjct  77   LEVFDWMNNRPERFRITTSDTAIRLDLIAKVHGIPSAESYFSRLTDELKDKRIYGSLLNV  136

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y R  MRE+AE+L D+MR RGY    LPYN+M+ LY+
Sbjct  137  YARAKMREEAETLMDKMRTRGYATQPLPYNVMMTLYL  173



>ref|XP_006306047.1| hypothetical protein CARUB_v10011354mg [Capsella rubella]
 gb|EOA38945.1| hypothetical protein CARUB_v10011354mg [Capsella rubella]
Length=524

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI KV GIS+AE++FLTLP + KDRR+YGSLLNA
Sbjct  117  LEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDAEEFFLTLPETFKDRRVYGSLLNA  176

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR   REKAE+L + MR +GY  + LP+N+M+ LYM
Sbjct  177  YVRAKSREKAEALLNTMREKGYALHPLPFNVMMTLYM  213



>ref|XP_002892022.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68281.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=523

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI KV GIS+AE++FLTLP + KDRR+YGSLLNA
Sbjct  118  LEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDAEQFFLTLPENFKDRRVYGSLLNA  177

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR   REKAE+L   MR++GY  + LP+N+M+ LYM
Sbjct  178  YVRAKSREKAEALLHTMRDKGYALHPLPFNVMMTLYM  214



>gb|KDP28877.1| hypothetical protein JCGZ_14648 [Jatropha curcas]
Length=528

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI+KV G+ +AE +F  LP+S+KDRRIYG+LLNA
Sbjct  122  LEVYDWMNNREERFRVSASDAAIQLDLIAKVRGVYSAEDFFFRLPDSVKDRRIYGALLNA  181

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  MREKAE   D+MRN+GY    LP+N+M+ LYM
Sbjct  182  YVRAKMREKAECWIDDMRNKGYANQALPFNVMMTLYM  218



>ref|XP_010692029.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Beta vulgaris subsp. vulgaris]
Length=535

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW+N+R ER+++++SDTAIQLDLI+KV G+S+AE YF+ LP++LKD+RIYG+LLNA
Sbjct  122  LEVYEWMNNRIERFRLSSSDTAIQLDLIAKVRGVSSAEDYFMRLPDTLKDKRIYGALLNA  181

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV    REKAESL + MR +GY ++ LP+N+M+ LYM
Sbjct  182  YVGAKEREKAESLMERMRTKGYAQHPLPFNVMMTLYM  218



>ref|XP_008344410.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Malus domestica]
Length=537

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 83/100 (83%), Gaps = 3/100 (3%)
 Frame = +1

Query  1    VEVC---EWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSL  171
            +E C   +W+++R ER++I+TSD AIQLDL++KV G+++AE YFL+LP +LKDRRIYG+L
Sbjct  121  IEGCMVYDWMSNRGERFRISTSDAAIQLDLVAKVRGVASAENYFLSLPGTLKDRRIYGAL  180

Query  172  LNAYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            LNAYVR  M+EKAE+L D+MR +G+   +LP+N+M+ LYM
Sbjct  181  LNAYVRARMKEKAEALLDKMRTKGHALQSLPFNVMMTLYM  220



>ref|XP_004307244.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Fragaria vesca subsp. vesca]
Length=541

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+ +RAER++ ++SD AIQLDL+ KV G+S+AE YFL+LP++LKD+RIYG+LLNA
Sbjct  121  LEVYDWMINRAERFRFSSSDAAIQLDLVGKVRGVSSAENYFLSLPDNLKDKRIYGALLNA  180

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  M+EKAESL D+MR++G+  + LP+N+M+ LYM
Sbjct  181  YVRAKMQEKAESLLDKMRSKGHALHPLPFNVMMTLYM  217



>emb|CDY15126.1| BnaC05g00050D [Brassica napus]
Length=512

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N R ER++++ SD AIQLDLI KV GIS+AE++FL+LP++ KDRR+YGSLLNA
Sbjct  118  LEVYDWMNKRDERFRLSASDAAIQLDLIGKVRGISDAEEFFLSLPDNFKDRRVYGSLLNA  177

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR   REKAE+L D MR +GY  + LP+N+M+ LYM
Sbjct  178  YVRAKSREKAEALIDIMRQKGYALHPLPFNVMMTLYM  214



>ref|XP_008343643.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
isoform X2 [Malus domestica]
Length=421

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+++R ER++I+TSD AIQLDL +KV G+++AE YFL+LP++LKDRRIYG+LLNA
Sbjct  122  LEVYDWMSNRGERFRISTSDAAIQLDLFAKVRGVASAENYFLSLPDTLKDRRIYGALLNA  181

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  M++KAE+L ++MR +G+   +LP+N+M+ LYM
Sbjct  182  YVRARMKQKAEALLEKMRTKGHALQSLPFNVMMTLYM  218



>ref|XP_007052357.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOX96514.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
Length=549

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI+KV G+S+AE +F+ LP+++KD+RIYG+LLNA
Sbjct  121  LEVYDWMNNRGERFRLSASDAAIQLDLIAKVRGVSSAEDFFVQLPDTMKDKRIYGALLNA  180

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  MR+KAE+L D MR +GY  + LP+N+M+ LYM
Sbjct  181  YVRAKMRDKAETLIDNMRGKGYAMHPLPFNVMMTLYM  217



>ref|XP_008343638.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
isoform X1 [Malus domestica]
Length=535

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+++R ER++I+TSD AIQLDL +KV G+++AE YFL+LP++LKDRRIYG+LLNA
Sbjct  122  LEVYDWMSNRGERFRISTSDAAIQLDLFAKVRGVASAENYFLSLPDTLKDRRIYGALLNA  181

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR  M++KAE+L ++MR +G+   +LP+N+M+ LYM
Sbjct  182  YVRARMKQKAEALLEKMRTKGHALQSLPFNVMMTLYM  218



>ref|XP_009375366.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Pyrus x bretschneideri]
Length=534

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+++R ER++I+TSD AIQLDL +KV G+++AE YFL+LP++LKDRRIYG+LLNA
Sbjct  122  LEVYDWMSNRGERFRISTSDAAIQLDLFAKVRGVASAENYFLSLPDTLKDRRIYGALLNA  181

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV   M+EKAE+L D+MR +G+   +LP+N+M+ LYM
Sbjct  182  YVWARMKEKAEALLDKMRTKGHALQSLPFNVMMTLYM  218



>ref|XP_010246096.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Nelumbo nucifera]
Length=515

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW+ ++ +R+++ +SD AIQLDLISKVHGIS AE YF  LP +LKDRR YGSLLNA
Sbjct  123  LEVYEWMTNQGDRFRVASSDAAIQLDLISKVHGISTAEDYFSRLPETLKDRRTYGSLLNA  182

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  MREKAE++ +EMR +GY  + LPYN+M+ LYM
Sbjct  183  YAQSKMREKAENVIEEMRKKGYANHPLPYNVMMTLYM  219



>ref|XP_004133941.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Cucumis sativus]
 ref|XP_004169913.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Cucumis sativus]
 gb|KGN56639.1| hypothetical protein Csa_3G127020 [Cucumis sativus]
Length=537

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ +W+++R ER+++TTSD AIQLDLISKV GI +AE+YFL LPN LKDRRIYG+LLNA
Sbjct  122  LEIYDWMSNREERFRLTTSDAAIQLDLISKVRGIKSAEEYFLRLPNHLKDRRIYGALLNA  181

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +   REKAE+L ++MR +G+T + LP+N+M+ LYM
Sbjct  182  YAKGRQREKAENLLEKMRTKGFTTHPLPFNVMMTLYM  218



>ref|XP_007052358.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
 ref|XP_007052359.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOX96515.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOX96516.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
Length=420

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +1

Query  7    VCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYV  186
            V +W+N+R ER++++ SD AIQLDLI+KV G+S+AE +F+ LP+++KD+RIYG+LLNAYV
Sbjct  2    VYDWMNNRGERFRLSASDAAIQLDLIAKVRGVSSAEDFFVQLPDTMKDKRIYGALLNAYV  61

Query  187  RVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            R  MR+KAE+L D MR +GY  + LP+N+M+ LYM
Sbjct  62   RAKMRDKAETLIDNMRGKGYAMHPLPFNVMMTLYM  96



>gb|AAM19786.1| At1g02150/T7I23.8 [Arabidopsis thaliana]
 gb|AAO64747.1| At1g02150/T7I23.8 [Arabidopsis thaliana]
Length=524

 Score =   131 bits (330),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI KV GI +AE++FL LP + KDRR+YGSLLNA
Sbjct  119  IEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGIPDAEEFFLQLPENFKDRRVYGSLLNA  178

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR   REKAE+L + MR++GY  + LP+N+M+ LYM
Sbjct  179  YVRAKSREKAEALLNTMRDKGYALHPLPFNVMMTLYM  215



>emb|CBI16683.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW+N+R ER+++++SD AIQLDLI+KV G+S+AE YF  LP++LKD+RIYG+LLNA
Sbjct  44   LEVYEWMNNRGERFRLSSSDAAIQLDLIAKVCGVSSAEDYFSRLPDTLKDKRIYGALLNA  103

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  MR+KAE L +++RN+GY    LP+N+M+ LYM
Sbjct  104  YVQAKMRDKAEILIEKLRNKGYATTPLPFNVMMTLYM  140



>ref|XP_010089787.1| hypothetical protein L484_008037 [Morus notabilis]
 gb|EXB38379.1| hypothetical protein L484_008037 [Morus notabilis]
Length=546

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER+++++SD AIQLDLI KV GIS+AE +FL+L ++ KDRRIYG+LLNA
Sbjct  128  LEVYDWMNNRGERFRLSSSDAAIQLDLIGKVRGISSAENFFLSLSDTSKDRRIYGALLNA  187

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  M+EKAESL D MR +GY  ++LP+N+M+ LYM
Sbjct  188  YVQARMKEKAESLLDRMRGKGYAIHSLPFNVMMTLYM  224



>ref|NP_171717.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q8LPS6.2|PPR3_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g02150 
[Arabidopsis thaliana]
 gb|AAC24372.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE27393.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=524

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI KV GI +AE++FL LP + KDRR+YGSLLNA
Sbjct  119  LEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGIPDAEEFFLQLPENFKDRRVYGSLLNA  178

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR   REKAE+L + MR++GY  + LP+N+M+ LYM
Sbjct  179  YVRAKSREKAEALLNTMRDKGYALHPLPFNVMMTLYM  215



>ref|XP_002270492.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Vitis vinifera]
Length=527

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW+N+R ER+++++SD AIQLDLI+KV G+S+AE YF  LP++LKD+RIYG+LLNA
Sbjct  110  LEVYEWMNNRGERFRLSSSDAAIQLDLIAKVCGVSSAEDYFSRLPDTLKDKRIYGALLNA  169

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  MR+KAE L +++RN+GY    LP+N+M+ LYM
Sbjct  170  YVQAKMRDKAEILIEKLRNKGYATTPLPFNVMMTLYM  206



>ref|XP_008438222.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Cucumis melo]
Length=537

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ +W+++R ER+++TTSD AIQLDLISKV GI +AE YFL LP++LKDRRIYG+LLNA
Sbjct  122  LEIYDWMSNREERFRLTTSDAAIQLDLISKVRGIKSAEDYFLRLPDNLKDRRIYGALLNA  181

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +   REKAE+L  +MR +GY  + LP+N+M+ LYM
Sbjct  182  YAKARQREKAENLLAKMRTKGYATHPLPFNVMMTLYM  218



>gb|KEH18913.1| PPR containing plant protein [Medicago truncatula]
Length=300

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V +WIN+R ER++I+ SD AIQLDLI++VHG+S+AE +FL L N LKD+R YG+LLNA
Sbjct  156  LQVYDWINNRPERFRISASDVAIQLDLIARVHGVSSAEGFFLNLTNDLKDKRTYGALLNA  215

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV    REKAESL + MR++ Y  ++LP+NLM+ LYM
Sbjct  216  YVHSRSREKAESLLEVMRSKRYLIHSLPFNLMMTLYM  252



>emb|CAN75355.1| hypothetical protein VITISV_002476 [Vitis vinifera]
Length=736

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +1

Query  4    EVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAY  183
            +V EW+N+R ER+++++SD AIQLDLI+KV G+S+AE YF  LP++LKD+RIYG+LLNAY
Sbjct  320  KVYEWMNNRGERFRLSSSDAAIQLDLIAKVCGVSSAEDYFSRLPDTLKDKRIYGALLNAY  379

Query  184  VRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            V+  MR+KAE L +++RN+GY    LP+N+M+ LYM
Sbjct  380  VQAKMRDKAEILIEKLRNKGYATTPLPFNVMMTLYM  415



>ref|XP_002526471.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF35862.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=533

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDL++KV G+S+AE YF+ L +++KDRR+YG+LLN+
Sbjct  121  LEVYDWMNNREERFRLSASDAAIQLDLVAKVRGVSSAEDYFMRLSDNVKDRRVYGALLNS  180

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  MREKAESL ++MR + YT + LP+N+M+ LYM
Sbjct  181  YVKARMREKAESLIEKMRKKDYTTHALPFNVMMTLYM  217



>ref|XP_010540211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Tarenaya hassleriana]
Length=561

 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V +W+++R ER++++ SD AIQLDLI KV GIS+AE  FL LP++ KDRR+YG+LLNA
Sbjct  141  LQVYDWMSNRGERFRLSASDAAIQLDLIGKVRGISSAEDVFLRLPDNFKDRRVYGALLNA  200

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR   REKAE+L  +MR +GY  + LP+N+M+ LYM
Sbjct  201  YVRAKSREKAEALIGQMREKGYAMHPLPFNVMMTLYM  237



>ref|XP_004515320.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Cicer arietinum]
Length=543

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +WIN+R ER++I+ SD AIQLDLI++VHG+S+AE +FL L N LKD+R YG+LLNA
Sbjct  127  LQIYDWINNRPERFRISASDAAIQLDLIARVHGVSSAEGFFLNLVNDLKDKRTYGALLNA  186

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV    REKAESL D MR++ Y  ++LP+NLM+ LYM
Sbjct  187  YVHSRSREKAESLLDVMRSKRYLIHSLPFNLMMTLYM  223



>ref|XP_007134411.1| hypothetical protein PHAVU_010G045500g [Phaseolus vulgaris]
 gb|ESW06405.1| hypothetical protein PHAVU_010G045500g [Phaseolus vulgaris]
Length=542

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +WIN+R ER++++ SD AIQLDLI+KV G S+AE +FL+L + LK++R YG+LLN 
Sbjct  123  LEVYDWINNRPERFRVSESDAAIQLDLIAKVRGFSSAEVFFLSLEDQLKNKRTYGALLNV  182

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV   ++EKAESLFD MR++GY  + LP+N+M+ LYM
Sbjct  183  YVHSRLKEKAESLFDTMRSKGYVVHALPFNVMMTLYM  219



>ref|XP_003530115.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Glycine max]
 gb|KHN12244.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=546

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI+KV G+S+AE +FL+L + LKD++ YG+LLN 
Sbjct  133  LEVYDWMNNRPERFRVSESDAAIQLDLIAKVRGLSSAEAFFLSLEDKLKDKKTYGALLNV  192

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV    +EKAESLFD MR++GY  + LP+N+M+ LYM
Sbjct  193  YVHSRSKEKAESLFDTMRSKGYVIHALPFNVMMTLYM  229



>ref|XP_003520417.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Glycine max]
Length=555

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+N+R ER++++ SD AIQLDLI+KV G+S+AE +FL+L + LKD+R YG+LLN 
Sbjct  132  LEVYDWMNNRPERFRVSESDAAIQLDLIAKVRGVSSAEAFFLSLEDKLKDKRTYGALLNV  191

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV    +EKAESLFD MR++GY  + LP N+M+ LYM
Sbjct  192  YVHSRSKEKAESLFDTMRSKGYVIHALPINVMMTLYM  228



>ref|XP_003636175.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=790

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V +W+N+R ER++I+ SD AIQLDLI++VHG+S+AE +FL L N LKD+R YG+LLNA
Sbjct  295  LQVYDWMNNRPERFRISASDVAIQLDLIARVHGVSSAESFFLNLTNDLKDKRTYGALLNA  354

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV    REKAESL + MR++ Y  ++LP+NLM+ L M
Sbjct  355  YVHSRSREKAESLLEVMRSKRYLTHSLPFNLMMTLSM  391



>ref|XP_010933566.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Elaeis guineensis]
Length=508

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVC+W+  + +R+  T+SD AIQLDLI+K HGIS AE++F  LP++LKD+R YG+LLN 
Sbjct  125  LEVCDWMTAQGDRFMFTSSDMAIQLDLIAKAHGISRAEEHFSQLPDTLKDKRTYGALLNV  184

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y R  M+EKAE++ + MRN+GY    L +N+M+ LYM
Sbjct  185  YGRAKMKEKAEAIVEVMRNKGYLTEALIFNVMMTLYM  221



>emb|CAE04345.1| OSJNBb0038F03.9 [Oryza sativa Japonica Group]
Length=511

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V +W+ +R +R+ +++SD AIQLDLI+KV G+S+AE+YF  LP+ LKD+R YGSLLN 
Sbjct  127  LQVYDWMTERRDRFSLSSSDMAIQLDLIAKVRGVSHAEEYFEELPDPLKDKRTYGSLLNV  186

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M+EK ES F++MR +G+  +TLP+N+++N Y+
Sbjct  187  YAQAMMKEKTESTFEQMRKKGFATDTLPFNVLMNFYV  223



>gb|EAY95037.1| hypothetical protein OsI_16851 [Oryza sativa Indica Group]
Length=511

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V +W+ +R +R+ +++SD AIQLDLI+KV G+S+AE+YF  LP+ LKD+R YGSLLN 
Sbjct  127  LQVYDWMTERRDRFSLSSSDMAIQLDLIAKVRGVSHAEEYFEELPDPLKDKRTYGSLLNV  186

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M+EK ES F++MR +G+  +TLP+N+++N Y+
Sbjct  187  YAQAMMKEKTESTFEQMRKKGFATDTLPFNVLMNFYV  223



>ref|NP_001053460.2| Os04g0544400 [Oryza sativa Japonica Group]
 dbj|BAF15374.2| Os04g0544400 [Oryza sativa Japonica Group]
Length=571

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V +W+ +R +R+ +++SD AIQLDLI+KV G+S+AE+YF  LP+ LKD+R YGSLLN 
Sbjct  127  LQVYDWMTERRDRFSLSSSDMAIQLDLIAKVRGVSHAEEYFEELPDPLKDKRTYGSLLNV  186

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M+EK ES F++MR +G+  +TLP+N+++N Y+
Sbjct  187  YAQAMMKEKTESTFEQMRKKGFATDTLPFNVLMNFYV  223



>gb|EAZ31514.1| hypothetical protein OsJ_15655 [Oryza sativa Japonica Group]
Length=531

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +1

Query  4    EVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAY  183
            +V +W+ +R +R+ +++SD AIQLDLI+KV G+S+AE+YF  LP+ LKD+R YGSLLN Y
Sbjct  148  DVYDWMTERRDRFSLSSSDMAIQLDLIAKVRGVSHAEEYFEELPDPLKDKRTYGSLLNVY  207

Query  184  VRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
             +  M+EK ES F++MR +G+  +TLP+N+++N Y+
Sbjct  208  AQAMMKEKTESTFEQMRKKGFATDTLPFNVLMNFYV  243



>dbj|BAJ85010.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+ DR +R+ +++SD AIQLDLI+KV G+ +AE+YF  LP+ LKD+R YGSLLN 
Sbjct  119  LEVYDWMTDRRDRFSLSSSDMAIQLDLIAKVRGVPDAEEYFEKLPDPLKDKRTYGSLLNV  178

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M+EK E  F++MR +G+  +TLP+N+++N Y+
Sbjct  179  YAQARMKEKTEYTFEQMRKKGFATDTLPFNVLMNFYV  215



>ref|XP_010919766.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Elaeis guineensis]
Length=506

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+  + ER+  T+SD AIQLDLI+KVHGIS+AE++F  LP++ KDRR YG+LLN 
Sbjct  124  LEVYDWMTAQGERFTFTSSDMAIQLDLIAKVHGISHAEEHFSKLPDTFKDRRAYGALLNV  183

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y R  M+EKAE + + MRN+GYT   L +N+++ LYM
Sbjct  184  YGRAKMKEKAEDIVEVMRNKGYTTEALFFNVLMTLYM  220



>gb|EEC77735.1| hypothetical protein OsI_16848 [Oryza sativa Indica Group]
Length=1300

 Score =   121 bits (303),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V +W+ +R +R+ +++SD AIQLDLI+KV G+S+AE+YF  LP+ LKD+R YGSLLN 
Sbjct  127  LQVYDWMTERRDRFSLSSSDMAIQLDLIAKVRGVSHAEEYFEELPDPLKDKRTYGSLLNV  186

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M+EK ES F++MR +G+  +TLP+N+++N Y+
Sbjct  187  YAQAMMKEKTESTFEQMRKKGFATDTLPFNVLMNFYV  223



>ref|XP_006652599.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Oryza brachyantha]
Length=511

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V +W+ +R +R+ +++SD AIQLDLI+KV G+++AE+YF  LP+ LKD+R YGSLLN 
Sbjct  127  LQVYDWMTERRDRFSLSSSDMAIQLDLIAKVRGVAHAEEYFEELPDPLKDKRTYGSLLNV  186

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M+EK ES F++MR +G+  +TLP+N+++N Y+
Sbjct  187  YAQAMMKEKTESTFEQMRKKGFATDTLPFNVLMNFYV  223



>ref|XP_002448264.1| hypothetical protein SORBIDRAFT_06g024190 [Sorghum bicolor]
 gb|EES12592.1| hypothetical protein SORBIDRAFT_06g024190 [Sorghum bicolor]
Length=515

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V +W+ +R +R+ +++SD AIQLDLI+KV G+S+AEKYF  LP+++KD+R YGSLLN 
Sbjct  131  LQVYDWMTERRDRFSLSSSDMAIQLDLIAKVRGVSHAEKYFDELPDAMKDKRTYGSLLNV  190

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M+EK E  F++MR +G+  +TLP N+++N Y+
Sbjct  191  YAQAMMKEKTEDTFEQMRKKGFASDTLPCNVLMNFYV  227



>dbj|BAK02297.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+ DR +R+ +++SD AIQLDLI+KV G+ + E+YF  LP+ LKD+R YGSLLN 
Sbjct  119  LEVYDWMTDRRDRFSLSSSDMAIQLDLIAKVRGVPDTEEYFEKLPDPLKDKRTYGSLLNV  178

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M+EK E  F++MR +G+  +TLP+N+++N Y+
Sbjct  179  YAQARMKEKTEYTFEQMRKKGFATDTLPFNVLMNFYV  215



>gb|KHN31110.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=418

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  19   INDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGM  198
            +N+R ER++++ SD AIQLDLI+KV G+S+AE +FL+L + LKD+R YG+LLN YV    
Sbjct  1    MNNRPERFRVSESDAAIQLDLIAKVRGVSSAEAFFLSLEDKLKDKRTYGALLNVYVHSRS  60

Query  199  REKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            +EKAESLFD MR++GY  + LP N+M+ LYM
Sbjct  61   KEKAESLFDTMRSKGYVIHALPINVMMTLYM  91



>gb|KEH17920.1| PPR containing plant-like protein [Medicago truncatula]
Length=407

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  19   INDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGM  198
            +N+R ER++I+ SD AIQLDLI++VHG+S+AE +FL L N LKD+R YG+LLNAYV    
Sbjct  1    MNNRPERFRISASDVAIQLDLIARVHGVSSAESFFLNLTNDLKDKRTYGALLNAYVHSRS  60

Query  199  REKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            REKAESL + MR++ Y  ++LP+NLM+ L M
Sbjct  61   REKAESLLEVMRSKRYLTHSLPFNLMMTLSM  91



>ref|XP_010227218.1| PREDICTED: uncharacterized protein LOC100829762 [Brachypodium 
distachyon]
Length=987

 Score =   118 bits (295),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V +W+ +R +R+ +++SD AIQLDL++KV G+ +AE+YF +LP+ LKD+R YGSLLN 
Sbjct  603  LQVYDWMTERRDRFSLSSSDMAIQLDLVAKVRGVPHAEEYFESLPDPLKDKRTYGSLLNV  662

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M+EK E  F++MR +GY  +TLP+N+++N Y+
Sbjct  663  YAQARMKEKTEDTFEQMRKKGYASDTLPFNVLMNFYV  699



>ref|XP_008786192.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Phoenix dactylifera]
Length=508

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVC+W+  + +R+  T+SD AIQ+DLI+K HGIS+AE+YF  LP+++KD+R YG+LLN 
Sbjct  126  LEVCDWMIAQGDRFMFTSSDMAIQVDLIAKAHGISHAEEYFSQLPDTMKDKRTYGALLNV  185

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M+EKAE++ + MRN+GY    L +N+++ LYM
Sbjct  186  YGQAKMKEKAEAIVEVMRNKGYLTEALFFNVIMTLYM  222



>ref|XP_004956425.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Setaria italica]
Length=513

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V +W+ +R +R+ +++SD AIQLDLI+KV G+S+AEKYF  LP+ LKD+R YGSLLN 
Sbjct  129  LQVYDWMTERRDRFPLSSSDMAIQLDLIAKVRGVSHAEKYFEELPDPLKDKRTYGSLLNV  188

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M++K E  F++MR +G+  +TLP N+++N Y+
Sbjct  189  YAQAMMKDKTEDTFEKMRKKGFASDTLPCNVLMNFYV  225



>ref|NP_001168310.1| hypothetical protein [Zea mays]
 gb|ACN27772.1| unknown [Zea mays]
 tpg|DAA36624.1| TPA: hypothetical protein ZEAMMB73_688721 [Zea mays]
Length=513

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V +W+ +R +R+ +++SD AIQLDLI+KV G+ +AEKYF  LP+++KD+R YGSLLN 
Sbjct  129  LQVYDWMTERRDRFPLSSSDMAIQLDLIAKVRGVPHAEKYFDELPDAMKDKRTYGSLLNV  188

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M+EK E  F++MR +G+  +TLP N+++N Y+
Sbjct  189  YAQAMMKEKTEETFEQMRKKGFASDTLPCNVLMNFYV  225



>gb|EMT27370.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=949

 Score =   115 bits (289),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  4    EVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAY  183
            +V +W+ DR +R+ +++SD AIQLDLI+KV G+ +AE+YF  LP+ LKD+R YGSLLN Y
Sbjct  564  KVYDWMTDRRDRFSLSSSDMAIQLDLIAKVRGVPDAEEYFEKLPDPLKDKRTYGSLLNVY  623

Query  184  VRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
             +  M+EK E  F++MR + +  +TLP+N+++N Y+
Sbjct  624  AQARMKEKTEYTFEQMRKKAFATDTLPFNVLMNFYV  659



>ref|XP_008794909.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Phoenix dactylifera]
Length=507

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+  + +R+  T+SD AIQLDLI+KVHGI +AE++F  LP++LKD+R YG+LLN 
Sbjct  124  LEVYDWMTAQRDRFTFTSSDMAIQLDLIAKVHGILHAEEHFSKLPDTLKDKRAYGALLNV  183

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M+EKAE + +EMRN GY    L +N+M+ LYM
Sbjct  184  YGQAKMKEKAEDIIEEMRNNGYATEALFFNVMMTLYM  220



>ref|XP_009387580.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150, 
partial [Musa acuminata subsp. malaccensis]
Length=377

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +1

Query  7    VCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYV  186
            V  W+  + +R+ +T+SD AIQLDLI+KVHGIS+AE +F  LP++LKD+R YG+LLN Y 
Sbjct  1    VYNWMAAQGDRFTLTSSDMAIQLDLIAKVHGISHAEDHFSNLPDNLKDKRTYGALLNVYG  60

Query  187  RVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            +  + +KAE++ + M+++GY  + LP+N+M+ LYM
Sbjct  61   QAKIEDKAEAIMETMKSKGYASDALPFNVMMTLYM  95



>gb|AGN52922.1| hypothetical protein, partial [Silene latifolia]
Length=271

 Score =   110 bits (275),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +1

Query  52   TSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFDEM  231
            +SDTAIQ+DLI+KVHGI +AE YF  +P++LKD R+YG+LLNAYV   +R+KAE+L ++M
Sbjct  1    SSDTAIQVDLIAKVHGIPSAEDYFTRVPDTLKDMRLYGALLNAYVGAKIRDKAETLMEQM  60

Query  232  RNRGYTRNTLPYNLMLNLYM  291
            RN+GY    LPYN+M+ LYM
Sbjct  61   RNKGYCITPLPYNVMMTLYM  80



>ref|XP_006838525.1| hypothetical protein AMTR_s00002p00190720 [Amborella trichopoda]
 gb|ERN01094.1| hypothetical protein AMTR_s00002p00190720 [Amborella trichopoda]
Length=390

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V EW+  + E++ +++SD AIQLDL++KVHG+S+AE  F+ L +  K+ R YG++L+ 
Sbjct  110  LQVYEWMISKGEKFTLSSSDIAIQLDLVAKVHGMSSAEDIFVKLSDFQKNERTYGAILHV  169

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +   REKAE++F++M+      N LP+N M+NLYM
Sbjct  170  YSQSKEREKAETIFEKMKKESLITNALPFNEMMNLYM  206



>emb|CBI21840.3| unnamed protein product [Vitis vinifera]
Length=446

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ EWI D+   + I+  D AIQLDLISKVHG+  AEKYF   PNSL+  ++YG+LLN 
Sbjct  87   LEIYEWIRDKF-YFDISPGDVAIQLDLISKVHGLEQAEKYFNETPNSLRSFQVYGALLNC  145

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y +    EKAE++  EMR+ G+ + TL YN+ML LY
Sbjct  146  YSQKKSLEKAEAIMQEMRDMGFVK-TLSYNVMLGLY  180



>emb|CAN73453.1| hypothetical protein VITISV_024964 [Vitis vinifera]
Length=499

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ EWI D+   + I+  D AIQLDLISKVHG+  AEKYF   PNSL+  ++YG+LLN 
Sbjct  87   LEIYEWIRDKF-YFDISPGDVAIQLDLISKVHGLEQAEKYFNETPNSLRSFQVYGALLNC  145

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y +    EKAE++  EMR+ G+ + TL YN+ML LY
Sbjct  146  YSQKKSLEKAEAIMQEMRDMGFVK-TLSYNVMLGLY  180



>ref|XP_002273904.2| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, 
mitochondrial [Vitis vinifera]
Length=968

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ EWI D+   + I+  D AIQLDLISKVHG+  AEKYF   PNSL+  ++YG+LLN 
Sbjct  556  LEIYEWIRDKF-YFDISPGDVAIQLDLISKVHGLEQAEKYFNETPNSLRSFQVYGALLNC  614

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y +    EKAE++  EMR+ G+ + TL YN+ML LY
Sbjct  615  YSQKKSLEKAEAIMQEMRDMGFVK-TLSYNVMLGLY  649


 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ +W+ DR   + +T SD AI+LDLIS VHG   AE YF  +PN+LK    YG+LL+ 
Sbjct  74   LEISQWMTDR-RYFTLTPSDAAIRLDLISMVHGRVQAESYFNNIPNNLKTSSAYGALLSG  132

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YVR    EKAE+   +MR   +  ++ PYN+++NLY
Sbjct  133  YVREKSVEKAEATMQKMREMDFATSSFPYNMLINLY  168



>ref|XP_008241137.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Prunus mume]
Length=303

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 60/91 (66%), Gaps = 1/91 (1%)
 Frame = +1

Query  16   WINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVG  195
            W+ D+   + +  +D AIQLDLISKVHGI  AE YF  +P  LK   +Y +LLN Y  V 
Sbjct  2    WLTDK-RYFSLIKADVAIQLDLISKVHGIEQAENYFENIPKQLKAHEVYSTLLNCYAHVK  60

Query  196  MREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            + EKAE+   +MR+ G+ R +L YN++LNLY
Sbjct  61   LVEKAEATMQKMRDLGFARTSLVYNVLLNLY  91



>ref|XP_006849761.1| hypothetical protein AMTR_s00024p00251490 [Amborella trichopoda]
 gb|ERN11342.1| hypothetical protein AMTR_s00024p00251490 [Amborella trichopoda]
Length=501

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV +W+     +Y++ + D AI LDLISKV+G  +AE+YFL LP  +K++  Y +LLN 
Sbjct  135  LEVSDWLIQHGTKYQLRSGDYAIHLDLISKVNGPHHAERYFLQLPKGMKNKLTYSALLNV  194

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  M+E+AE+   +MR  G+  + LPYN M+ LY+
Sbjct  195  YVKENMKERAETTMKKMRMLGFLTSALPYNRMMTLYL  231



>ref|XP_010272479.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Nelumbo nucifera]
Length=502

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ +W+ +R   ++++ SD A++LDLISKVHG+ +AEKYF ++ N LK  + YG+LLN 
Sbjct  85   LEISQWMTNR-RYFELSPSDAAMRLDLISKVHGLEHAEKYFASISNKLKALKTYGALLNC  143

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YVR    EKAE+L   M++ G+   + PYN+++ LY
Sbjct  144  YVREKSVEKAEALVQNMKSMGFATTSFPYNMLIILY  179



>gb|KJB50098.1| hypothetical protein B456_008G153900 [Gossypium raimondii]
Length=507

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV E++++   RY I+  D A++LDLISKVHGI  AEKYF +LP++++  ++YG+LLN 
Sbjct  92   LEVSEFMSEEM-RYGISVGDMAVRLDLISKVHGIEQAEKYFDSLPDTMRTFQVYGALLNC  150

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE+    MR  G+  N + YN+MLNLY
Sbjct  151  YAHHKCLEKAEATLQIMRESGHLSNAVSYNVMLNLY  186



>ref|XP_007198902.1| hypothetical protein PRUPE_ppa005316mg [Prunus persica]
 gb|EMJ00101.1| hypothetical protein PRUPE_ppa005316mg [Prunus persica]
Length=467

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EW++D A  Y ++  D AI+LDLISKV G+  AE YF +LP+ L++ ++YG+LL  
Sbjct  89   LQISEWMSD-ARNYDLSHGDIAIRLDLISKVCGLEQAEMYFNSLPDPLRNFKVYGALLFC  147

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             V     EKAE+LF++M+  GY +  LPYN+ML LY
Sbjct  148  SVEHKSLEKAENLFEKMKELGYVKGPLPYNVMLTLY  183



>ref|XP_008349216.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Malus domestica]
Length=509

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+  W++D+   +++T +D AI+LDLI+KVHGI  AE YF  +P +LK   +Y +LLN+
Sbjct  96   LEISMWLSDK-RYFELTIADVAIRLDLIAKVHGIEQAEDYFNNIPKNLKVLEVYCALLNS  154

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y R  + EKAE +  +MR  G+ R +L YN +LNLY
Sbjct  155  YARAKLVEKAEDIMQKMRELGFARTSLSYNNLLNLY  190



>gb|KDP24136.1| hypothetical protein JCGZ_25793 [Jatropha curcas]
Length=457

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +1

Query  7    VCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYV  186
            + +W+ D+   + ++  D A+QLDLI+KV+G+   EKYF ++P + +  ++Y +LLN Y 
Sbjct  77   ISQWMTDQ-RCFNLSPGDVAVQLDLITKVYGLEEVEKYFSSIPENSRGCQVYDALLNCYA  135

Query  187  RVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
                 EKAE+L ++M+  G+ +N+LPYN+MLNLY
Sbjct  136  HTKQLEKAEALMEKMKELGFIKNSLPYNVMLNLY  169



>gb|KDP24137.1| hypothetical protein JCGZ_25794 [Jatropha curcas]
Length=475

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+ D+   + ++  D AIQLDLI+KV+G   AEKYF ++P + +  + YG+LLN 
Sbjct  87   LQISQWMTDQ-RCFILSPGDVAIQLDLITKVYGFEEAEKYFSSIPENSRGYQAYGALLNC  145

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE++ ++M+  G+ +N LPYN+ML LY
Sbjct  146  YAHTKRLEKAEAVMEKMKELGFVKNALPYNIMLGLY  181



>ref|XP_009379667.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Pyrus x bretschneideri]
Length=502

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV  W++D+   +++T  D AI+LDLI KVHGI  AE YF  +P  LK R +Y +LLN 
Sbjct  97   LEVSMWLSDK-RYFELTIPDVAIRLDLIGKVHGIKQAEDYFNNIPKQLKGRDVYCALLNI  155

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            +    + EKAE +   MR+ G+ R  L YN++LNLY
Sbjct  156  FAHAKLVEKAEEIMQTMRDLGFARTLLSYNILLNLY  191



>emb|CBI21839.3| unnamed protein product [Vitis vinifera]
Length=501

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ +W+ DR   + +T SD AI+LDLIS VHG   AE YF  +PN+LK    YG+LL+ 
Sbjct  74   LEISQWMTDR-RYFTLTPSDAAIRLDLISMVHGRVQAESYFNNIPNNLKTSSAYGALLSG  132

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YVR    EKAE+   +MR   +  ++ PYN+++NLY
Sbjct  133  YVREKSVEKAEATMQKMREMDFATSSFPYNMLINLY  168



>ref|XP_010242929.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial [Nelumbo nucifera]
Length=500

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ +W+ D+   + ++  D AI+LDLI+KVHG+  AEKYF  +P  L+  + YG+LLN 
Sbjct  87   LEISQWMTDQ-RYFDLSAGDAAIRLDLITKVHGLGEAEKYFDYIPTQLRVFQTYGALLNC  145

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      +KAE+LF +M+  G+ +  L YN+MLNLY
Sbjct  146  YTHEKSVDKAEALFQKMKELGFAKTVLTYNVMLNLY  181



>ref|XP_009357846.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Pyrus x bretschneideri]
Length=514

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EW++D   +Y +T  D A++LDLISKVH +  AE YF ++P+ L++ ++YG+LL +
Sbjct  89   LQISEWMSDARNQY-LTPGDIAVRLDLISKVHSLQQAEAYFNSIPDQLRNFKVYGALLFS  147

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YV     EKAE++F++M   GY + ++ YN ML LY
Sbjct  148  YVENKSSEKAETIFEKMNELGYLKGSVAYNAMLTLY  183



>ref|XP_010099566.1| hypothetical protein L484_011572 [Morus notabilis]
 gb|EXB79632.1| hypothetical protein L484_011572 [Morus notabilis]
Length=418

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
             ++ EW+++      ++  D A++LDL+SKVHG+  AE+YF ++P +L+  +IYG+LLN 
Sbjct  7    CQISEWMSE-GMNCDLSPGDVAVKLDLVSKVHGLDQAEEYFNSIPPALRADKIYGALLNC  65

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE LF +MR  G+ ++ L YN+ML+LY
Sbjct  66   YAEKKYLEKAERLFQKMRKLGFIKSNLSYNVMLSLY  101



>ref|XP_002517926.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF44444.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=504

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V EW+ D+ +   +   D A++LDLISKVHG+  AE+YF ++P++ +DR++YG+LLN 
Sbjct  91   LQVSEWMTDK-KGCSLLPGDVAVRLDLISKVHGLVKAEEYFNSIPDTSRDRQVYGALLNC  149

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
                 +  KAE+   +M++ G+ +N+L YN+ML+LY
Sbjct  150  CAHSKLLGKAEATMQKMKDLGFVKNSLSYNVMLSLY  185



>ref|XP_007203456.1| hypothetical protein PRUPE_ppa022158mg, partial [Prunus persica]
 gb|EMJ04655.1| hypothetical protein PRUPE_ppa022158mg, partial [Prunus persica]
Length=485

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV  W+ D+   + +  +D AI+LDLISKVHGI  AE YF  +P  LK   +Y +LLN 
Sbjct  98   LEVSMWMTDK-RYFSLMKADVAIRLDLISKVHGIEQAENYFENIPKQLKALEVYCTLLNC  156

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y  V + EKAE+   +MR+ G+ R  L YN +LNLY
Sbjct  157  YAHVKLVEKAEATMQKMRDLGFARTPLVYNALLNLY  192



>ref|XP_008366628.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Malus domestica]
Length=501

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV  W++D+   +++T  D AI+LDLI KVHGI  AE YF  +P  LK R +Y +LLN 
Sbjct  96   LEVSMWVSDK-RYFELTIPDVAIRLDLIGKVHGIKQAEDYFNNIPKQLKGRDVYCALLNV  154

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            +    + EKAE +   MR+ G+    L YN++LNLY
Sbjct  155  FAHAKLVEKAEEIMQTMRDLGFAXTPLSYNILLNLY  190



>ref|XP_008342918.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Malus domestica]
Length=514

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EW++D   +Y +T  D A++LDLISKV+G+  AE YF ++P+ L++ ++YG+LL +
Sbjct  89   LQISEWMSDAQNQY-LTPGDIAVRLDLISKVYGLQQAEAYFNSIPDQLRNFKVYGALLFS  147

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YV     EKAE +F++M   GY + +L YN ML LY
Sbjct  148  YVENKSSEKAEIIFEKMNKLGYLKGSLVYNAMLTLY  183



>ref|XP_008353787.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Malus domestica]
Length=514

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EW++D   +Y +T  D A++LDLISKV+G+  AE YF ++P+ L++ ++YG+LL +
Sbjct  89   LQISEWMSDAQNQY-LTPGDIAVRLDLISKVYGLQQAEAYFNSIPDQLRNFKVYGALLFS  147

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YV     EKAE +F++M   GY + +L YN ML LY
Sbjct  148  YVENKSSEKAEIIFEKMNKLGYLKGSLVYNAMLTLY  183



>ref|XP_010555122.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial [Tarenaya hassleriana]
Length=518

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EWI+++   Y ++  D AIQLDLI+KV G+  +EK+F T P  ++D  +YG+LLN 
Sbjct  103  LQILEWISEQ-RIYNLSAGDIAIQLDLIAKVRGLEESEKFFETTPVDVRDYHVYGALLNC  161

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y  +    KAE+ F +MR  G+ +  L YN+MLNLY
Sbjct  162  YASMNSVHKAEATFQKMREFGFIKGPLTYNVMLNLY  197



>ref|XP_002884218.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH60477.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=491

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+++    ++IT  D AI+LDLI+KV G+  AEK+F T+P   ++  +YG+LLN 
Sbjct  91   LQISDWMSEH-RVHEITEGDVAIRLDLIAKVGGLGEAEKFFETIPMERRNYHLYGALLNC  149

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y    +  KAE +F EM+  G+ +  LPYN+MLNLY+
Sbjct  150  YASKKVLHKAEQVFQEMKELGFLKGCLPYNVMLNLYV  186



>ref|XP_009342634.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g20710, mitochondrial-like [Pyrus x bretschneideri]
Length=412

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EW++D   +Y +T  D A++LDLISKV+ +  AE YF ++P+ L++ ++YG+LL +
Sbjct  89   LQISEWMSDAQNQY-LTPGDIAVRLDLISKVYSLQQAEAYFNSIPDQLRNFKVYGALLFS  147

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YV     EKAE++F++M   GY + +L YN ML LY
Sbjct  148  YVENKSSEKAETIFEKMNELGYLKGSLVYNAMLTLY  183



>ref|NP_001176986.1| Os12g0527850 [Oryza sativa Japonica Group]
 dbj|BAH95714.1| Os12g0527850 [Oryza sativa Japonica Group]
Length=313

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  ++   D A+ LDL++KV G+ +AEK+F  +P   K      +LL+A
Sbjct  80   LEICEWMRTQPE-MRLLPGDHAVHLDLVAKVRGLPSAEKFFEDMPERAKGPSTCNALLHA  138

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+ G R+KAE++ +EM   GY    LP+N M++LYM
Sbjct  139  YVQHGRRDKAEAMLEEMAKAGYLTCALPFNHMMSLYM  175



>ref|XP_006376506.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ERP54303.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=501

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W++D+   + ++  D A++LDLISKVHG+  A  YF ++P SL+   +YG+LLN 
Sbjct  85   LQISQWMSDQ-RGHNLSPGDVAVRLDLISKVHGLEQAVTYFNSVPESLRGLEVYGALLNC  143

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      E+AE+   +MR  G+ RN L YN+MLNLY
Sbjct  144  YAHYKHLEEAEATMRKMREMGFVRNVLSYNVMLNLY  179



>ref|XP_007200782.1| hypothetical protein PRUPE_ppa024012mg [Prunus persica]
 gb|EMJ01981.1| hypothetical protein PRUPE_ppa024012mg [Prunus persica]
Length=480

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EW++D   ++ +   D A++LDL SKVHG+  AE+YF ++P SLK   +YG+LL+ 
Sbjct  92   LQISEWMSDEM-KHDLHPGDIAVRLDLTSKVHGLEEAERYFDSIPESLKVLPVYGALLSC  150

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y +    EKAES+F++M   G+ + +  YN MLNLY
Sbjct  151  YAKHNCLEKAESVFEKMEELGFVKGSSCYNTMLNLY  186



>ref|XP_008229148.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Prunus mume]
Length=467

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EW++D   R   +  D AI+LDLISKV G+  AE YF +LP+ L++ ++YG+LL  
Sbjct  89   LQISEWMSDARNR-DPSPGDIAIRLDLISKVCGLEQAEMYFNSLPDPLRNFKVYGALLFC  147

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             V     EKAE+LF++M+  GY +  LPYN+ML LY
Sbjct  148  SVEHKSLEKAENLFEKMKELGYVKGPLPYNVMLTLY  183



>gb|KDP21919.1| hypothetical protein JCGZ_03057 [Jatropha curcas]
Length=311

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +1

Query  49   TTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFDE  228
            T+ D A++LDL+S+VHGI  AEKYF  +P + +   +YG+LLN YVR    EKAE+L  +
Sbjct  10   TSVDIALRLDLLSEVHGIQKAEKYFNNIPQNFRVLEVYGALLNCYVRAKSVEKAEALMQK  69

Query  229  MRNRGYTRNTLPYNLMLNLY  288
            MR+ G+ +N+L YN ML+LY
Sbjct  70   MRDLGFAKNSLNYNNMLSLY  89



>gb|KJB46994.1| hypothetical protein B456_008G004700 [Gossypium raimondii]
Length=514

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + +  K+   D AI LDLI+K+ G+ +AEK+F  LP+ ++D+  Y +LL+ 
Sbjct  103  LEICEWMRLQKD-IKLLPGDYAIHLDLIAKIRGLDSAEKFFKDLPDKMRDQATYTALLHT  161

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  +  KAE+L  +M +RG+ +  LPYN ML+LY+
Sbjct  162  YVQNKLSGKAEALMKKMSDRGFAKYPLPYNHMLSLYI  198



>dbj|BAK02972.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=510

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  ++   D A+ LDL++KV G+++AEK+F  +P   K      SLL+A
Sbjct  90   LEICEWMRTQPE-IRLLPGDHAVHLDLVAKVRGLASAEKFFEDVPERAKGPSTCNSLLHA  148

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+ G R+KAE++  EM + GY    LP+N M++LYM
Sbjct  149  YVQHGARDKAEAMLKEMADAGYLTCALPFNHMMSLYM  185



>ref|NP_179663.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9SKU6.1|PP166_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD20924.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAT99801.1| At2g20710 [Arabidopsis thaliana]
 gb|AEC07059.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=490

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+++    ++I+  D AI+LDLI+KV G+  AEK+F T+P   ++  +YG+LLN 
Sbjct  90   LQISDWMSEH-RVHEISEGDVAIRLDLIAKVGGLGEAEKFFETIPMERRNYHLYGALLNC  148

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y    +  KAE +F EM+  G+ +  LPYN+MLNLY+
Sbjct  149  YASKKVLHKAEQVFQEMKELGFLKGCLPYNVMLNLYV  185



>ref|XP_004290659.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Fragaria vesca subsp. vesca]
Length=520

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + +  K+   D A++LDLI+KV G+++AEK+F  LP  ++D     +LL+ 
Sbjct  91   LEICEWMTLQKD-IKLLAGDYAVELDLIAKVRGMNSAEKFFEDLPEQMRDGITCSALLHT  149

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+     KAE+LF++M+  GY +N LPYN ML+LY+
Sbjct  150  YVQNKESAKAEALFEKMKECGYVKNPLPYNHMLSLYV  186



>gb|EMT17732.1| hypothetical protein F775_09007 [Aegilops tauschii]
Length=510

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  ++   D A+ LDL++KV G+++AEK+F  +P   K      SLL+A
Sbjct  90   LEICEWMRTQPE-MRLLPGDHAVHLDLVAKVRGLASAEKFFEDVPERAKGPSTCNSLLHA  148

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+ G R+KAE++  EM   GY    LP+N M++LYM
Sbjct  149  YVQHGARDKAEAMLKEMAGAGYLTCALPFNHMMSLYM  185



>ref|XP_010255941.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Nelumbo nucifera]
Length=513

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + +  K+   D A+ LDL++KV G  +AEK+F  LP  +K    Y +LL+ 
Sbjct  93   LEICEWMTVQPD-IKLLPGDYALHLDLVAKVRGWVSAEKFFEDLPEHMKGEPTYSALLHT  151

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + EKAE+L  +M   G++RN LPYN ML+LY+
Sbjct  152  YVQHNLSEKAEALMKKMSECGFSRNVLPYNHMLSLYI  188



>ref|XP_002322749.2| hypothetical protein POPTR_0016s06320g [Populus trichocarpa]
 gb|EEF04510.2| hypothetical protein POPTR_0016s06320g [Populus trichocarpa]
Length=522

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+  W+ D    +++ + D A+QLDLISKVHGI  A+K F   P  LK  ++Y +LLN 
Sbjct  111  LEISTWMTDSG-YFELASQDVAVQLDLISKVHGIEQAQKLFNNTPQHLKVLKVYSALLNC  169

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y +  + EKAES+  EM++ G+    L YN++LN Y
Sbjct  170  YAKAKLVEKAESVVQEMKSLGFANTLLVYNVILNFY  205



>ref|NP_973492.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 gb|ABM06033.1| At2g20710 [Arabidopsis thaliana]
 gb|AEC07060.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=395

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +1

Query  40   YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  219
            ++I+  D AI+LDLI+KV G+  AEK+F T+P   ++  +YG+LLN Y    +  KAE +
Sbjct  7    HEISEGDVAIRLDLIAKVGGLGEAEKFFETIPMERRNYHLYGALLNCYASKKVLHKAEQV  66

Query  220  FDEMRNRGYTRNTLPYNLMLNLYM  291
            F EM+  G+ +  LPYN+MLNLY+
Sbjct  67   FQEMKELGFLKGCLPYNVMLNLYV  90



>ref|XP_009354430.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Pyrus x bretschneideri]
Length=509

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+  W++D+   +++T +D AI+LDLI+KVHGI  AE YF  +P +LK   +Y +LLN+
Sbjct  96   LEISMWLSDK-RYFELTIADVAIRLDLIAKVHGIEQAEDYFNNIPKNLKVLEVYCALLNS  154

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y R  + EKAE +   MR  G+   +L YN +LNLY
Sbjct  155  YARAKLVEKAEDIMQRMRELGFAWTSLSYNNLLNLY  190



>ref|XP_008381253.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Malus domestica]
Length=514

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EW++D   +Y +T  D A++LDLISKV G+  AE YF ++P+ L++ ++YG+LL +
Sbjct  89   LQISEWMSDARNQY-LTPGDIAVRLDLISKVXGLQQAEAYFNSIPDQLRNFKVYGALLFS  147

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YV     EKAE +F++M   GY + ++ YN ML LY
Sbjct  148  YVENKSSEKAEIIFEKMNELGYLKGSVAYNAMLTLY  183



>gb|KDP24141.1| hypothetical protein JCGZ_25798 [Jatropha curcas]
Length=416

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+  W+ DR   + ++ SD A +L+L+ +V+G ++AEKYF  L   LK   +YG+LLN 
Sbjct  11   LEISHWMTDR-RYFTLSPSDAASRLNLVHRVYGSAHAEKYFNELSGKLKTFHVYGALLNV  69

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YV+    +KAE++  EMR +G   +T PYN+++NLY
Sbjct  70   YVQENFVQKAEAIMQEMREKGMATSTFPYNILINLY  105



>ref|XP_010237220.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Brachypodium distachyon]
Length=514

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+   D A+ LDL++KV G+++AEK+F  +P   K      +LL+A
Sbjct  95   LEICEWMRTQPE-MKLLPGDHAVHLDLVAKVRGLASAEKFFEDVPERAKGPSTCNALLHA  153

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+ G+R+KAE++  EM + GY    LP+N M+++YM
Sbjct  154  YVQNGVRDKAEAMLREMADAGYLTCALPFNHMMSMYM  190



>gb|KDP21918.1| hypothetical protein JCGZ_03056 [Jatropha curcas]
Length=501

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+  W+ D+   + + + D A++LDL+SKVHGI  AEKYF  +P  LK   +YG LL+ 
Sbjct  98   LEILTWMTDK-RYFALCSPDIALRLDLMSKVHGIEEAEKYFNNVPQKLKVVEVYGGLLHC  156

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE+L  +MR+ G+ R    YN MLNLY
Sbjct  157  YAHATHVEKAEALMQKMRDLGFDRTLFTYNDMLNLY  192



>ref|XP_010489001.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Camelina sativa]
 ref|XP_010489002.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X2 [Camelina sativa]
Length=485

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+++    ++I+  D AI+LDLI+KV G+  A+K+F T+P   +   +YG+LLN 
Sbjct  92   LQISDWMSEH-RVHEISEGDVAIRLDLIAKVGGLGEADKFFETIPVERRSYHLYGALLNC  150

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y       KAE LF EM++ G+ +  LPYN+MLNLY+
Sbjct  151  YASNKALHKAEQLFQEMKDLGFLKGCLPYNVMLNLYV  187



>gb|ABA99305.2| pentatricopeptide, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG94881.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94387.1| unnamed protein product [Oryza sativa Japonica Group]
Length=514

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  ++   D A+ LDL++KV G+ +AEK+F  +P   K      +LL+A
Sbjct  95   LEICEWMRTQPE-MRLLPGDHAVHLDLVAKVRGLPSAEKFFEDMPERAKGPSTCNALLHA  153

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+ G R+KAE++ +EM   GY    LP+N M++LYM
Sbjct  154  YVQHGRRDKAEAMLEEMAKAGYLTCALPFNHMMSLYM  190



>ref|XP_003594185.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=123

 Score = 83.2 bits (204),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 55/82 (67%), Gaps = 14/82 (17%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++V +W+N+R ER+KI  SD  IQLDLI++VHGISN              +R YG+LLNA
Sbjct  33   LQVYDWMNNRPERFKIYASDAVIQLDLIARVHGISN--------------KRTYGALLNA  78

Query  181  YVRVGMREKAESLFDEMRNRGY  246
            YV    +EKAESL D MR++GY
Sbjct  79   YVHSRSKEKAESLPDIMRSKGY  100



>gb|EAY83341.1| hypothetical protein OsI_38557 [Oryza sativa Indica Group]
Length=444

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++CEW+  + E  ++   D A+ LDL++KV G+ +AEK+F  +P   K      +LL+A
Sbjct  25   LQICEWMRTQPE-MRLLPGDHAVHLDLVAKVRGLPSAEKFFEDMPERAKGPSTCNALLHA  83

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+ G R+KAE++ +EM   GY    LP+N M++LYM
Sbjct  84   YVQHGRRDKAEAMLEEMAKAGYLTCALPFNHMMSLYM  120



>ref|XP_009627474.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=506

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EWIN +++ + I + D A+QLDL+SK HG+  AEKYF ++P++L+  R+YG+LLN 
Sbjct  110  LQIYEWIN-KSKHFDILSGDVAVQLDLVSKSHGVKAAEKYFASVPDNLRTYRVYGALLNV  168

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      +KAE    +++  GY   T+ YN+++ LY
Sbjct  169  YADAKCLKKAEDTMQKLKELGYA-GTVAYNVLMTLY  203



>ref|XP_011037317.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Populus euphratica]
Length=501

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 64/97 (66%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAER-YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +++ +W++D  ER + ++  D A++LDLISKVHG+  A  YF ++P S +   +YG+LLN
Sbjct  85   LQISQWMSD--ERGHNLSPGDVAVRLDLISKVHGLEQAVTYFNSVPESSRGLEVYGALLN  142

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             Y      E+AE+   +MR  G+ RN L YN+MLNLY
Sbjct  143  CYAHYKHLEEAEATMRKMREMGFVRNVLSYNVMLNLY  179



>ref|XP_002442234.1| hypothetical protein SORBIDRAFT_08g016710 [Sorghum bicolor]
 gb|EES16072.1| hypothetical protein SORBIDRAFT_08g016710 [Sorghum bicolor]
Length=501

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  R E  ++   D A+ LDL++KV G+++A K+F  +P   K      +LL+A
Sbjct  82   LEICEWMRTRPE-MRLLPGDHAVHLDLVAKVRGLASAVKFFEDMPERAKAPSTCNALLHA  140

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+ G REKAE++  EM   GY    LP+N M++LYM
Sbjct  141  YVQHGAREKAEAMMAEMARAGYLTCALPFNHMMSLYM  177



>gb|EMS62788.1| hypothetical protein TRIUR3_25805 [Triticum urartu]
Length=503

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 61/95 (64%), Gaps = 1/95 (1%)
 Frame = +1

Query  7    VCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYV  186
            +CEW+  + E  ++   D A+ LDL++KV G+++AEK+F  +P   K      SLL+AYV
Sbjct  85   ICEWMRTQPE-IRLLPGDHAVHLDLVAKVRGLASAEKFFEDVPERAKGPSTCNSLLHAYV  143

Query  187  RVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            + G R+KAE++  EM   GY    LP+N M++LYM
Sbjct  144  QHGARDKAEAMLKEMAGAGYLTCALPFNHMMSLYM  178



>emb|CDY03299.1| BnaC09g10490D [Brassica napus]
Length=473

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+++    + I+  D AI+LDLI+KV+G+  A+K+F  +P   ++  +YG+LLN 
Sbjct  82   LQISDWMSEH-RVHDISEGDIAIRLDLIAKVNGLGEADKFFEKIPIERRNYHLYGALLNC  140

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y    +  KA+ LF EM++ G+ R  LPYN+MLNLY+
Sbjct  141  YASKKVLHKADQLFHEMKDLGFLRGCLPYNVMLNLYI  177



>emb|CDP03624.1| unnamed protein product [Coffea canephora]
Length=515

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  + E  K+ + D A+ LDLI+KV G+++AEK+F  LP+ +KD     SLL+ 
Sbjct  96   LEVCEWMRIQ-ENVKLLSGDYAVHLDLIAKVRGMNSAEKFFEDLPDKMKDHTTCSSLLHT  154

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +     KAE+L ++M   G+ ++ LPYN ML LY+
Sbjct  155  YAQHKESAKAEALIEKMSECGFLKSPLPYNHMLTLYI  191



>gb|KDP24140.1| hypothetical protein JCGZ_25797 [Jatropha curcas]
Length=494

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+ DR   + ++  D A QLDLISKV+G+  AEKYF ++P + +  R+Y +LLN 
Sbjct  74   LQISQWMTDRV-CFNLSPEDAASQLDLISKVYGLEEAEKYFSSIPENSRGYRVYSALLNC  132

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKA +L ++M+   + R   PYNLMLNLY
Sbjct  133  YAHTKCLEKAGALMEKMKVLRFIRTPQPYNLMLNLY  168



>emb|CDY39781.1| BnaA09g10330D [Brassica napus]
Length=478

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+++    + I+  D AI+LDLI+KV+G+  A+K+F  +P   ++  +YG+LLN 
Sbjct  85   LQISDWMSEH-RVHDISEGDIAIRLDLIAKVNGLGEADKFFEKIPIERRNYHLYGALLNC  143

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y    +  KA+ LF EM++ G+ R  LPYN+MLNLY+
Sbjct  144  YATKKVLHKADQLFHEMKDLGFLRGCLPYNVMLNLYI  180



>ref|XP_010556784.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Tarenaya hassleriana]
Length=512

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+   D A+ LDLI+K+ G+++AEK+F  +P+ ++D  +  SLL+ 
Sbjct  100  LEICEWMVLQ-EDIKLQPGDYAVHLDLITKIRGLNSAEKFFEDIPDRMRDHSVCTSLLHT  158

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE+LF++M   G+ ++ LPYN ++++Y+
Sbjct  159  YVQSKLSDKAEALFEKMSECGFLKSPLPYNHLISMYI  195



>ref|XP_006827770.1| hypothetical protein AMTR_s00009p00264540 [Amborella trichopoda]
 gb|ERM95186.1| hypothetical protein AMTR_s00009p00264540 [Amborella trichopoda]
Length=503

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+C W++DR   Y ++ SD AI+LDLISKVHG+  AE+YF  +    K    YG+LLN 
Sbjct  86   LEICRWMSDRRYHY-LSPSDHAIRLDLISKVHGLEQAEQYFGNITKQAKTFETYGALLNC  144

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y +    EKAES+ ++M+  G+  + L YN ++ LY
Sbjct  145  YAQERSVEKAESIAEKMKELGFFNSALSYNALMTLY  180



>ref|XP_002531596.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF30799.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=300

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+  W++D+   + +T+ D AI+LDL+SKV GI  AEKYF  +P  LK   +Y +LLN 
Sbjct  101  LEISMWMSDK-RYFALTSRDVAIRLDLMSKVLGIEQAEKYFENVPQKLKVLEVYNALLNC  159

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      +KAE++   MR+ G+   TL YN+MLNL+
Sbjct  160  YAYAKSVDKAEAVMQNMRDLGFAGKTLTYNVMLNLH  195



>emb|CDP14775.1| unnamed protein product [Coffea canephora]
Length=534

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = +1

Query  7    VCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYV  186
            V EWIN   +  K+  +D A+ LDLI+KVHG+  AEKYF +LP++L+  + YG+LLN YV
Sbjct  123  VSEWINS-IQHSKLKPADAAVHLDLIAKVHGLEQAEKYFESLPDNLRVIQTYGALLNCYV  181

Query  187  RVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            +     KAE +  +MR  GY +  L Y+ ML LY+
Sbjct  182  KFKSLRKAEEIMQKMRQLGYNK-MLSYSAMLTLYV  215



>ref|XP_010422532.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Camelina sativa]
Length=532

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++
Sbjct  113  LEICEWMVLQ-EDIKLQAGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHS  171

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE+LF++M   G+ ++ LPYN ML++Y+
Sbjct  172  YVQNKLSDKAEALFEKMGECGFLKSCLPYNHMLSMYI  208



>ref|XP_008455539.1| PREDICTED: uncharacterized protein LOC103495690 [Cucumis melo]
Length=1067

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERYK-ITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +++CEWI++  ER K  +  D A+QL LISK  G+  AEKYF ++  S +D ++YG+LLN
Sbjct  662  LQLCEWIHN--ERNKNPSPGDIAVQLHLISKARGLEQAEKYFSSIRESSRDHKVYGALLN  719

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             YV     EKAE++  +MR  G+ +  L YN+ML+LY
Sbjct  720  CYVENKNLEKAEAIMQKMREVGFMKTPLSYNVMLSLY  756


 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +E+ +W+ DR  RY  ++ SD A++LDLI  VHG+ +AE YF ++   LK   +YGSLL+
Sbjct  99   LEISQWMTDR--RYLSLSASDAALRLDLIHSVHGLEHAENYFNSISTRLKTSNVYGSLLS  156

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             YVR    EKAE++  EMR  G    +  YN+++NLY
Sbjct  157  CYVREKSVEKAEAIMQEMRKMGIANTSFAYNVLINLY  193



>ref|NP_192191.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9SY07.1|PP302_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD15353.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77767.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82233.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=532

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++
Sbjct  113  LEICEWMVVQ-EDIKLQAGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHS  171

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE+LF++M   G+ ++ LPYN ML++Y+
Sbjct  172  YVQNKLSDKAEALFEKMGECGFLKSCLPYNHMLSMYI  208



>ref|XP_010430409.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Camelina sativa]
Length=532

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++
Sbjct  113  LEICEWMVLQ-EDIKLQAGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHS  171

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE+LF++M   G+ ++ LPYN ML++Y+
Sbjct  172  YVQNKLSDKAEALFEKMGECGFLKSCLPYNHMLSMYI  208



>gb|AAL32523.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO00924.1| Unknown protein [Arabidopsis thaliana]
Length=532

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++
Sbjct  113  LEICEWMVVQ-EDIKLQAGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHS  171

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE+LF++M   G+ ++ LPYN ML++Y+
Sbjct  172  YVQNKLSDKAEALFEKMGECGFLKSCLPYNHMLSMYI  208



>ref|XP_011039574.1| PREDICTED: uncharacterized protein LOC105136086 [Populus euphratica]
Length=1072

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+  W+ D    +++ + D A+QLDLIS VHGI  A+K F   P  LK  ++Y +LLN 
Sbjct  111  LEISTWMTDSG-YFELASQDVAVQLDLISNVHGIEQAQKLFNNTPQHLKVLKVYSALLNC  169

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y +  + EKAES+  EM++ G+    L YN++LN Y
Sbjct  170  YAKAKLAEKAESVVQEMKSLGFANTLLVYNVILNFY  205


 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +E+  W+ D+  RY  +T+   A++LDLISKVHGI   E YF  +P  LK    YG+LLN
Sbjct  654  LEISMWMTDK--RYLALTSRAVAVRLDLISKVHGIEQVENYFNNIPTKLKGLESYGALLN  711

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             Y  V   EKAE++   MR  G+ R  L + +MLNLY
Sbjct  712  CYAYVKSVEKAEAVMQRMRELGFARKPLVFTVMLNLY  748



>ref|NP_001151760.1| tetratricopeptide-like helical [Zea mays]
 gb|ACG44244.1| tetratricopeptide-like helical [Zea mays]
 gb|ACN25152.1| unknown [Zea mays]
 gb|AFW56577.1| Tetratricopeptide-like helical [Zea mays]
Length=501

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  ++   D A+ LDL++KV G+++A K+F  +P   K      +LL+A
Sbjct  83   LEICEWMRTQPE-MRLLPGDHAVHLDLVAKVRGLASATKFFEDMPERAKGPSTCNALLHA  141

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+ G REKAE++  EM   GY    LP+N M++LYM
Sbjct  142  YVQNGAREKAEAMLAEMARVGYLTCALPFNHMMSLYM  178



>ref|XP_004155477.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
Length=493

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERYK-ITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +++CEW+  R ER + ++T D A++L LISK  G+  AEKYF ++  S +D ++YG+LL+
Sbjct  88   LQLCEWV--RNERNQCLSTGDIAVELHLISKARGLEQAEKYFSSIGESSRDHKVYGALLH  145

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             YV     +KAE++  +MR  G+ +  L YN MLNLY
Sbjct  146  CYVENKNLKKAEAIMQKMREVGFMKTPLSYNAMLNLY  182



>ref|XP_010455929.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Camelina sativa]
Length=533

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++
Sbjct  114  LEICEWMVLQ-EDIKLQAGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHS  172

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE+LF++M   G+ ++ LPYN ML++Y+
Sbjct  173  YVQNKLSDKAEALFEKMGECGFLKSCLPYNHMLSMYI  209



>ref|XP_009112678.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial [Brassica rapa]
Length=478

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+++    + I+  D AI+LDLI+KV+G+  A+K+F  +P   ++  +YG+LLN 
Sbjct  85   LQISDWMSEH-RVHDISEGDIAIRLDLIAKVNGLGEADKFFEKIPIERRNYHLYGALLNC  143

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y    +  KA+ LF EM++ G+ R  LPYN+MLNLY+
Sbjct  144  YATKKVLHKADQLFHEMKDLGFLRGCLPYNVMLNLYI  180



>ref|XP_006429969.1| hypothetical protein CICLE_v10013712mg [Citrus clementina]
 gb|ESR43209.1| hypothetical protein CICLE_v10013712mg [Citrus clementina]
Length=468

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +E+  W+ D+  RY  IT +D A+QLDLI+KV GI  AE YF  +P  +K   +Y +LLN
Sbjct  98   LEISMWMTDK--RYLNITAADAAVQLDLIAKVKGIEEAENYFSYIPEKIKGLEVYSALLN  155

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             Y  V   +KAE+   +MR+ G  R TL YN ML LY
Sbjct  156  CYSNVKSTDKAEATMQKMRDLGLARTTLVYNSMLKLY  192



>ref|XP_002874893.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH51152.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=525

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+   D A+ LDLISK+ G+++AEK+F  LP+ ++      SLL++
Sbjct  106  LEICEWMVLQ-EDIKLQAGDYAVHLDLISKIRGLNSAEKFFEDLPDQMRGHAACTSLLHS  164

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE+LF++M   G+ ++ LPYN ML++++
Sbjct  165  YVQNKLSDKAEALFEKMGECGFLKSCLPYNHMLSMFI  201



>gb|KCW90381.1| hypothetical protein EUGRSUZ_A02520, partial [Eucalyptus grandis]
Length=471

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +E+  W++D+  RY  ITT D A++L+LISKVHGI  AE +F  +P  LK  ++Y +LLN
Sbjct  64   LEISMWMSDK--RYIAITTVDAAVRLNLISKVHGIEQAEIFFDNVPRQLKVEKVYIALLN  121

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             Y +  + +KAE+L + MR+ G+ R+ L +  +LNLY
Sbjct  122  CYAKAKLPKKAEALLETMRHLGFPRSVLCFTNLLNLY  158



>gb|KDP21467.1| hypothetical protein JCGZ_21938 [Jatropha curcas]
Length=515

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+    E  K+   D A+ LDLI+KV G+++AEK+F  LP+ ++      +LL+ 
Sbjct  96   LEVCEWMTQERE-IKLLPGDYAVHLDLIAKVRGLNSAEKFFEDLPDEMRGWHTCTALLHT  154

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  +  KAE+L ++M   G+ +N LPYN ML LY+
Sbjct  155  YVQFKLLSKAEALMEKMAECGFMKNPLPYNHMLTLYV  191



>ref|XP_006664068.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Oryza brachyantha]
Length=510

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  ++   D A+ LDL++KV G+ +AEK+F  +P   K      +LL+ 
Sbjct  91   LEICEWMRTQPE-MRLLPGDHAVHLDLVAKVRGLPSAEKFFEDMPERAKGPSTCSALLHT  149

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+ G R+KAE++  EM   GY    LP+N M++LYM
Sbjct  150  YVQHGRRDKAEAMLGEMAKAGYLTCALPFNHMMSLYM  186



>gb|EYU46589.1| hypothetical protein MIMGU_mgv1a004554mg [Erythranthe guttata]
Length=521

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+ + D A+ LDLI+K+ G+ +AEK+FL LP   +D     +LL+ 
Sbjct  103  LEICEWMMTQ-EDMKLVSGDYAVHLDLIAKIRGLDSAEKFFLDLPEKTRDSATCSALLHT  161

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR     KAE+L ++M + G+  + LPYN ML++Y+
Sbjct  162  YVRHNESGKAEALMEKMSDCGFLTSPLPYNHMLSIYV  198



>ref|XP_010058578.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Eucalyptus grandis]
Length=550

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +E+  W++D+  RY  ITT D A++L+LISKVHGI  AE +F  +P  LK  ++Y +LLN
Sbjct  113  LEISMWMSDK--RYIAITTVDAAVRLNLISKVHGIEQAEIFFDNVPRQLKVEKVYIALLN  170

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             Y +  + +KAE+L + MR+ G+ R+ L +  +LNLY
Sbjct  171  CYAKAKLPKKAEALLETMRHLGFPRSVLCFTNLLNLY  207



>ref|XP_004137019.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
 ref|XP_004155524.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
Length=500

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 62/97 (64%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +E+ +W+ DR  RY  ++ SD A++LDLI  VHG+ +AE YF ++   LK   +YG+LL 
Sbjct  88   LEISQWMTDR--RYLSLSPSDAAVRLDLIHSVHGLEHAENYFNSISIRLKTSNVYGALLG  145

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             YVR    EKAE++  EMR  G    +  YN+++NLY
Sbjct  146  CYVREKSLEKAEAIMQEMRKMGIATTSFAYNVLINLY  182



>ref|XP_006287476.1| hypothetical protein CARUB_v10000687mg [Capsella rubella]
 gb|EOA20374.1| hypothetical protein CARUB_v10000687mg [Capsella rubella]
Length=532

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++
Sbjct  113  LEICEWMVLQ-EDIKLQPGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHS  171

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE+LF++M   G+ ++ LPYN ML++Y+
Sbjct  172  YVQNKLSDKAEALFEKMGECGFLKSCLPYNHMLSMYI  208



>ref|XP_008451368.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Cucumis melo]
Length=531

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  + +  K+   D A+QLDLI+K+ G+++AEK+F  LP+ ++++ +  +LL+A
Sbjct  100  LEVCEWMTLQKD-MKLLPGDYAVQLDLIAKIRGLNSAEKFFEDLPDKIREQSVCTALLHA  158

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + EKAE+L ++M   G+ ++ L +N ML+L++
Sbjct  159  YVQKNLSEKAEALMEKMSECGFLKSPLSFNHMLSLHI  195



>ref|XP_011032725.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Populus euphratica]
 ref|XP_011032726.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Populus euphratica]
Length=513

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  +++  K+   D A+ LDLI+K+ G+++AEK+F  +P+ ++D +   +LL+ 
Sbjct  92   LEVCEWMTKQSD-IKLVPGDYAVHLDLIAKIRGLNSAEKFFEDIPDKMRDYQACSALLHV  150

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+     KAE+L ++M   G+ +N LPYN ML++Y+
Sbjct  151  YVQNKSISKAEALMEKMSECGFLKNALPYNHMLSVYV  187



>ref|XP_002307578.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE94574.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=513

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  +++  K+   D A+ LDLI+K+ G+++AEK+F  +P+ ++D +   +LL+ 
Sbjct  92   LEVCEWMTKQSD-IKLVPGDYAVHLDLIAKIRGLNSAEKFFEDIPDKMRDYQACSALLHV  150

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+     KAE+L ++M   G+ +N LPYN ML++Y+
Sbjct  151  YVQNKSISKAEALMEKMSECGFLKNALPYNHMLSVYV  187



>ref|XP_010467774.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial isoform X2 [Camelina sativa]
 ref|XP_010467775.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial isoform X3 [Camelina sativa]
 ref|XP_010467776.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial isoform X4 [Camelina sativa]
Length=484

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+++    ++I+  D AI+LDLI+KV G+  A+K+F T+P   +   +YG+LLN 
Sbjct  91   LQISDWMSEH-RVHEISEGDVAIRLDLIAKVGGLVEADKFFETIPVERRSYHLYGALLNC  149

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y       KA+ +F EM++ G+ +  LPYN+MLNLY+
Sbjct  150  YASNKALHKAQQVFQEMKDLGFLKGCLPYNVMLNLYV  186



>ref|XP_010467773.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial isoform X1 [Camelina sativa]
Length=484

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+++    ++I+  D AI+LDLI+KV G+  A+K+F T+P   +   +YG+LLN 
Sbjct  91   LQISDWMSEH-RVHEISEGDVAIRLDLIAKVGGLVEADKFFETIPVERRSYHLYGALLNC  149

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y       KA+ +F EM++ G+ +  LPYN+MLNLY+
Sbjct  150  YASNKALHKAQQVFQEMKDLGFLKGCLPYNVMLNLYV  186



>ref|XP_008790994.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Phoenix dactylifera]
Length=533

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + +  K+   D A+ LDL++KV G+++AEK+F  LP  +K +    +LL+ 
Sbjct  114  LEICEWMTTQPD-IKLLPGDYAVHLDLVAKVRGLASAEKFFEDLPERMKGQSTCTALLHT  172

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  +  KAESL +EM   G  R  LPYN ML LY+
Sbjct  173  YVQSELSNKAESLMEEMSIHGLLRCPLPYNHMLTLYI  209



>ref|XP_009802167.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Nicotiana sylvestris]
Length=623

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +1

Query  4    EVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAY  183
            ++ EWI  +++ + + + D A+QLDL+SK HG+  AEKYF ++P++L+  ++YG+LLN Y
Sbjct  222  QIYEWIT-KSKHFDVLSGDVAVQLDLVSKAHGVKAAEKYFASIPDNLRTYQVYGALLNVY  280

Query  184  VRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
                  +KAE    +++  GY  NT+ YN++++LY
Sbjct  281  ADAKCLKKAEDTMQKLKELGYA-NTVAYNVLMSLY  314



>gb|KDP21920.1| hypothetical protein JCGZ_03058 [Jatropha curcas]
Length=273

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = +1

Query  46   ITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  225
            +T+ D A++LDLISKV+GI  AEKYF  +P   K  ++YG+LLN Y R    EKAE++  
Sbjct  9    LTSIDIALRLDLISKVYGIEEAEKYFNNIPQKFKVLKVYGALLNCYARAESIEKAEAVMQ  68

Query  226  EMRNRGY-TRNTLPYNLMLNLY  288
            +MR+ G+ +R +L YN +LNLY
Sbjct  69   KMRDLGFCSRMSLTYNTILNLY  90



>gb|AES60905.2| PPR containing plant protein [Medicago truncatula]
Length=512

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  + +  K+   D A+QLDLI+KV G+++AEK+F  LP+ ++ +    +LL+A
Sbjct  89   LEVCEWMKLQND-IKLVEGDYAVQLDLITKVRGLNSAEKFFEDLPDKMRGQPTCTALLHA  147

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  +  KAE+L  +M   G+ R+ +PYN M++LY+
Sbjct  148  YVQNNLTNKAEALMSKMSECGFLRSPVPYNRMMSLYI  184



>emb|CDX91277.1| BnaC02g26880D [Brassica napus]
Length=519

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+   D A+ LDLISK+ G+++AEK+F  +P+ ++D     SLL++
Sbjct  97   LEICEWMVLQ-EDIKLQPGDYAVHLDLISKIRGLNSAEKFFQDMPDKMRDHAACTSLLHS  155

Query  181  YVRVGMREKAESLFDEMRNRGYTRNT-LPYNLMLNLYM  291
            YV+  + +KAE+LF+ M   G+ +++ LPYN ML++Y+
Sbjct  156  YVKNKLSDKAEALFERMAECGFLKSSCLPYNHMLSMYI  193



>ref|XP_009398991.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=520

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  ++   K+   D A+ LDL++KV G+++A+K+F  LP  +K      +LL+ 
Sbjct  101  LEICEWMTTQS-HIKLLPGDYAVHLDLVAKVCGLASAQKFFEDLPVRMKGPSTCTALLHT  159

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAESL +EM  +G  R  LPYN ML LY+
Sbjct  160  YVQCKLTDKAESLMEEMSAQGLLRCALPYNHMLTLYI  196



>ref|XP_009144540.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Brassica rapa]
Length=514

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+   D A+ LDLISK+ G+++AEK+F  +P+ ++D     SLL+ 
Sbjct  92   LEICEWMVVQ-EDIKLQPGDYAVHLDLISKIRGLNSAEKFFQDMPDQMRDHAACTSLLHT  150

Query  181  YVRVGMREKAESLFDEMRNRGYTRNT-LPYNLMLNLYM  291
            YV+  + +KAE+LF+ M   G+ +++ LPYN ML++Y+
Sbjct  151  YVKNKLSDKAEALFERMAECGFLKSSCLPYNHMLSMYI  188



>ref|XP_002517927.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF44445.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=507

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+  W+ D    + ++ SD A++L+LI +V+G ++AE YF  + + LK   +YG+LL+ 
Sbjct  100  LEMSHWMTD-CRYFSLSPSDVAVRLELIYRVYGSAHAEMYFEKISDKLKSGNVYGALLSG  158

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YVR    +KAE++  EMR +G   ++ PYN+M+NLY
Sbjct  159  YVRENSVQKAEAVLQEMREKGIATSSFPYNIMINLY  194



>ref|XP_002520753.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF41715.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=551

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+    E  K+   D A+ LDL++KV G+++AEK+F  LP+ ++  +   +LL+ 
Sbjct  88   LEVCEWMTQERE-LKLLPGDYAVHLDLVAKVRGLTSAEKFFEDLPDEMRGWQTCTALLHT  146

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+     KAE+L ++MR+  + +N LPYN M++LY+
Sbjct  147  YVKCKDVVKAEALMEKMRDCSFVKNPLPYNHMISLYI  183



>ref|XP_003590654.1| WD repeat-containing protein [Medicago truncatula]
Length=562

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  + +  K+   D A+QLDLI+KV G+++AEK+F  LP+ ++ +    +LL+A
Sbjct  89   LEVCEWMKLQND-IKLVEGDYAVQLDLITKVRGLNSAEKFFEDLPDKMRGQPTCTALLHA  147

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  +  KAE+L  +M   G+ R+ +PYN M++LY+
Sbjct  148  YVQNNLTNKAEALMSKMSECGFLRSPVPYNRMMSLYI  184



>ref|XP_002517929.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF44447.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=446

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+ DR     ++ SD  ++L+L+ +++G ++AEKYF  LP+  K R +Y +LL+ 
Sbjct  60   LQISQWMADRP-NLTLSPSDVVVRLELVHRIYGSAHAEKYFEKLPDKFKCREVYCALLSG  118

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YV+     KAE++ +EMR +G   +  PYNL++NLY
Sbjct  119  YVQESSVRKAEAIMEEMRAKGMANSCFPYNLLINLY  154



>ref|XP_009629681.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=477

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV  W+ DR   + +  +D A ++DL+ KV G+   EKYF + P  LK   +Y SLLN 
Sbjct  92   LEVSHWMTDR-RYFSVQPADVATRIDLMYKVKGLEEVEKYFNSTPQKLKRLTVYTSLLNC  150

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE+L  ++R+ G+ + TL YNLMLNLY
Sbjct  151  YTSEKSAEKAEALMQKLRDMGFAKGTLCYNLMLNLY  186



>gb|KGN43610.1| hypothetical protein Csa_7G047450 [Cucumis sativus]
Length=493

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERYK-ITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +++CEW+  R ER + ++T D A++L LISK  G+  AE+YF ++  S +D ++YG+LL+
Sbjct  88   LQLCEWV--RNERNQCLSTGDIAVELHLISKARGLEQAEEYFSSIGESSRDHKVYGALLH  145

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             YV     +KAE++  +MR  G+ +  L YN MLNLY
Sbjct  146  CYVENKNLKKAEAIMQKMREVGFMKTPLSYNAMLNLY  182



>ref|XP_004155478.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
Length=259

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 62/97 (64%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITT-SDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +++CEW  +R ER K  +    AIQL LISK  G+  AE+YF ++  S +D ++YG+LL+
Sbjct  88   LQLCEW--ERNERNKCPSPGHIAIQLHLISKARGLEQAEEYFSSIGESSRDHKVYGALLH  145

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             YV     +KAE++  +MR  G+ +  L YN MLNLY
Sbjct  146  CYVENKNLKKAEAIMQKMREVGFMKTPLSYNAMLNLY  182



>gb|KFK40443.1| hypothetical protein AALP_AA3G373800 [Arabis alpina]
Length=469

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+++      I+  D AI+LDLISKV G+  A+K+F T+P   ++  +YG+LLN 
Sbjct  74   LQISDWMSEHRVN-DISEGDVAIRLDLISKVGGLGEADKFFQTIPVDRRNYHLYGALLNC  132

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y    +   AE +F +M+  G+ R  LPYN+MLNLY+
Sbjct  133  YASKKVLHNAEQVFQKMKELGFLRGCLPYNVMLNLYI  169



>ref|XP_010921943.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Elaeis guineensis]
Length=521

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  +    K+   D A+ LDLI+KV G+++AEK+F  LP  +K +    +LL+ 
Sbjct  102  LEICEWMTTQPN-IKLLPGDYAVHLDLIAKVRGLASAEKFFEDLPERMKVQSTCTALLHT  160

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  +  KAESL +EM   G  R  LPYN ML LY+
Sbjct  161  YVQNELSNKAESLMEEMSTHGLLRCPLPYNHMLTLYI  197



>emb|CDX97288.1| BnaA02g20790D [Brassica napus]
Length=514

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+   D A+ LDLISK+ G+++AEK+F  +P+ ++D     SLL+ 
Sbjct  92   LEICEWMVVQ-EDIKLQPGDYALHLDLISKIRGLNSAEKFFQDMPDQMRDHAACTSLLHT  150

Query  181  YVRVGMREKAESLFDEMRNRGYTRNT-LPYNLMLNLYM  291
            YV+  + +KAE+LF+ M   G+ +++ LPYN ML++Y+
Sbjct  151  YVKNKLSDKAEALFERMAECGFLKSSCLPYNHMLSMYI  188



>ref|XP_009762284.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Nicotiana sylvestris]
Length=468

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EWI D ++  +IT  D A++LDLISK HG+  AE+YF ++P++L+   +YG+LLN 
Sbjct  102  LQIYEWI-DNSKHLRITPGDVAVRLDLISKAHGLEAAEEYFASIPDNLRSSYVYGALLNC  160

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y       KAE    +MR+ G T + + YN+M+NLY
Sbjct  161  YADAKSLMKAEGTMQKMRDLGNT-DLVTYNVMMNLY  195



>ref|XP_002322750.1| hypothetical protein POPTR_0016s06330g [Populus trichocarpa]
 gb|EEF04511.1| hypothetical protein POPTR_0016s06330g [Populus trichocarpa]
Length=516

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +E+  W+ D+  RY  +T+   A++LDLISKVHGI   E YF  +P  LK    YG+LLN
Sbjct  98   LEISMWMTDK--RYLALTSRAVAVRLDLISKVHGIEQVENYFNNIPTKLKGLESYGALLN  155

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             Y  V   EKAE++   MR  G+ R  L + +MLNLY
Sbjct  156  CYAYVKSVEKAEAVMQRMRELGFARKPLVFTVMLNLY  192



>gb|KHG13694.1| hypothetical protein F383_19313 [Gossypium arboreum]
Length=514

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + +  K+   D AI LDLI+K  G+ +AEK+F  LP+ ++D+  Y +LL+ 
Sbjct  103  LEICEWMRLQKD-IKLLPGDYAIHLDLIAKNRGLDSAEKFFEDLPDKMRDQATYTALLHT  161

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  +  KAE+L  +M + G+ +  LPYN ML+LY+
Sbjct  162  YVQNKLSGKAEALMKKMSDCGFAKYPLPYNHMLSLYI  198



>ref|XP_010520653.1| PREDICTED: uncharacterized protein LOC104799713 [Tarenaya hassleriana]
Length=1018

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +++  W++++  RY ++T+SD +++LDL+SK+HGI  AE +F  +P   +   +YG+LLN
Sbjct  123  LQISMWMSEK--RYIELTSSDISVRLDLVSKIHGIEEAESHFNNVPVHQRSLEVYGALLN  180

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             Y      EKAE L D+MR+ G+ R +L Y+++L LY
Sbjct  181  CYANAKCVEKAEGLMDKMRDLGFARGSLVYSVLLGLY  217


 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++  W++++     +   D +++LDLISKV+G+  AE Y+  +P   +  ++YG+LLN 
Sbjct  615  LQISMWMSEKM-NISLDPRDISLRLDLISKVNGVEAAENYYNYIPTHQRTIQVYGALLNC  673

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE++   +R+ G TR  L YN +L+LY
Sbjct  674  YANAKCVEKAENVAQMVRDLGLTRELLMYNTLLDLY  709



>ref|XP_008229146.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Prunus mume]
Length=506

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ +W+ DR   + ++ SD A +L+LI +VHG+ +AEKYF  +  +LK    YG+LL+ 
Sbjct  96   LEISQWMTDR-RYFDLSPSDAAARLNLIHRVHGLEDAEKYFNNMSKNLKSVNAYGALLSI  154

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YV+    EKAE+   +M+  G  + + PYN+++NLY
Sbjct  155  YVQENSVEKAEATMQKMKKLGMAKTSFPYNMLINLY  190



>ref|XP_008342919.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X2 [Malus domestica]
Length=420

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  31   AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  210
            A+   +T  D A++LDLISKV+G+  AE YF ++P+ L++ ++YG+LL +YV     EKA
Sbjct  4    AQNQYLTPGDIAVRLDLISKVYGLQQAEAYFNSIPDQLRNFKVYGALLFSYVENKSSEKA  63

Query  211  ESLFDEMRNRGYTRNTLPYNLMLNLY  288
            E +F++M   GY + +L YN ML LY
Sbjct  64   EIIFEKMNKLGYLKGSLVYNAMLTLY  89



>ref|XP_004962880.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Setaria italica]
Length=510

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ EW+  + E  ++   D A+ LDL++KV G+ +AEK+F  +P   K      +LL+A
Sbjct  91   LEIMEWMRTQTE-MRLLPGDHAVHLDLVAKVRGLPSAEKFFEDMPERAKAPSTCNALLHA  149

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+ G REKAE++  EM   GY    LP+N M++LYM
Sbjct  150  YVQNGAREKAEAMLAEMARAGYLTCALPFNHMMSLYM  186



>ref|XP_006409008.1| hypothetical protein EUTSA_v10001972mg [Eutrema salsugineum]
 gb|ESQ50461.1| hypothetical protein EUTSA_v10001972mg [Eutrema salsugineum]
Length=486

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+++    + ++  D AI+LDLI+KV G+  A+++F  +P   +   +YG+LLN 
Sbjct  90   LQLSDWMSEH-RVHDLSEGDVAIRLDLIAKVGGLGEADRFFEKIPVERRSYHLYGALLNC  148

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y    +  KAE +F EM+  G+ R  LPYN+MLNLY+
Sbjct  149  YASKKVLHKAEQVFQEMKELGFLRGCLPYNVMLNLYI  185



>ref|XP_008353788.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X2 [Malus domestica]
Length=420

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  31   AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  210
            A+   +T  D A++LDLISKV+G+  AE YF ++P+ L++ ++YG+LL +YV     EKA
Sbjct  4    AQNQYLTPGDIAVRLDLISKVYGLQQAEAYFNSIPDQLRNFKVYGALLFSYVENKSSEKA  63

Query  211  ESLFDEMRNRGYTRNTLPYNLMLNLY  288
            E +F++M   GY + +L YN ML LY
Sbjct  64   EIIFEKMNKLGYLKGSLVYNAMLTLY  89



>gb|KFK30887.1| hypothetical protein AALP_AA6G038700 [Arabis alpina]
Length=533

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  ++   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++
Sbjct  114  LEICEWMVLQ-EDIQLQAGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHS  172

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE+LF +M   G+ ++ LPYN ML++Y+
Sbjct  173  YVQNKLSDKAEALFAKMGECGFLKSCLPYNHMLSMYI  209



>ref|XP_010091037.1| hypothetical protein L484_006401 [Morus notabilis]
 gb|EXB42055.1| hypothetical protein L484_006401 [Morus notabilis]
Length=464

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+    +  K+   D A+ LDL++KV GI  AEK+F  L   + D   + +LLN 
Sbjct  43   LEICEWMTQEKD-IKLQAGDYAVHLDLVAKVRGIHRAEKFFEDLLGPMADHSTHSTLLNI  101

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  +  KAE+L  +M   G  RN  PYNLM++LY+
Sbjct  102  YVQNNLSAKAEALMAKMLECGLVRNPHPYNLMISLYL  138



>ref|XP_006878583.1| hypothetical protein AMTR_s00011p00250030 [Amborella trichopoda]
 gb|ERM94728.1| hypothetical protein AMTR_s00011p00250030 [Amborella trichopoda]
Length=413

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  34   ERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAE  213
            +  K+   D A+ LDL++KV G+++AEK+F  LP  +K++  Y SLLNAYV+  +  KAE
Sbjct  5    QHIKLLPGDYALHLDLVAKVRGLASAEKFFEDLPEKMKEKSTYTSLLNAYVQNKLSTKAE  64

Query  214  SLFDEMRNRGYTRNTLPYNLMLNLYM  291
            +L  +M   G  ++ LPYN MLNLY+
Sbjct  65   ALMAKMSECGLLKSPLPYNHMLNLYV  90



>ref|XP_009762286.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X2 [Nicotiana sylvestris]
Length=421

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = +1

Query  7    VCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYV  186
            + EWI D ++  +IT  D A++LDLISK HG+  AE+YF ++P++L+   +YG+LLN Y 
Sbjct  57   IYEWI-DNSKHLRITPGDVAVRLDLISKAHGLEAAEEYFASIPDNLRSSYVYGALLNCYA  115

Query  187  RVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
                  KAE    +MR+ G T + + YN+M+NLY
Sbjct  116  DAKSLMKAEGTMQKMRDLGNT-DLVTYNVMMNLY  148



>ref|XP_010099567.1| hypothetical protein L484_011573 [Morus notabilis]
 gb|EXB79633.1| hypothetical protein L484_011573 [Morus notabilis]
Length=515

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+  W+ D +   +I+ SD AI+LDLI +VHG+  AE YF ++   L+ R  Y +LL +
Sbjct  101  LEISLWMTD-SRFLRISPSDAAIRLDLIYRVHGLERAENYFNSVSRKLRTRSAYVALLRS  159

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YVR    EKA++   EMRN G   ++LPYN+++NLY
Sbjct  160  YVRENSVEKAKASMQEMRNMGMINSSLPYNILINLY  195



>ref|XP_011077261.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Sesamum indicum]
Length=493

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  49   TTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFDE  228
            T SD AI LDL++K  GI+ AE YF+TLP S K    YG+LLN Y +  M EKAE+LF++
Sbjct  92   TVSDQAIHLDLVAKSRGITAAEAYFVTLPESSKTHLTYGALLNCYCKDLMTEKAEALFEK  151

Query  229  MRNRGYTRNTLPYNLMLNLYM  291
            M+      +++PYN ++ +Y+
Sbjct  152  MKEHNLELSSMPYNSLMTMYL  172



>ref|XP_006299518.1| hypothetical protein CARUB_v10015690mg [Capsella rubella]
 gb|EOA32416.1| hypothetical protein CARUB_v10015690mg [Capsella rubella]
Length=487

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W+++     +I+  D AI+LDL +KV G+  AEK F  +P   ++  +YG+LLN 
Sbjct  87   LQISDWMSEHRVN-EISEGDVAIRLDLTAKVGGLGEAEKLFEAIPVERRNYHLYGALLNC  145

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y    +  KAE +F EM++ G+ +  LPYN+MLNLY+
Sbjct  146  YASKKVLHKAEQVFQEMKDLGFLKGCLPYNVMLNLYV  182



>ref|NP_001060183.1| Os07g0598500 [Oryza sativa Japonica Group]
 dbj|BAC83218.1| putative DNA-binding protein [Oryza sativa Japonica Group]
 dbj|BAF22097.1| Os07g0598500 [Oryza sativa Japonica Group]
 dbj|BAG93347.1| unnamed protein product [Oryza sativa Japonica Group]
Length=506

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW+N +    K    D A+ LDLI ++HG S AE YF  LP+  K  + YG+LLN 
Sbjct  116  LEVSEWMNAKG-HVKFLPKDHAVHLDLIGEIHGSSAAETYFNNLPDKDKTEKPYGALLNC  174

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y R  + EK+ + F +M+  G+  +TLPYN ++ LY
Sbjct  175  YTRELLVEKSLAHFQKMKELGFVFSTLPYNNIMGLY  210



>ref|XP_004303401.2| PREDICTED: uncharacterized protein LOC101303140 [Fragaria vesca 
subsp. vesca]
Length=1016

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 64/97 (66%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +EV  W++DR  RY ++  SD AI+LDLI+KVHGI  AE YF  +P  +K   +Y +LL+
Sbjct  605  LEVSMWMSDR--RYVELLPSDIAIRLDLIAKVHGIEQAENYFNNIPKQVKVLPVYNALLH  662

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             Y      EKAE+   +MR+ G+++ +  YN++LNLY
Sbjct  663  CYAHAKQLEKAETTMRKMRDLGFSKMSWSYNVLLNLY  699


 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +EV  W++D+  RY ++  +D AI+LDLI+KVHG   AE YF   P  LK   +Y +LLN
Sbjct  93   LEVSMWMSDK--RYVELLHADVAIRLDLIAKVHGTEQAENYFNNTPEKLKVLEVYCALLN  150

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             Y      EKAE+   +M++ G    +L YN++LNLY
Sbjct  151  CYAHAKQLEKAEATMQKMKDLGLYMTSLSYNVLLNLY  187



>ref|XP_009357845.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Pyrus x bretschneideri]
Length=505

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ +W+ DR   + ++ SD A +L+LI +VHG+ +AE YF  LP SLK    YG+LL  
Sbjct  96   LEISQWMTDR-RYFDLSPSDAAARLNLIHRVHGLDHAENYFNNLPKSLKSLNAYGALLCI  154

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YV+    EKAE+   +M+     + + PYN+++NLY
Sbjct  155  YVQERSVEKAEATMQKMKKMDMAKTSFPYNMLINLY  190



>ref|XP_009779118.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Nicotiana sylvestris]
Length=477

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV  W+ DR   + +  +D A ++DL+ KV G+   E+YF + P  LK   +Y SLLN 
Sbjct  92   LEVSHWMTDR-RYFSLQPADVATRIDLMYKVKGLEEVEEYFNSTPQKLKRLTVYTSLLNC  150

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE+L  ++R+ G+ + TL YNLMLNLY
Sbjct  151  YTSEKSAEKAEALMQKLRDMGFAKGTLCYNLMLNLY  186



>ref|XP_006481674.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Citrus sinensis]
Length=518

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +E+  W+ D+  RY  IT +D A++LDLI+KV GI  AE YF  +P  +K   +Y +LLN
Sbjct  98   LEISMWMTDK--RYLNITAADAAVRLDLIAKVKGIEEAENYFSYIPEKIKGLEVYSALLN  155

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             Y  V   +KAE+   +MR+ G  R T+ YN ML LY
Sbjct  156  CYSNVKSTDKAEATMQKMRDLGLARTTVVYNSMLKLY  192



>ref|XP_008337472.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial [Malus domestica]
 ref|XP_008367878.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Malus domestica]
Length=504

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ +W+ DR   + ++ SD A +L+LI +VHG+ +AE YF  L  SLK    YG+LL  
Sbjct  95   LEISQWMTDR-RYFDLSPSDAAARLNLIHRVHGLEHAENYFNNLSKSLKSLNAYGALLCX  153

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YV+    EKAE+   +M+  G  + + PYN+++NLY
Sbjct  154  YVQERSVEKAEATMQKMKKMGMAKTSFPYNMLINLY  189



>emb|CDO99769.1| unnamed protein product [Coffea canephora]
Length=414

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +1

Query  49   TTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFDE  228
            T SD AI +DLI+KV GI++AE YF+ LP + K+   YG+LLN Y +  M +KAE+L D+
Sbjct  93   TVSDQAIHIDLIAKVRGIASAETYFINLPEASKNHLTYGALLNCYCKALMIDKAEALMDK  152

Query  229  MRNRGYTRNTLPYNLMLNLY  288
            M+    +  ++PYN ++ LY
Sbjct  153  MKELNLSLTSMPYNSLMTLY  172



>ref|XP_008345197.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like, partial [Malus domestica]
Length=424

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            ++VCEW+  + +  K+ + D A+ LDLI+KV G+++AEK+F  LP  + DR    +LL+ 
Sbjct  5    IQVCEWMTLQQD-LKLVSGDYAVHLDLIAKVRGMNSAEKFFEDLPLQMTDRATCTALLHT  63

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE+L  +M   G+ ++ L YN ML+LY+
Sbjct  64   YVQNKVTDKAEALIAKMSECGFMKHPLAYNHMLSLYI  100



>ref|XP_009368491.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Pyrus x bretschneideri]
Length=481

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 63/96 (66%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EW++D    + +   D AI+L+LISKV G+  AEKYF ++P  L+  ++ G+LL+ 
Sbjct  96   LQIAEWMSDEL-NHDLHPGDIAIRLELISKVRGLEEAEKYFYSIPELLRVVQVCGALLSC  154

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE+LF++M++ G  R  LPYN ML LY
Sbjct  155  YAEHNCLEKAEALFEKMKHSG-IRGPLPYNTMLKLY  189



>gb|KHG24373.1| hypothetical protein F383_30483 [Gossypium arboreum]
Length=516

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + +  K+   D A+ LDLI+KV G+++AEK+F  LP  ++ +    +LL+ 
Sbjct  98   LEICEWMRLQQD-IKLLPGDYAVHLDLIAKVRGLTSAEKFFEDLPEKMRGQATCTALLHT  156

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNL  285
            YV+  +  KAE+L ++M   G+ RN LPYN M++L
Sbjct  157  YVQNKLSAKAEALMEKMSECGFVRNPLPYNHMISL  191



>ref|XP_004136821.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
Length=486

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 62/97 (64%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITT-SDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +++CEW  +R ER K  +    AIQL LISK  G+  AE+YF ++  S +D ++YG+LL+
Sbjct  88   LQLCEW--ERNERNKCPSPGHIAIQLHLISKARGLEQAEEYFSSIGESSRDHKVYGALLH  145

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             YV     +KAE++  +MR  G+ +  L YN MLNLY
Sbjct  146  CYVENKNLKKAEAIMQKMREVGFMKTPLSYNAMLNLY  182



>ref|XP_008235277.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Prunus mume]
Length=511

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + +  K+   D A+ LDLI+KV G+++AEK+F  LP+ + DR    +LL+ 
Sbjct  92   LEICEWMTLQQD-MKLLPGDYAVHLDLIAKVRGLNSAEKFFEDLPDQMTDRPTCTALLHT  150

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE+L  +M   GY ++ L YN +L+LY+
Sbjct  151  YVQNKLSDKAEALMAKMSQCGYMKHPLAYNHILSLYV  187



>gb|KGN43609.1| hypothetical protein Csa_7G047440 [Cucumis sativus]
Length=486

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 62/97 (64%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITT-SDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +++CEW  +R ER K  +    AIQL LISK  G+  AE+YF ++  S +D ++YG+LL+
Sbjct  88   LQLCEW--ERNERNKCPSPGHIAIQLHLISKARGLEQAEEYFSSIGESSRDHKVYGALLH  145

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             YV     +KAE++  +MR  G+ +  L YN MLNLY
Sbjct  146  CYVENKNLKKAEAIMQKMREVGFMKTPLSYNAMLNLY  182



>gb|EPS60165.1| hypothetical protein M569_14638, partial [Genlisea aurea]
Length=505

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  + +   +   D A+ LDLI KV G+++AEK+F  LP  +++     +LL+A
Sbjct  86   LEVCEWMRLQHD-ICLLPGDYAVHLDLIGKVRGLTSAEKFFEDLPERMRNHTTCSALLHA  144

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YVR G  EKAE+L ++M   G+  + +P+N M++LY
Sbjct  145  YVRHGEEEKAEALMEKMSECGFLLSPVPFNHMISLY  180



>ref|XP_004148903.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Cucumis sativus]
 ref|XP_004158945.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Cucumis sativus]
 gb|KGN44819.1| hypothetical protein Csa_7G390000 [Cucumis sativus]
Length=531

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  + +  ++   D A+ LDLI K+ G++ AEK+F  LP+ ++++ +  SLL+A
Sbjct  100  LEVCEWMTLQKD-MRLVPGDYAVHLDLICKIRGLNRAEKFFEDLPDKIREQSVCTSLLHA  158

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + EKAE+L ++M   G+ ++ L +N ML+L++
Sbjct  159  YVQNNLSEKAEALMEKMSECGFLKSPLSFNHMLSLHI  195



>ref|XP_008368855.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Malus domestica]
Length=511

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  + +  K+ + D A+ LDLI+KV G+++AEK+F  LP  + DR    +LL+ 
Sbjct  92   LEVCEWMTLQQD-LKLVSGDYAVHLDLIAKVRGMNSAEKFFEDLPLQMTDRATCTALLHT  150

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE+L  +M   G+ ++ L YN ML+LY+
Sbjct  151  YVQNKVTDKAEALIAKMSECGFMKHPLAYNHMLSLYI  187



>ref|XP_011037319.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X2 [Populus euphratica]
Length=376

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = +1

Query  7    VCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYV  186
            + +W++D     + +  D A+QLDLISKVHG+  AE+Y+ ++P+ L+  ++YG+LLN Y 
Sbjct  4    ISQWMSDERGSEQ-SPGDFAVQLDLISKVHGLEQAEEYYNSIPDHLRGIQVYGALLNCYA  62

Query  187  RVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
                 EKAE+   +MR  G  + TL YN+ML+LY
Sbjct  63   HKRHLEKAEATMQKMRELGLVQ-TLSYNVMLSLY  95



>ref|XP_008381254.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X2 [Malus domestica]
Length=420

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  46   ITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  225
            +T  D A++LDLISKV G+  AE YF ++P+ L++ ++YG+LL +YV     EKAE +F+
Sbjct  9    LTPGDIAVRLDLISKVXGLQQAEAYFNSIPDQLRNFKVYGALLFSYVENKSSEKAEIIFE  68

Query  226  EMRNRGYTRNTLPYNLMLNLY  288
            +M   GY + ++ YN ML LY
Sbjct  69   KMNELGYLKGSVAYNAMLTLY  89



>ref|XP_011037318.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Populus euphratica]
Length=469

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +W++D     + +  D A+QLDLISKVHG+  AE+Y+ ++P+ L+  ++YG+LLN 
Sbjct  95   LQISQWMSDERGSEQ-SPGDFAVQLDLISKVHGLEQAEEYYNSIPDHLRGIQVYGALLNC  153

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE+   +MR  G  + TL YN+ML+LY
Sbjct  154  YAHKRHLEKAEATMQKMRELGLVQ-TLSYNVMLSLY  188



>ref|XP_006444085.1| hypothetical protein CICLE_v10019771mg [Citrus clementina]
 ref|XP_006479730.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Citrus sinensis]
 gb|ESR57325.1| hypothetical protein CICLE_v10019771mg [Citrus clementina]
 gb|KDO68751.1| hypothetical protein CISIN_1g010458mg [Citrus sinensis]
Length=510

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  + +  K+ + D A+ LDLISK+ G+S+AE +F  LP+ ++      +LL++
Sbjct  91   LEVCEWMELQYD-IKLVSGDYAVHLDLISKIRGLSSAENFFENLPDKMRGPDTCSALLHS  149

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+     +AE+L ++M   G+ +  LPYN MLNLY+
Sbjct  150  YVQNKKSAEAEALMEKMSECGFLKCPLPYNHMLNLYI  186



>ref|XP_007029137.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY09639.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=360

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+  W+ D+   + ++  D AI+LDLI+KVHGI +AE YF ++P  LK   +Y +LL  
Sbjct  101  LEMSLWMTDK-RYFPMSYRDVAIRLDLIAKVHGIEHAENYFNSVPKQLKGLAVYSALLYC  159

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y R    EKAE+L   MR+ G  R+   +N++L+LY
Sbjct  160  YAREKSVEKAEALMQRMRDLGLDRSAFVFNVLLSLY  195



>ref|XP_008452263.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like [Cucumis melo]
Length=487

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW+  +  R+ +TT D AIQLDLI +V G+ +AEKYF ++    +  ++YGSLLN 
Sbjct  98   LEVSEWMCSKG-RFSLTTRDFAIQLDLIGQVRGLDSAEKYFGSVSKQKEIGKLYGSLLNC  156

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YVR G+ +K+ +   +M+  G+  + L YN ++ LY+
Sbjct  157  YVREGLIDKSLAHMQKMKEMGFASSPLCYNDIMCLYL  193



>ref|XP_006396507.1| hypothetical protein EUTSA_v10028573mg [Eutrema salsugineum]
 gb|ESQ37960.1| hypothetical protein EUTSA_v10028573mg [Eutrema salsugineum]
Length=526

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CE++    E  K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++
Sbjct  107  LEICEYMV-LEEDIKLQPGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHS  165

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE+LF+ M   G+ ++ LPYN ML++Y+
Sbjct  166  YVQNKLSDKAEALFERMAECGFLKSCLPYNHMLSMYI  202



>ref|XP_010662164.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial isoform X1 [Vitis vinifera]
 ref|XP_010662165.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial isoform X1 [Vitis vinifera]
 emb|CBI26594.3| unnamed protein product [Vitis vinifera]
Length=529

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + +  K+   D A+ LDLI+K+ G+++AEK+F  L + +K +    +LL+ 
Sbjct  108  LEICEWMTKQHD-IKLLAGDYAVHLDLIAKIRGLASAEKFFEDLSDKMKGQPTCTALLHT  166

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + EKAE+L ++M   G+ +  LPYN M++LY+
Sbjct  167  YVQNKVSEKAEALMEKMSECGFLKCPLPYNHMISLYI  203



>gb|EMT11631.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=1113

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ +W+  R    K+T    A++LDL+SKVHGI  AE+YF +LP+ LK R+ Y SLLN 
Sbjct  158  LELMDWMEARGA--KLTPGHQALRLDLVSKVHGIQAAEEYFWSLPDILKSRKAYSSLLNC  215

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y   GM  K    +++M+ +    NTL YN ++ LY
Sbjct  216  YGEHGMAFKGLKFYEKMKAKNIVPNTLVYNSLMVLY  251


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 4/92 (4%)
 Frame = +1

Query  13   EWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRV  192
            +W+  R    K+T    A++L L+SKVHGI  AE+YF +LP+  K ++ Y SLLN Y   
Sbjct  710  DWMESRGA--KLTPGHQALRLGLVSKVHGIQAAEEYFWSLPD--KSKKTYSSLLNCYGEH  765

Query  193  GMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             M  K   L+++M+      NTL YN ++ LY
Sbjct  766  RMASKGLELYEKMKVMDIVPNTLLYNNLMTLY  797



>gb|KJB23095.1| hypothetical protein B456_004G080600 [Gossypium raimondii]
Length=515

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + +  K+   D A+ LDLI+KV G+++AEK+F  LP  ++ +    +LL+ 
Sbjct  97   LEICEWMRLQQD-IKLLPGDYAVHLDLIAKVRGLTSAEKFFEDLPEKMRGQATCTALLHT  155

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNL  285
            YV+  +  KAE+L ++M   G+ +N LPYN M++L
Sbjct  156  YVQNKLSAKAEALMEKMSECGFVKNPLPYNHMISL  190



>gb|KDP35619.1| hypothetical protein JCGZ_09057 [Jatropha curcas]
Length=495

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ +++ND    + ++  D A+QLDLISKV+GI  AEKYF  +P +     +Y +LLN 
Sbjct  90   LQISQFMND-GLCFDLSPGDAAVQLDLISKVYGIEEAEKYFSGIPENSISYVVYCALLNC  148

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YV     EKAE+L ++M   G+ +++  YNL+LNLY
Sbjct  149  YVHPKHLEKAEALIEKMNELGFIKSSPSYNLILNLY  184



>ref|XP_008339193.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g28020 [Malus domestica]
Length=900

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 63/96 (66%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EW++D    + +   D AI+L+LISKV G+  AEKYF ++P  L+  ++ G+LL+ 
Sbjct  515  LQISEWMSDELN-HDLHPGDIAIRLELISKVRGLEEAEKYFYSIPELLRVVQVCGALLSC  573

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE+LF++M++ G  R  LPYN ML LY
Sbjct  574  YAEHNCLEKAEALFEKMKHSG-IRGPLPYNTMLTLY  608


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 1/77 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ EW+ D    + +   D AI+LDLIS+VHG   AE+YF  +PN L D R   + L++
Sbjct  91   LEISEWMGDEMN-FDLHPGDIAIRLDLISRVHGNKRAERYFDCIPNELSDIRTLNNRLHS  149

Query  181  YVRVGMREKAESLFDEM  231
            Y       + E L  +M
Sbjct  150  YAATSDVGRMEKLLMKM  166



>gb|KDO70776.1| hypothetical protein CISIN_1g011472mg [Citrus sinensis]
Length=485

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++  W+  ++  + +T +D AI+LDLI+KV GI  A  YF  +P  LK   +Y +LLNA
Sbjct  103  LQISMWMTKKSN-FVLTPADVAIRLDLIAKVQGIEQAASYFNCVPEKLKLPSVYIALLNA  161

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE +  +MR+RG  + T+ YN M+N+Y
Sbjct  162  YACAKSAEKAEIIMQQMRDRGLVKKTIDYNSMMNVY  197



>gb|EEE67529.1| hypothetical protein OsJ_24995 [Oryza sativa Japonica Group]
Length=491

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = +1

Query  7    VCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYV  186
            V EW+N +    K    D A+ LDLI ++HG S AE YF  LP+  K  + YG+LLN Y 
Sbjct  103  VSEWMNAKG-HVKFLPKDHAVHLDLIGEIHGSSAAETYFNNLPDKDKTEKPYGALLNCYT  161

Query  187  RVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            R  + EK+ + F +M+  G+  +TLPYN ++ LY
Sbjct  162  RELLVEKSLAHFQKMKELGFVFSTLPYNNIMGLY  195



>ref|XP_006481675.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Citrus sinensis]
Length=485

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++  W+  ++  + +T +D AI+LDLI+KV GI  A  YF  +P  LK   +Y +LLNA
Sbjct  103  LQISMWMTKKSN-FVLTPADVAIRLDLIAKVQGIEQAASYFNCVPEKLKLPSVYIALLNA  161

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE +  +MR+RG  + T+ YN M+N+Y
Sbjct  162  YACAKSAEKAEIIMQQMRDRGLVKKTIDYNSMMNVY  197



>ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
Length=227

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ +W++D+   + ++T+D AI+++LI +VHG+   E YF  +P+ LK  +++ +LLN 
Sbjct  81   LEISKWMSDK-RYFPLSTADIAIRMNLILRVHGLEQVEDYFDNMPSQLKRYQVHIALLNC  139

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      +KA +   +++  G+  + LPYN+M+NLY
Sbjct  140  YAHEKCVDKANAFMQKIKEMGFANSPLPYNIMMNLY  175



>gb|KCW49953.1| hypothetical protein EUGRSUZ_K03412 [Eucalyptus grandis]
Length=470

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + +  K+   D A+ LDLI+KV G+++AEK+F  LP+ ++      +LL++
Sbjct  61   LEICEWMRLQQD-IKLLAGDYAVHLDLIAKVRGLNSAEKFFEDLPSQMRGEHTCNALLHS  119

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  +  KAE+L ++M + G+ ++ LPYN +L++Y+
Sbjct  120  YAKKQLSSKAEALIEKMSDCGFLKSPLPYNHILSMYV  156



>ref|XP_010038139.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Eucalyptus grandis]
Length=516

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + +  K+   D A+ LDLI+KV G+++AEK+F  LP+ ++      +LL++
Sbjct  97   LEICEWMRLQQD-IKLLAGDYAVHLDLIAKVRGLNSAEKFFEDLPSQMRGEHTCNALLHS  155

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  +  KAE+L ++M + G+ ++ LPYN +L++Y+
Sbjct  156  YAKKQLSSKAEALIEKMSDCGFLKSPLPYNHILSMYV  192



>emb|CAN64701.1| hypothetical protein VITISV_037299 [Vitis vinifera]
Length=1111

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + +  K+   D A+ LDLI+K+ G+++AEK+F  L + +K +    +LL+ 
Sbjct  108  LEICEWMTKQHD-IKLLAGDYAVHLDLIAKIRGLASAEKFFEDLSDKMKGQPTCTALLHT  166

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + EKAE+L ++M   G+ +  LPYN M++LY+
Sbjct  167  YVQNKVSEKAEALMEKMSECGFLKCPLPYNHMISLYI  203



>ref|XP_009615280.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Nicotiana tomentosiformis]
Length=545

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  + +  ++ + D A+ LDLI+KV G+++AEK+F  LP+ LK +    +LL+ 
Sbjct  126  LEVCEWMRVQ-DDIQLLSGDYAVHLDLIAKVRGMNSAEKFFEDLPDKLKSQTTCTALLHN  184

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+     KAE+L ++M   G+ +  LPYN ML+LY+
Sbjct  185  YVQHKNTSKAEALMEKMSECGFLKCPLPYNHMLSLYI  221



>ref|XP_006827771.1| hypothetical protein AMTR_s00009p00264580 [Amborella trichopoda]
 gb|ERM95187.1| hypothetical protein AMTR_s00009p00264580 [Amborella trichopoda]
Length=412

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +1

Query  40   YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  219
            + ++ SD AI+L+LI KVHG+  AE YF ++P  LK  ++YG+LLN +V   + EKAE+L
Sbjct  5    WNLSASDNAIRLELICKVHGLEYAEDYFESIPQYLKTFQVYGALLNCFVDKRLVEKAETL  64

Query  220  FDEMRNRGYTRNTLPYNLMLNLY  288
              EM   G   ++L YN ++NLY
Sbjct  65   VKEMNKFGLVDSSLTYNALMNLY  87



>ref|XP_008453822.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like isoform X1 [Cucumis melo]
Length=498

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++ EW+  R   Y  T  D A++LDLISKV+GI+ AEKYF  LP S K+R  YG+LLN 
Sbjct  85   LQIMEWMEIRKINYSFT--DYALRLDLISKVNGITAAEKYFYDLPPSAKNRCTYGALLNC  142

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M EKA +LF +M    +   +L +N ++ +YM
Sbjct  143  YCKEMMEEKASTLFKKMDELKFV-TSLAFNNLMTMYM  178



>ref|XP_006429968.1| hypothetical protein CICLE_v10011545mg [Citrus clementina]
 gb|ESR43208.1| hypothetical protein CICLE_v10011545mg [Citrus clementina]
Length=499

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +++  W+  ++  + +T +D AI+LDLI+KV GI  A  YF  +P  LK   +Y +LLNA
Sbjct  103  LQISMWMTKKSN-FVLTPADVAIRLDLIAKVQGIEQAANYFNCVPEKLKLPSVYIALLNA  161

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE +  +MR+RG  + T+ YN M+N+Y
Sbjct  162  YACAKSAEKAEIIMQQMRDRGLVKKTIDYNSMMNVY  197



>ref|XP_008368256.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Malus domestica]
Length=489

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +1

Query  49   TTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFDE  228
            T SD AI LDL++KV GI  AE YF+ LP S K    YG+LLN Y +  M EKAE+L ++
Sbjct  88   TVSDQAIHLDLVAKVRGIPAAESYFIDLPESAKTHLCYGALLNCYCKELMTEKAEALIEK  147

Query  229  MRNRGYTRNTLPYNLMLNLY  288
            M+       ++PYN ++ LY
Sbjct  148  MKALNLPLTSMPYNSLMTLY  167



>ref|XP_004495206.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Cicer arietinum]
Length=510

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  + +  K+   D A+ LDLI+KV G+++AEK+F  LP+ ++ +    +LL+A
Sbjct  86   LEVCEWMKLQND-IKLVEGDYAVHLDLITKVRGLNSAEKFFEDLPDKMRGQPTCTALLHA  144

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  + +KAE++  +M   G+ ++ +PYN M++LY+
Sbjct  145  YVQNNLADKAEAIMLKMSECGFLQSPIPYNRMMSLYI  181



>dbj|BAK01251.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW++ +    +    D A+ LDLI +VHGI  AE YF TLP+  K  + YG+LLN 
Sbjct  110  LEVSEWMSAKGH-VRFLPKDYAVHLDLIGQVHGIGAAEAYFNTLPDKDKTEKPYGALLNC  168

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y R  M + + + F +M+  G+  ++LPYN ++ LY
Sbjct  169  YTRELMVDGSLAHFQKMKELGFVFSSLPYNNLMGLY  204



>ref|XP_006661923.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Oryza brachyantha]
Length=521

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+  W+ +R   + ++  D A +LDLISKVHG+  A +YF ++PN L+ ++ YGSLL  
Sbjct  110  LELSMWMTERRHLH-LSPGDIAYRLDLISKVHGLDKAVEYFDSVPNQLRQQQCYGSLLRC  168

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y      EKAE LF++MR  G    +  YN+M+ LY
Sbjct  169  YAEANCVEKAEELFEKMRGMGIA-GSYAYNVMMKLY  203



>ref|XP_004240342.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Solanum lycopersicum]
Length=520

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  + +  ++ + D A+ LDLI+KV G+++AEK+F  LP+ LK +    +LL+ 
Sbjct  101  LEVCEWMRVQDD-IELLSGDYAVHLDLIAKVRGMNSAEKFFEDLPDKLKVQTTCTALLHT  159

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+     KAESL ++M   G+ +  LPYN ML LY+
Sbjct  160  YVQHKDTSKAESLMEKMSECGFLKYPLPYNHMLTLYI  196



>ref|XP_007029136.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY09638.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=496

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+  W+ D+   + ++  D AI+LDLI+KVHGI +AE YF ++P  LK   +Y +LL  
Sbjct  101  LEMSLWMTDK-RYFPMSYRDVAIRLDLIAKVHGIEHAENYFNSVPKQLKGLAVYSALLYC  159

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            Y R    EKAE+L   MR+ G  R+   +N++L+LY
Sbjct  160  YAREKSVEKAEALMQRMRDLGLDRSAFVFNVLLSLY  195



>ref|XP_007021400.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY12925.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
Length=506

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 66/96 (69%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVC+W+++     + ++SD A+QLDLI +VHG+ +A+ +F ++ +  K  + YG+LLN 
Sbjct  93   LEVCKWMSN--SDLEFSSSDCAVQLDLIGRVHGLMSAKSFFSSMRDQEKTVKTYGALLNC  150

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YVR G+ +++ SL  +MR+ G+  + L YN ++ LY
Sbjct  151  YVREGLLDESLSLMKKMRDMGFLSSPLNYNDLMCLY  186



>ref|XP_006366127.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Solanum tuberosum]
Length=524

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EVCEW+  + +  ++ + D A+ LDLI+KV G+++AEK+F  LP+ LK +    +LL+ 
Sbjct  105  LEVCEWMRVQDD-IELLSGDYAVHLDLIAKVRGMNSAEKFFEDLPDKLKVQTTCTALLHT  163

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+     KAESL ++M   G+ +  LPYN ML LY+
Sbjct  164  YVQHKDTAKAESLMEKMSECGFLKYPLPYNHMLTLYI  200



>gb|AIZ68164.1| pentatricopeptide repeat-containing protein At1g60770-like isoform 
X1 [Ornithogalum saundersiae]
Length=491

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  46   ITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  225
            +T SD AI+LDL++K  GI++AE+YF+ LP   K    YG+LLN Y +  M EKAE++ +
Sbjct  85   LTNSDHAIRLDLVAKARGIASAEEYFVNLPEDAKTHLAYGALLNCYCKELMTEKAEAIME  144

Query  226  EMRNRGYTRNTLPYNLMLNLY  288
            +M+  G+  + + YN ++ LY
Sbjct  145  KMKEMGFASSPMAYNSLMTLY  165



>ref|XP_006644106.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Oryza brachyantha]
Length=412

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +1

Query  46   ITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  225
            ++ ++ AI+LDLI KVHGI  AEKYF  LP+  K+ R YG+LLN Y    M EKA  ++ 
Sbjct  12   MSYTNHAIRLDLIYKVHGIEAAEKYFADLPDPAKNHRTYGALLNCYCSAKMEEKAMDVYR  71

Query  226  EMRNRGYTRNTLPYNLMLNLYM  291
            +M   G + +TLP N +++LY+
Sbjct  72   KMDELGISSSTLPINNLMSLYV  93



>ref|XP_007050629.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOX94786.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=513

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + +  K+   D A+ LDLI+KV G+++AEK+F  LP+ ++ +    +LL+ 
Sbjct  95   LEICEWMRLQQD-IKLLPGDYAVHLDLIAKVRGLASAEKFFEDLPDQMRGQATCTALLHT  153

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+  +  KAE+L  +M   G+ +  LP+N ML+LY+
Sbjct  154  YVQNKLFAKAETLMKKMSECGFVKCPLPFNHMLSLYI  190



>ref|XP_008453823.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like isoform X2 [Cucumis melo]
Length=411

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = +1

Query  13   EWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRV  192
            EW+  R   Y  T  D A++LDLISKV+GI+ AEKYF  LP S K+R  YG+LLN Y + 
Sbjct  2    EWMEIRKINYSFT--DYALRLDLISKVNGITAAEKYFYDLPPSAKNRCTYGALLNCYCKE  59

Query  193  GMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
             M EKA +LF +M    +   +L +N ++ +YM
Sbjct  60   MMEEKASTLFKKMDELKFV-TSLAFNNLMTMYM  91



>ref|XP_010662166.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial isoform X2 [Vitis vinifera]
Length=470

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = +1

Query  7    VCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYV  186
            +CEW+  + +  K+   D A+ LDLI+K+ G+++AEK+F  L + +K +    +LL+ YV
Sbjct  51   ICEWMTKQHD-IKLLAGDYAVHLDLIAKIRGLASAEKFFEDLSDKMKGQPTCTALLHTYV  109

Query  187  RVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            +  + EKAE+L ++M   G+ +  LPYN M++LY+
Sbjct  110  QNKVSEKAEALMEKMSECGFLKCPLPYNHMISLYI  144



>ref|XP_011079842.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Sesamum indicum]
Length=523

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+CEW+  + E  K+   D A+ LDLI+K+ G+++AEK+F  LP  ++      +LL+ 
Sbjct  105  LEICEWMRIQ-EDMKLVPGDYAVHLDLIAKIRGLNSAEKFFEDLPEKMRAPATCSALLHT  163

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            YV+     KAE+L ++M   G+ ++ LP+N ML+LY+
Sbjct  164  YVQHKESNKAEALMEKMSECGFLKSPLPFNHMLSLYV  200



>ref|XP_008381422.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Malus domestica]
Length=505

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ EW+  R   Y  + +D AI++DL+SKV GI  AE YF  LP S KDR  YG+LLN 
Sbjct  88   LEIMEWMEFRKMNY--SKADYAIRVDLMSKVKGIGAAEDYFSGLPESSKDRFTYGALLNC  145

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M EKA + F+ M    +  +TL +N +++L+M
Sbjct  146  YCKELMEEKALAHFETMDELNFASSTLVFNNLMSLHM  182



>ref|XP_008800895.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Phoenix dactylifera]
Length=485

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  46   ITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  225
            +T SD AI+LDL++K  GI++AE YF+ LP + K+   YG+LLN Y +  M +KAE+L +
Sbjct  83   LTVSDQAIRLDLVAKARGIASAEDYFINLPETAKNHLTYGALLNCYCKELMTDKAEALME  142

Query  226  EMRNRGYTRNTLPYNLMLNLY  288
            +M+   +T + + YN ++ LY
Sbjct  143  KMKELKFTSSPMAYNSLMTLY  163



>ref|XP_008442434.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis melo]
Length=455

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEVCEWINDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  177
            +E+ +W++D+  RY  ++T D A +++LI +VHG+   E YF  +P+ LK   ++ +LLN
Sbjct  81   LEISKWMSDK--RYLPLSTDDVATRMNLILRVHGLEQVEDYFNNMPSQLKRYHVHIALLN  138

Query  178  AYVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
             Y      +KA +   +++  GY ++TLPYN+M+NLY
Sbjct  139  CYAHEKCVDKANAFLQKIKEMGYAKSTLPYNIMMNLY  175



>ref|XP_009349931.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial [Pyrus x bretschneideri]
Length=511

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +E+ EW+  R   Y  + +D AI++DL+SKV GI  AE YF  LP S KDR  YG+LLN 
Sbjct  94   LEIMEWMEFRKMNY--SKADYAIRVDLMSKVKGIGAAEDYFSGLPESSKDRFTYGALLNC  151

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLYM  291
            Y +  M EKA + F+ M    +  +TL +N +++L+M
Sbjct  152  YCKELMEEKALAHFETMDELNFASSTLVFNNLMSLHM  188



>ref|XP_009390562.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial [Musa acuminata subsp. malaccensis]
 ref|XP_009390570.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=514

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  1    VEVCEWINDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  180
            +EV EW+  + ++ +  +SD A+ LDLI +VHG+S+AE YF  +  + K+ + YG+LLN 
Sbjct  95   LEVSEWMKGK-QKIQFMSSDHAVHLDLIGQVHGLSSAESYFNNMRENDKNEKTYGALLNC  153

Query  181  YVRVGMREKAESLFDEMRNRGYTRNTLPYNLMLNLY  288
            YVR  + EK+ S   +M+  G   + LPYN ++ LY
Sbjct  154  YVRERLVEKSLSHIQKMKELGLVSSPLPYNDIMCLY  189



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570625233910