BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF007A14

Length=213
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABR13297.1|  putative elongation factor 1-alpha                      106   2e-27   Prunus dulcis [sweet almond]
gb|KJB63203.1|  hypothetical protein B456_009G4199002                   103   1e-26   Gossypium raimondii
ref|XP_003591963.1|  Elongation factor 1-alpha                          102   2e-26   
emb|CBI31496.3|  unnamed protein product                                105   2e-26   Vitis vinifera
gb|AFK35720.1|  unknown                                                 103   3e-26   Medicago truncatula
ref|XP_006307728.1|  hypothetical protein CARUB_v100092940mg            102   5e-26   
gb|KJB73629.1|  hypothetical protein B456_011G2414002                   103   6e-26   Gossypium raimondii
gb|AGH32904.1|  translation elongation factor 1-alpha                   103   6e-26   Camellia oleifera [abura-tsubaki]
gb|KJB73625.1|  hypothetical protein B456_011G2412001                   103   6e-26   Gossypium raimondii
dbj|BAJ91931.1|  predicted protein                                      103   8e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003618775.1|  Elongation factor 1-alpha                          110   9e-26   
gb|AFW76433.1|  putative translation elongation factor Tu family ...    102   1e-25   
gb|AEG78681.1|  elongation factor 1 alpha                               104   1e-25   Erythroxylum coca [coca]
ref|XP_004172806.1|  PREDICTED: elongation factor 1-alpha-like          102   2e-25   
gb|ACG70967.1|  translation elongation factor 1                         104   2e-25   Ziziphus jujuba [Chinese jujube]
gb|AEQ94148.1|  elongation factor 1                                     104   2e-25   Elaeis guineensis
emb|CDP07148.1|  unnamed protein product                                106   2e-25   Coffea canephora [robusta coffee]
gb|EAY88762.1|  hypothetical protein OsI_10238                          102   2e-25   Oryza sativa Indica Group [Indian rice]
emb|CDP08919.1|  unnamed protein product                                106   2e-25   Coffea canephora [robusta coffee]
ref|XP_006307727.1|  hypothetical protein CARUB_v100096371mg            102   2e-25   
gb|AEK98799.1|  translation elongation factor 1 alfa                    104   2e-25   Carthamus tinctorius
emb|CDY09214.1|  BnaA02g06400D                                          102   2e-25   Brassica napus [oilseed rape]
gb|AFW77598.1|  putative translation elongation factor Tu family ...    102   3e-25   
emb|CDY06287.1|  BnaA09g49160D                                          103   4e-25   
ref|XP_002538495.1|  elongation factor 1-alpha, putative                101   5e-25   Ricinus communis
emb|CDO98621.1|  unnamed protein product                                104   6e-25   Coffea canephora [robusta coffee]
gb|AFJ04514.1|  elongation factor 1-alpha                               105   7e-25   Vernicia fordii [tung oil tree]
ref|XP_007009762.1|  GTP binding Elongation factor Tu family prot...    104   7e-25   
gb|AHA84124.1|  elongation factor 1-alpha                               105   7e-25   Phaseolus vulgaris [French bean]
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          105   7e-25   Tarenaya hassleriana [spider flower]
gb|KHG28979.1|  Elongation factor 1-alpha                               105   7e-25   Gossypium arboreum [tree cotton]
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    104   8e-25   
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          104   8e-25   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP20796.1|  unnamed protein product                              99.8    8e-25   Coffea canephora [robusta coffee]
gb|ABA12220.1|  translation elongation factor 1A-4                      104   8e-25   Gossypium hirsutum [American cotton]
emb|CDY06289.1|  BnaA09g49140D                                          103   8e-25   
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          104   8e-25   Tarenaya hassleriana [spider flower]
ref|XP_001753059.1|  predicted protein                                  104   8e-25   
ref|NP_001290506.1|  elongation factor 1-alpha                          104   8e-25   Elaeis guineensis
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               104   8e-25   Tarenaya hassleriana [spider flower]
ref|XP_010248287.1|  PREDICTED: elongation factor 1-alpha               104   8e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               104   8e-25   Phoenix dactylifera
gb|AGY80449.1|  elongation factor 1-alpha                               104   8e-25   Dendrocalamus latiflorus [sweet bamboo]
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     104   8e-25   Eucalyptus grandis [rose gum]
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          104   8e-25   Tarenaya hassleriana [spider flower]
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          104   8e-25   Tarenaya hassleriana [spider flower]
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    104   8e-25   Glycine max [soybeans]
gb|KHN42761.1|  Elongation factor 1-alpha                               104   8e-25   Glycine soja [wild soybean]
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          104   8e-25   Phoenix dactylifera
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         104   8e-25   Jatropha curcas
gb|ABA12219.1|  translation elongation factor 1A-3                      104   8e-25   Gossypium hirsutum [American cotton]
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          104   8e-25   Phoenix dactylifera
ref|NP_001151074.1|  elongation factor 1-alpha                          104   8e-25   
gb|ABA12217.1|  translation elongation factor 1A-1                      104   8e-25   Gossypium hirsutum [American cotton]
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             104   8e-25   Phaseolus vulgaris [French bean]
gb|AGI15328.1|  elongation factor 1                                     104   8e-25   Aegiceras corniculatum
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          104   8e-25   Elaeis guineensis
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         104   8e-25   Jatropha curcas
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          104   8e-25   Eucalyptus grandis [rose gum]
gb|AAX54511.1|  elongation factor 1 alpha                               104   8e-25   Actinidia deliciosa [Chinese gooseberry]
ref|XP_001753181.1|  predicted protein                                  104   8e-25   
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          104   8e-25   Amborella trichopoda
ref|XP_001763201.1|  predicted protein                                  104   8e-25   
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          104   8e-25   Sesamum indicum [beniseed]
gb|EPS66340.1|  elongation factor 1-alpha                               104   8e-25   Genlisea aurea
gb|KHG26926.1|  Elongation factor 1-alpha                               104   8e-25   Gossypium arboreum [tree cotton]
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               104   8e-25   Elaeis guineensis
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          104   8e-25   Amborella trichopoda
ref|XP_001753167.1|  predicted protein                                  104   8e-25   
ref|XP_001763194.1|  predicted protein                                  104   8e-25   
ref|XP_001766482.1|  predicted protein                                  104   8e-25   
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          104   8e-25   Elaeis guineensis
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          104   8e-25   Solanum tuberosum [potatoes]
gb|ABA12225.1|  translation elongation factor 1A-9                      104   9e-25   Gossypium hirsutum [American cotton]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    104   9e-25   
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    104   9e-25   
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                104   9e-25   Erythranthe guttata [common monkey flower]
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    104   9e-25   Daucus carota [carrots]
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          104   9e-25   Solanum lycopersicum
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     104   9e-25   Glycine max [soybeans]
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             104   9e-25   Populus trichocarpa [western balsam poplar]
gb|ABF00115.1|  elongation factor 1-alpha                               104   9e-25   Litchi chinensis [litchi]
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               104   9e-25   Sesamum indicum [beniseed]
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               104   9e-25   Tarenaya hassleriana [spider flower]
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               104   9e-25   Nicotiana tomentosiformis
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          104   9e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          104   9e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               104   9e-25   Pyrus x bretschneideri [bai li]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          104   9e-25   Pyrus x bretschneideri [bai li]
gb|AAY56337.1|  elongation factor-1 alpha                               104   9e-25   Musa acuminata [banana]
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          104   9e-25   Elaeis guineensis
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               104   9e-25   Elaeis guineensis
gb|KHG01531.1|  Elongation factor 1-alpha                               104   9e-25   Gossypium arboreum [tree cotton]
gb|AHZ58493.1|  translation elongation factor alpha                     104   9e-25   Syntrichia caninervis
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          104   9e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003604587.1|  Elongation factor 1-alpha                          104   9e-25   Medicago truncatula
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               104   9e-25   Vitis vinifera
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               104   9e-25   Vitis vinifera
gb|EPS66069.1|  elongation factor 1-alpha                               104   9e-25   Genlisea aurea
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          104   9e-25   Eucalyptus grandis [rose gum]
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    104   9e-25   Sesamum indicum [beniseed]
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               104   9e-25   Tarenaya hassleriana [spider flower]
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    104   9e-25   Theobroma cacao [chocolate]
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               104   9e-25   Nicotiana tomentosiformis
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               104   9e-25   Eucalyptus grandis [rose gum]
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    104   9e-25   Manihot esculenta [manioc]
gb|ABA12221.1|  translation elongation factor 1A-5                      104   9e-25   Gossypium hirsutum [American cotton]
gb|ABA12224.1|  translation elongation factor 1A-8                      104   9e-25   Gossypium hirsutum [American cotton]
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          104   9e-25   Nelumbo nucifera [Indian lotus]
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         104   9e-25   Medicago truncatula
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          104   9e-25   Cicer arietinum [garbanzo]
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          104   9e-25   Nicotiana sylvestris
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          104   9e-25   Sorghum bicolor [broomcorn]
gb|KHG23927.1|  Elongation factor 1-alpha                               104   9e-25   Gossypium arboreum [tree cotton]
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        104   9e-25   Hevea brasiliensis [jebe]
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    104   9e-25   Vicia faba [broad bean]
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          104   9e-25   
gb|ABA12223.1|  translation elongation factor 1A-7                      104   1e-24   Gossypium hirsutum [American cotton]
dbj|BAA34348.1|  elongation factor-1 alpha                              104   1e-24   Nicotiana paniculata
ref|XP_001763198.1|  predicted protein                                  103   1e-24   
ref|XP_002528028.1|  elongation factor 1-alpha, putative                104   1e-24   
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    104   1e-24   Theobroma cacao [chocolate]
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         104   1e-24   Medicago truncatula
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          104   1e-24   Nicotiana tomentosiformis
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   104   1e-24   Lilium longiflorum [Easter lily]
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   104   1e-24   Lilium longiflorum [Easter lily]
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    104   1e-24   Eucalyptus grandis [rose gum]
gb|AEN79476.1|  elongation factor 1-alpha                               104   1e-24   Ziziphus jujuba [Chinese jujube]
gb|AAL69396.1|  elongation factor 1-alpha                               104   1e-24   Elaeis oleifera
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        104   1e-24   Hevea brasiliensis [jebe]
ref|XP_003604823.1|  Elongation factor 1-alpha                          104   1e-24   
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               104   1e-24   Vitis vinifera
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   104   1e-24   Lilium longiflorum [Easter lily]
ref|WP_041515120.1|  elongation factor 1-alpha                        98.6    1e-24   
gb|AFW87115.1|  putative translation elongation factor Tu family ...    102   1e-24   
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         104   1e-24   Medicago truncatula
ref|XP_008465824.1|  PREDICTED: elongation factor 1-alpha-like          102   1e-24   Cucumis melo [Oriental melon]
ref|XP_003588821.1|  Elongation factor 1-alpha                          104   1e-24   
emb|CDY67375.1|  BnaC03g71520D                                          102   1e-24   Brassica napus [oilseed rape]
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    105   1e-24   
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         104   1e-24   Medicago truncatula
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        104   1e-24   Bruguiera sexangula
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             103   1e-24   Prunus persica
gb|EYU18869.1|  hypothetical protein MIMGU_mgv1a010191mg                103   2e-24   Erythranthe guttata [common monkey flower]
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    106   2e-24   
gb|ABA12222.1|  translation elongation factor 1A-6                      103   2e-24   Gossypium hirsutum [American cotton]
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          103   2e-24   Prunus mume [ume]
gb|ABR13300.1|  putative elongation factor eEF1-alpha chain A4        97.4    2e-24   Prunus dulcis [sweet almond]
gb|ABF94275.1|  Elongation factor 1-alpha, putative, expressed          103   2e-24   Oryza sativa Japonica Group [Japonica rice]
gb|AFO67216.1|  putative elongation factor 1-alpha                      102   2e-24   Aralia elata
gb|EEE58429.1|  hypothetical protein OsJ_09630                          103   2e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EMS65134.1|  Elongation factor 1-alpha                               105   3e-24   Triticum urartu
gb|KHG15275.1|  Elongation factor 1-alpha                               103   3e-24   Gossypium arboreum [tree cotton]
ref|XP_003591959.1|  Elongation factor 1-alpha                          104   3e-24   
ref|NP_001077483.1|  elongation factor 1-alpha 2                        102   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          103   3e-24   Cucumis sativus [cucumbers]
emb|CDY61938.1|  BnaCnng38780D                                          103   3e-24   Brassica napus [oilseed rape]
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          103   3e-24   Oryza brachyantha
ref|NP_001049145.1|  Os03g0177400                                       103   3e-24   
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          103   3e-24   Populus euphratica
ref|XP_008349743.1|  PREDICTED: elongation factor 1-alpha isoform X2    102   3e-24   
gb|ABA12218.1|  translation elongation factor 1A-2                      103   3e-24   Gossypium hirsutum [American cotton]
dbj|BAA23658.1|  EF-1 alpha                                             103   3e-24   Oryza sativa [red rice]
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               103   3e-24   Cucumis melo [Oriental melon]
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             103   3e-24   Prunus persica
gb|ABR17675.1|  unknown                                                 103   3e-24   Picea sitchensis
gb|AIZ68131.1|  translation elongation factor 1-alpha                   103   3e-24   Ornithogalum longebracteatum [sea-onion]
emb|CDY22710.1|  BnaC08g43440D                                          103   3e-24   Brassica napus [oilseed rape]
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               103   3e-24   Cucumis melo [Oriental melon]
gb|KJB09231.1|  hypothetical protein B456_001G130700                    103   3e-24   Gossypium raimondii
gb|KHN14872.1|  Elongation factor 1-alpha                               103   3e-24   Glycine soja [wild soybean]
gb|ACN41180.1|  unknown                                                 103   3e-24   Picea sitchensis
gb|AAC15413.1|  translation elongation factor-1 alpha                   103   3e-24   Oryza sativa Japonica Group [Japonica rice]
dbj|BAO57272.1|  elongation factor 1-alpha                              103   3e-24   Ipomoea nil [qian niu]
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     103   3e-24   Glycine max [soybeans]
emb|CDX88757.1|  BnaA03g08920D                                          102   3e-24   
gb|AIZ74328.1|  translation elongation factor 1-alpha                   103   3e-24   Pinus massoniana [Chinese red pine]
gb|AGH32502.1|  translation elongation factor-1 alpha                   103   3e-24   Stylosanthes guianensis [stylo]
gb|ADI24333.1|  elongation factor 1-alpha                               103   3e-24   Miscanthus sinensis
gb|ACN40740.1|  unknown                                                 103   3e-24   Picea sitchensis
ref|NP_001105587.1|  elongation factor 1-alpha                          103   3e-24   Zea mays [maize]
gb|ABU63160.1|  elongation factor                                       103   3e-24   Saccharum officinarum [noble cane]
gb|ABK25072.1|  unknown                                                 103   3e-24   Picea sitchensis
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             103   3e-24   Citrus clementina [clementine]
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 103   3e-24   Larix kaempferi [karamatsu]
ref|NP_001152668.1|  LOC100286309                                       103   3e-24   Zea mays [maize]
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             103   3e-24   Citrus clementina [clementine]
gb|ABK24265.1|  unknown                                                 103   3e-24   Picea sitchensis
emb|CDX93604.1|  BnaA06g04440D                                          103   3e-24   
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          103   3e-24   Cucumis sativus [cucumbers]
gb|ABK24843.1|  unknown                                                 103   3e-24   Picea sitchensis
ref|NP_001032107.1|  elongation factor 1-alpha 4                        102   3e-24   
gb|KCW51623.1|  hypothetical protein EUGRSUZ_J01112                     102   3e-24   Eucalyptus grandis [rose gum]
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             103   3e-24   
gb|ACN40081.1|  unknown                                                 103   3e-24   Picea sitchensis
gb|AFC88830.1|  putative elongation factor 1-alpha                      103   3e-24   Miscanthus sinensis
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               103   3e-24   Prunus mume [ume]
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 103   3e-24   Larix kaempferi [karamatsu]
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               103   3e-24   Brachypodium distachyon [annual false brome]
gb|KJB76528.1|  hypothetical protein B456_012G093800                    103   3e-24   Gossypium raimondii
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    103   3e-24   Populus euphratica
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  103   3e-24   Citrus sinensis [apfelsine]
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          103   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          103   3e-24   
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    103   3e-24   Zea mays [maize]
gb|AFP44110.1|  elongation factor 1-alpha                               103   3e-24   Lycoris longituba
ref|XP_010456376.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    102   3e-24   
gb|KHG27341.1|  Elongation factor 1-alpha                               103   3e-24   Gossypium arboreum [tree cotton]
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               103   3e-24   Malus domestica [apple tree]
ref|NP_001280807.1|  elongation factor 1-alpha-like                     103   3e-24   Malus domestica [apple tree]
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               103   3e-24   Fragaria vesca subsp. vesca
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    103   4e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             103   4e-24   Citrus clementina [clementine]
gb|EMS52529.1|  Elongation factor 1-alpha                               103   4e-24   Triticum urartu
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    103   4e-24   
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     103   4e-24   Saccharum hybrid cultivar CP65-357
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    103   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          103   4e-24   Cicer arietinum [garbanzo]
ref|XP_011031786.1|  PREDICTED: elongation factor 1-alpha-like          102   4e-24   Populus euphratica
emb|CAA34456.1|  elongation factor 1-alpha                              103   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               103   4e-24   Prunus mume [ume]
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          103   4e-24   Amborella trichopoda
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    103   4e-24   Nicotiana tabacum [American tobacco]
gb|AFW90638.1|  elongation factor 1-alpha-like protein                  102   4e-24   Solanum tuberosum [potatoes]
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             103   4e-24   Capsella rubella
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    103   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32631.1|  putative elongation factor 1-a                          103   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          103   4e-24   Malus domestica [apple tree]
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             103   4e-24   Prunus persica
gb|AEQ75495.1|  elongation factor 1-alpha                               103   4e-24   Rosa multiflora [Japanese rose]
gb|ACS68200.1|  elongation factor 1 alpha                               103   4e-24   Brassica napus [oilseed rape]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        103   4e-24   Brassica rapa
ref|NP_200847.1|  elongation factor 1-alpha 4                           103   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               103   4e-24   Nicotiana sylvestris
dbj|BAH19898.1|  AT1G07930                                              103   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             103   4e-24   Eutrema salsugineum [saltwater cress]
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          102   4e-24   Malus domestica [apple tree]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             102   4e-24   Brassica rapa
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          102   4e-24   Nicotiana sylvestris
gb|ACI96243.1|  elongation factor 1-alpha                               102   4e-24   Prunus persica
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             102   4e-24   Prunus persica
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        102   4e-24   Brassica rapa
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                102   4e-24   Erythranthe guttata [common monkey flower]
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        102   4e-24   Brassica rapa
gb|AAL57653.1|  At1g07930/T6D22_3                                       102   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          102   4e-24   Fragaria vesca subsp. vesca
gb|AIX10769.1|  elongation factor 1 alpha                               102   4e-24   Panax notoginseng [san-qi]
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          102   4e-24   
ref|XP_002488881.1|  hypothetical protein SORBIDRAFT_2635s002010      98.2    4e-24   
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             102   4e-24   Phaseolus vulgaris [French bean]
gb|AGV54713.1|  elongation factor 1-alpha                               102   4e-24   Phaseolus vulgaris [French bean]
gb|KHN18669.1|  Elongation factor 1-alpha                               102   4e-24   Glycine soja [wild soybean]
ref|NP_001104939.1|  elongation factor alpha6                           102   4e-24   Zea mays [maize]
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          102   4e-24   
gb|ACG34498.1|  elongation factor 1-alpha                               102   5e-24   Zea mays [maize]
gb|AFW77593.1|  putative translation elongation factor Tu family ...    102   5e-24   
ref|NP_001105617.1|  elongation factor alpha3                           102   5e-24   Zea mays [maize]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         102   5e-24   
ref|NP_001288465.1|  elongation factor 1-alpha-like                     102   5e-24   Zea mays [maize]
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               102   5e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          102   5e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          102   5e-24   
ref|NP_001237425.1|  elongation factor-1A                               102   5e-24   
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    102   5e-24   Theobroma cacao [chocolate]
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             102   5e-24   Phaseolus vulgaris [French bean]
ref|NP_001105565.1|  elongation factor alpha5                           102   5e-24   
ref|NP_001105934.1|  elongation factor alpha7                           102   5e-24   
ref|NP_001105933.1|  elongation factor alpha2                           102   5e-24   
dbj|BAM13877.1|  elongation factor 1 alpha                              102   5e-24   Arum maculatum [cuckoo-pint]
gb|ABB16977.1|  elongation factor 1-alpha-like protein                  101   5e-24   Solanum tuberosum [potatoes]
gb|ACR38047.1|  unknown                                                 102   5e-24   Zea mays [maize]
gb|ABD66517.1|  EF-1 alpha                                              102   5e-24   Gymnadenia conopsea
ref|NP_001288407.1|  elongation factor 1-alpha-like                     102   5e-24   Zea mays [maize]
gb|AAF99703.1|  elongation factor                                       102   5e-24   Saccharum officinarum [noble cane]
gb|AGT16893.1|  elongation factor 1-alpha                               102   5e-24   Saccharum hybrid cultivar R570
gb|ACG31866.1|  elongation factor 1-alpha                               102   5e-24   Zea mays [maize]
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    102   5e-24   Setaria italica
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    102   5e-24   Glycine max [soybeans]
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          102   5e-24   Zea mays [maize]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    102   5e-24   
gb|KHG20498.1|  Elongation factor 1-alpha                               102   5e-24   
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    102   5e-24   
gb|EMS59091.1|  Elongation factor 1-alpha                               103   5e-24   
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          102   5e-24   
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    102   5e-24   
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          102   5e-24   
emb|CDX95108.1|  BnaC05g05630D                                          103   5e-24   
ref|XP_002311107.1|  ADR12-2 family protein                             102   5e-24   
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             102   6e-24   
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               102   6e-24   
ref|XP_002312029.1|  ADR12-2 family protein                             102   6e-24   
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             102   6e-24   
ref|XP_002311106.1|  ADR12-2 family protein                             102   6e-24   
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          102   6e-24   
gb|AGV54654.1|  elongation factor 1-alpha                               102   6e-24   
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    102   6e-24   
emb|CDY58828.1|  BnaAnng15460D                                          103   6e-24   
dbj|BAK08818.1|  elongation factor 1-alpha                              102   7e-24   
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          102   7e-24   
gb|AEE98364.1|  elongation factor 1-alpha                               102   7e-24   
gb|EMT12343.1|  Elongation factor 1-alpha                               102   7e-24   
gb|EMS49772.1|  Elongation factor 1-alpha                               102   7e-24   
gb|AGC94754.1|  elongation factor 1 alpha                               102   7e-24   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    102   7e-24   
dbj|BAK08744.1|  elongation factor 1-alpha                              102   7e-24   
dbj|BAK08819.1|  elongation factor 1-alpha                              102   7e-24   
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         102   8e-24   
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  102   8e-24   
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    102   8e-24   
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    102   8e-24   
gb|AHB86963.1|  elongation factor 1-alpha                               102   8e-24   
gb|AID52924.1|  elongation factor 1-alpha                               102   8e-24   
gb|ABB86283.1|  elongation factor-1 alpha-like                          102   8e-24   
gb|AAR82894.1|  elongation factor 1-alpha                               102   8e-24   
gb|ADD71925.1|  translation elongation factor 1 alpha                   101   8e-24   
gb|AAN77897.1|  elongation factor 1 alpha                               102   8e-24   
ref|NP_001275481.1|  elongation factor 1-alpha-like                     102   8e-24   
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          102   8e-24   
gb|ABV26710.1|  elongation factor 1 alpha                               102   9e-24   
ref|NP_001234035.1|  elongation factor 1-alpha                          102   9e-24   
ref|XP_002518073.1|  elongation factor 1-alpha, putative                102   9e-24   
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             102   9e-24   
dbj|BAC23049.1|  Elongation factor 1-alpha                              102   9e-24   
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          102   9e-24   
dbj|BAM13874.1|  elongation factor 1 alpha                              102   9e-24   
gb|AHE76183.1|  elongation factor 1-alpha                               102   9e-24   
dbj|BAL14665.1|  elongation factor 1-alpha                              102   9e-24   
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             102   9e-24   
gb|AGJ50595.1|  EF1alpha                                                102   9e-24   
gb|AAK82537.1|  At1g07930/T6D22_3                                       102   9e-24   
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             102   9e-24   
ref|XP_002488910.1|  hypothetical protein SORBIDRAFT_2002s002020      99.4    1e-23   
dbj|BAC66180.1|  elongation factor 1A                                   102   1e-23   
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             102   1e-23   
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             102   1e-23   
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             101   1e-23   
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        101   1e-23   
gb|KJB76560.1|  hypothetical protein B456_012G094600                    101   1e-23   
ref|NP_001105935.1|  elongation factor alpha8                           101   1e-23   
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        101   1e-23   
gb|AGI78242.1|  elongation factor 1 alpha                               101   2e-23   
gb|ACN59918.1|  translation elongation factor-1 alpha                 99.0    2e-23   
ref|XP_005650451.1|  translation elongation factor                      101   2e-23   
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          101   2e-23   
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               101   2e-23   
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          101   2e-23   
gb|AER42621.1|  elongation factor 1 alpha                               101   2e-23   
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        101   2e-23   
gb|EMT09703.1|  Elongation factor 1-alpha                               103   2e-23   
ref|XP_002892424.1|  T6D22.2                                            103   2e-23   
gb|ACI66647.1|  Elongation factor 1-alpha, oocyte form                95.1    2e-23   
gb|AAF79822.1|AC026875_2  T6D22.2                                       103   2e-23   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    102   3e-23   
ref|NP_872242.1|  Protein EEF-1A.2, isoform b                         94.4    4e-23   
gb|EMT29997.1|  Elongation factor 1-alpha                             94.7    4e-23   
gb|AAH70131.1|  EEF1A1 protein                                        95.5    4e-23   
gb|ACI66483.1|  Elongation factor 1-alpha, oocyte form                97.1    4e-23   
gb|AAB71612.1|  elongation factor-TU-I alpha                          93.6    4e-23   
ref|XP_010898590.1|  PREDICTED: elongation factor 1-alpha, oocyte...  96.7    5e-23   
gb|ABB46372.1|  elongation factor-1 alpha                             94.4    5e-23   
gb|KFQ66851.1|  Elongation factor 1-alpha 2                           94.4    6e-23   
tpg|DAA26532.1|  TPA: eukaryotic translation elongation factor 1 ...  94.7    6e-23   
gb|ESL07732.1|  elongation factor 1-alpha                             99.0    6e-23   
ref|XP_004623237.1|  PREDICTED: elongation factor 1-alpha 1           94.0    6e-23   
gb|AAH70500.1|  EEF1A1 protein                                        93.6    6e-23   
dbj|BAF02151.1|  elongation factor 1-alpha                            99.8    6e-23   
emb|CAA27325.1|  unnamed protein product                              94.4    7e-23   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...  99.8    7e-23   
gb|EDL88755.1|  eukaryotic translation elongation factor 1 alpha ...  94.7    7e-23   
gb|EDL88757.1|  eukaryotic translation elongation factor 1 alpha ...  96.7    8e-23   
gb|AAU50552.1|  elongation factor 1-alpha                             92.8    9e-23   
ref|XP_004696599.1|  PREDICTED: elongation factor 1-alpha 1           94.4    1e-22   
ref|XP_004687163.1|  PREDICTED: elongation factor 1-alpha 2           94.0    1e-22   
ref|XP_010898589.1|  PREDICTED: elongation factor 1-alpha-like        95.5    1e-22   
ref|XP_855343.2|  PREDICTED: spidroin-2-like                          99.8    1e-22   
gb|ADJ18345.1|  elongation factor 1 alpha                             93.6    2e-22   
emb|CAF89665.1|  unnamed protein product                              97.4    2e-22   
gb|ADJ18335.1|  elongation factor 1 alpha                             93.6    2e-22   
ref|XP_007104009.1|  PREDICTED: elongation factor 1-alpha 2           99.8    2e-22   
ref|XP_003794755.1|  PREDICTED: elongation factor 1-alpha 1-like      95.9    2e-22   
emb|CCO27324.1|  One of 3 closely related C, albicans translation...  92.4    2e-22   
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed        98.2    2e-22   
ref|XP_006870724.1|  PREDICTED: elongation factor 1-alpha 1-like      94.0    2e-22   
gb|KFY69875.1|  hypothetical protein V499_09660                       92.8    2e-22   
ref|XP_006835853.1|  PREDICTED: elongation factor 1-alpha 1           94.7    2e-22   
ref|XP_004413149.1|  PREDICTED: elongation factor 1-alpha 1           94.4    2e-22   
gb|ABX82323.1|  elongation factor 1 subunit alpha                     95.9    2e-22   
dbj|BAC56481.1|  similar to elongation factor 1 alpha                 94.7    2e-22   
gb|AHY22512.1|  elongation factor-1 alpha                             94.0    2e-22   
gb|KFQ31255.1|  Elongation factor 1-alpha 2                           98.2    3e-22   
gb|EDL77726.1|  rCG25445, isoform CRA_g                               95.5    3e-22   
gb|AGD99674.1|  eukaryotic elongation factor 1A                       98.2    3e-22   
gb|ELR44723.1|  Elongation factor 1-alpha 2                           98.2    3e-22   
ref|XP_010736052.1|  PREDICTED: elongation factor 1-alpha-like        93.2    3e-22   
ref|XP_006235797.1|  PREDICTED: elongation factor 1-alpha 2 isofo...  98.2    3e-22   
gb|ELW68548.1|  Elongation factor 1-alpha 1                           92.8    3e-22   
gb|KHJ76656.1|  elongation factor Tu GTP binding domain protein       92.8    3e-22   
gb|ACN10382.1|  Elongation factor 1-alpha, oocyte form                95.9    3e-22   
gb|ELK00147.1|  Elongation factor 1-alpha 1                           94.7    4e-22   
ref|XP_677916.1|  hypothetical protein                                91.7    4e-22   
ref|XP_003781883.1|  PREDICTED: elongation factor 1-alpha 1-like      94.7    4e-22   
gb|EDL26406.1|  mCG15232, isoform CRA_g                               95.9    4e-22   
ref|XP_739354.1|  hypothetical protein                                91.7    4e-22   
gb|KFV43558.1|  Elongation factor 1-alpha 1                           92.0    4e-22   
gb|KFG35314.1|  elongation factor 1-alpha                             93.2    4e-22   
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha     97.4    4e-22   
gb|AAY56745.1|  elongation factor 1-alpha                             94.4    4e-22   
ref|XP_002033449.1|  GM21315                                          93.2    4e-22   
ref|XP_006839938.1|  PREDICTED: elongation factor 1-alpha 1-like      92.4    5e-22   
gb|ELW50063.1|  Putative elongation factor 1-alpha-like 3             95.5    5e-22   
gb|KFG37329.1|  elongation factor 1-alpha                             93.2    5e-22   
ref|XP_010834950.1|  PREDICTED: elongation factor 1-alpha 2           98.6    5e-22   
ref|XP_009490089.1|  PREDICTED: elongation factor 1-alpha 2-like      94.7    5e-22   
emb|CDQ86379.1|  unnamed protein product                              96.3    5e-22   
ref|XP_007185479.1|  PREDICTED: elongation factor 1-alpha 2           99.0    5e-22   
ref|XP_009435907.1|  PREDICTED: elongation factor 1-alpha 2           95.5    5e-22   
ref|XP_005963050.1|  PREDICTED: elongation factor 1-alpha 1-like      95.9    5e-22   
gb|KFH06452.1|  elongation factor 1-alpha                             93.2    5e-22   
gb|KFG40096.1|  elongation factor 1-alpha                             93.2    5e-22   
gb|ADI60310.1|  elongation factor 1-alpha                             97.4    5e-22   
ref|XP_006143728.1|  PREDICTED: elongation factor 1-alpha 1-like      95.1    5e-22   
dbj|BAI52945.1|  elongation factor-1 alpha                            94.0    5e-22   
ref|XP_007087142.1|  PREDICTED: elongation factor 1-alpha 2           98.2    5e-22   
gb|EDL77725.1|  rCG25445, isoform CRA_f                               95.9    5e-22   
gb|EDL77722.1|  rCG25445, isoform CRA_c                               95.9    5e-22   
ref|XP_010995318.1|  PREDICTED: elongation factor 1-alpha 2           98.2    5e-22   
ref|XP_011279138.1|  PREDICTED: elongation factor 1-alpha 2           98.2    5e-22   
gb|EDL26403.1|  mCG15232, isoform CRA_d                               95.9    6e-22   
ref|XP_004713925.1|  PREDICTED: elongation factor 1-alpha 1-like      94.4    6e-22   
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...  97.1    6e-22   
gb|EMP28454.1|  Elongation factor 1-alpha 1                           99.0    6e-22   
dbj|BAE48211.1|  elongation factor 1 alpha                            94.7    6e-22   
ref|XP_011372446.1|  PREDICTED: elongation factor 1-alpha 2           96.3    6e-22   
gb|KFG54794.1|  elongation factor 1-alpha                             93.2    6e-22   
emb|CDQ79596.1|  unnamed protein product                              97.1    6e-22   
tpg|DAA16277.1|  TPA: EF1a-like protein-like                          95.9    6e-22   
emb|CDJ63491.1|  elongation factor 1-alpha, putative                  97.4    6e-22   
ref|XP_003421836.1|  PREDICTED: elongation factor 1-alpha 2           97.8    6e-22   
emb|CEG79529.1|  Putative Translation elongation factor 1 alpha (...  92.0    6e-22   
ref|XP_007664608.1|  PREDICTED: elongation factor 1-alpha 1-like      94.4    6e-22   
gb|ADN94290.1|  elongation factor 1                                   96.3    6e-22   
gb|ADG23121.1|  elongation factor 1-alpha                             93.2    7e-22   
emb|CAC27139.1|  translation elongation factor-1 alpha                97.1    7e-22   
ref|XP_006639575.1|  PREDICTED: elongation factor 1-alpha 2-like      97.1    7e-22   
gb|AGH70141.1|  eukaryotic translation elongation factor 1 alpha      94.7    7e-22   
gb|ETI46843.1|  elongation factor 1-alpha                             90.9    7e-22   
ref|XP_008291129.1|  PREDICTED: elongation factor 1-alpha-like        95.1    7e-22   
ref|XP_006853526.1|  hypothetical protein AMTR_s00032p00225850        92.0    7e-22   
emb|CDH51885.1|  elongation factor 1-alpha                            91.7    7e-22   
ref|XP_004328624.1|  PREDICTED: elongation factor 1-alpha 1-like      91.7    7e-22   
gb|EDL77724.1|  rCG25445, isoform CRA_e                               95.9    7e-22   
ref|XP_005978307.1|  PREDICTED: elongation factor 1-alpha 1-like      95.9    7e-22   
ref|XP_005993540.1|  PREDICTED: elongation factor 1-alpha 2           96.3    7e-22   
gb|EDL26401.1|  mCG15232, isoform CRA_b                               95.9    8e-22   
ref|XP_003968866.1|  PREDICTED: elongation factor 1-alpha-like        97.1    8e-22   
ref|XP_005941029.1|  PREDICTED: elongation factor 1-alpha-like        95.9    8e-22   
ref|XP_006872109.1|  PREDICTED: elongation factor 1-alpha 1-like      95.1    8e-22   
ref|XP_006078264.1|  PREDICTED: elongation factor 1-alpha 1-like      95.1    8e-22   
dbj|BAE48214.1|  elongation factor 1 alpha                            94.7    8e-22   
ref|XP_004074126.1|  PREDICTED: elongation factor 1-alpha             97.1    8e-22   
gb|AAI28792.1|  Zgc:109885 protein                                    97.1    9e-22   
ref|XP_005965035.1|  PREDICTED: putative elongation factor 1-alph...  96.3    9e-22   
ref|NP_001035074.1|  eukaryotic translation elongation factor 1 a...  96.7    9e-22   
gb|AFM89216.1|  elongation factor-1 alpha                             96.7    9e-22   
ref|XP_006019355.1|  PREDICTED: elongation factor 1-alpha, oocyte...  97.1    9e-22   
ref|XP_007067667.1|  PREDICTED: elongation factor 1-alpha, oocyte...  96.7    9e-22   
gb|AAT91089.1|  elongation factor 1-alpha                             96.7    9e-22   
ref|XP_008704500.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...  96.7    9e-22   
ref|XP_005302147.1|  PREDICTED: elongation factor 1-alpha 1-like      96.7    9e-22   
ref|XP_010345028.1|  PREDICTED: elongation factor 1-alpha 1-like      97.1    9e-22   
ref|XP_008329252.1|  PREDICTED: elongation factor 1-alpha             96.7    9e-22   
ref|XP_005802896.1|  PREDICTED: elongation factor 1-alpha-like        96.7    9e-22   
gb|ETW34463.1|  elongation factor 1-alpha                             92.0    9e-22   
gb|ETM46594.1|  elongation factor 1-alpha                             90.5    9e-22   
ref|XP_008421114.1|  PREDICTED: elongation factor 1-alpha-like        96.7    9e-22   
dbj|BAG60202.1|  unnamed protein product                              95.9    1e-21   
ref|XP_002799708.1|  PREDICTED: elongation factor 1-alpha 1-like      95.9    1e-21   
emb|CDQ79597.1|  unnamed protein product                              96.7    1e-21   
ref|XP_003968867.1|  PREDICTED: elongation factor 1-alpha-like        96.7    1e-21   
ref|XP_006130557.1|  PREDICTED: elongation factor 1-alpha, oocyte...  96.7    1e-21   
ref|NP_001002371.1|  elongation factor 1-alpha 2                      96.7    1e-21   
gb|EDL26404.1|  mCG15232, isoform CRA_e                               94.7    1e-21   
ref|XP_007234722.1|  PREDICTED: elongation factor 1-alpha 2-like      96.7    1e-21   
ref|XP_010736036.1|  PREDICTED: elongation factor 1-alpha             96.7    1e-21   
emb|CDQ65136.1|  unnamed protein product                              96.7    1e-21   
gb|ACN10642.1|  Elongation factor 1-alpha                             96.7    1e-21   
ref|XP_006268032.1|  PREDICTED: elongation factor 1-alpha, oocyte...  96.7    1e-21   
ref|XP_006104297.1|  PREDICTED: elongation factor 1-alpha 2           95.5    1e-21   
ref|XP_007655497.1|  PREDICTED: elongation factor 1-alpha-like        95.5    1e-21   
ref|NP_001135381.1|  elongation factor 1-alpha                        96.7    1e-21   
ref|NP_001081521.1|  elongation factor 1-alpha, oocyte form           96.7    1e-21   
ref|NP_001079602.1|  elongation factor 1-alpha, oocyte form           96.7    1e-21   
dbj|BAF64485.1|  elongation factor 1 alpha isoform 2                  96.7    1e-21   
gb|EHH19518.1|  hypothetical protein EGK_02189                        96.3    1e-21   
ref|NP_989301.1|  eukaryotic translation elongation factor 1 alph...  96.7    1e-21   
ref|XP_011217823.1|  PREDICTED: putative elongation factor 1-alph...  95.5    1e-21   
gb|AAP80605.1|AF468039_1  elongation factor-1 alpha 2                 95.1    1e-21   
sp|P17508.2|EF1A3_XENLA  RecName: Full=Elongation factor 1-alpha,...  96.7    1e-21   
emb|CAF89666.1|  unnamed protein product                              95.5    1e-21   
ref|XP_007524537.1|  PREDICTED: elongation factor 1-alpha 2-like      96.3    1e-21   



>gb|ABR13297.1| putative elongation factor 1-alpha [Prunus dulcis]
Length=93

 Score =   106 bits (264),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 54/60 (90%), Gaps = 4/60 (7%)
 Frame = +2

Query  32   SPGFAK*NRMGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            SP F     MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  5    SPAFV----MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  60



>gb|KJB63203.1| hypothetical protein B456_009G4199002, partial [Gossypium raimondii]
Length=86

 Score =   103 bits (257),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_003591963.1| Elongation factor 1-alpha, partial [Medicago truncatula]
Length=60

 Score =   102 bits (255),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CBI31496.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   105 bits (261),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  42   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  92



>gb|AFK35720.1| unknown [Medicago truncatula]
Length=126

 Score =   103 bits (258),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_006307728.1| hypothetical protein CARUB_v100092940mg, partial [Capsella rubella]
 gb|EOA40626.1| hypothetical protein CARUB_v100092940mg, partial [Capsella rubella]
Length=88

 Score =   102 bits (253),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KJB73629.1| hypothetical protein B456_011G2414002, partial [Gossypium raimondii]
Length=154

 Score =   103 bits (258),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AGH32904.1| translation elongation factor 1-alpha, partial [Camellia oleifera]
Length=149

 Score =   103 bits (257),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KJB73625.1| hypothetical protein B456_011G2412001, partial [Gossypium raimondii]
Length=144

 Score =   103 bits (257),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>dbj|BAJ91931.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=144

 Score =   103 bits (256),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_003618775.1| Elongation factor 1-alpha [Medicago truncatula]
Length=987

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 7/68 (10%)
 Frame = +2

Query  8    SDSLSFRYSPGFAK*NRMGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFE  187
            S++L+FR+       N MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFE
Sbjct  531  SNNLTFRF-------NIMGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFE  583

Query  188  KEAAEMNK  211
            KEAAEMNK
Sbjct  584  KEAAEMNK  591


 Score =   104 bits (259),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AFW76433.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=130

 Score =   102 bits (254),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AEG78681.1| elongation factor 1 alpha [Erythroxylum coca]
Length=211

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_004172806.1| PREDICTED: elongation factor 1-alpha-like, partial [Cucumis sativus]
Length=128

 Score =   102 bits (253),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ACG70967.1| translation elongation factor 1, partial [Ziziphus jujuba]
Length=227

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AEQ94148.1| elongation factor 1 [Elaeis guineensis]
Length=221

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CDP07148.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   106 bits (264),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|EAY88762.1| hypothetical protein OsI_10238 [Oryza sativa Indica Group]
Length=156

 Score =   102 bits (254),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CDP08919.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   106 bits (264),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_006307727.1| hypothetical protein CARUB_v100096371mg, partial [Capsella rubella]
 gb|EOA40625.1| hypothetical protein CARUB_v100096371mg, partial [Capsella rubella]
Length=154

 Score =   102 bits (254),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AEK98799.1| translation elongation factor 1 alfa [Carthamus tinctorius]
Length=248

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CDY09214.1| BnaA02g06400D [Brassica napus]
Length=160

 Score =   102 bits (254),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AFW77598.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=167

 Score =   102 bits (253),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CDY06287.1| BnaA09g49160D [Brassica napus]
Length=227

 Score =   103 bits (256),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_002538495.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23888.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=167

 Score =   101 bits (252),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/51 (96%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CDO98621.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AFJ04514.1| elongation factor 1-alpha, partial [Vernicia fordii]
Length=438

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_007009762.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY18572.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
Length=367

 Score =   104 bits (259),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AHA84124.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CDP20796.1| unnamed protein product [Coffea canephora]
Length=105

 Score = 99.8 bits (247),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVD GKSTTTGHLIYKLGGIDKRV++RFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDFGKSTTTGHLIYKLGGIDKRVMQRFEKEAAEMNK  51



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CDY06289.1| BnaA09g49140D [Brassica napus]
Length=256

 Score =   103 bits (256),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_001753059.1| predicted protein [Physcomitrella patens]
 gb|EDQ82100.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010248287.1| PREDICTED: elongation factor 1-alpha, partial [Nelumbo nucifera]
Length=382

 Score =   104 bits (259),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KCW65375.1| hypothetical protein EUGRSUZ_G02807 [Eucalyptus grandis]
Length=428

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KDP29085.1| hypothetical protein JCGZ_16474 [Jatropha curcas]
Length=418

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|NP_001151074.1| elongation factor 1-alpha [Zea mays]
 gb|ACG41520.1| elongation factor 1-alpha [Zea mays]
 tpg|DAA63136.1| TPA: putative translation elongation factor Tu family protein 
[Zea mays]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AGI15328.1| elongation factor 1 [Aegiceras corniculatum]
Length=449

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_001753181.1| predicted protein [Physcomitrella patens]
 ref|XP_001753188.1| predicted protein [Physcomitrella patens]
 gb|EDQ82222.1| predicted protein [Physcomitrella patens]
 gb|EDQ82229.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_006856244.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
 gb|ERN17711.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_001763201.1| predicted protein [Physcomitrella patens]
 gb|EDQ72078.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=441

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_001753167.1| predicted protein [Physcomitrella patens]
 gb|EDQ82208.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_001763194.1| predicted protein [Physcomitrella patens]
 ref|XP_001763195.1| predicted protein [Physcomitrella patens]
 ref|XP_001763196.1| predicted protein [Physcomitrella patens]
 gb|EDQ72071.1| predicted protein [Physcomitrella patens]
 gb|EDQ72072.1| predicted protein [Physcomitrella patens]
 gb|EDQ72073.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_001766482.1| predicted protein [Physcomitrella patens]
 gb|EDQ68810.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|EYU36203.1| hypothetical protein MIMGU_mgv1a006301mg [Erythranthe guttata]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>sp|P29521.1|EF1A1_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 emb|CAA42843.1| elongation factor 1A [Daucus carota]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_006381487.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
 gb|ABK95720.1| unknown [Populus trichocarpa]
 gb|ERP59284.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABF00115.1| elongation factor 1-alpha [Litchi chinensis]
Length=446

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AHZ58493.1| translation elongation factor alpha [Syntrichia caninervis]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_003604587.1| Elongation factor 1-alpha [Medicago truncatula]
 gb|AES86784.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|EPS66069.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=446

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010521578.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Manihot 
esculenta]
 gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AES62210.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH43534.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_004512426.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004512427.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=448

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_002460859.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
 gb|EER97380.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_001763198.1| predicted protein [Physcomitrella patens]
 gb|EDQ72075.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KEH43536.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AAL69396.1| elongation factor 1-alpha [Elaeis oleifera]
Length=447

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_003604823.1| Elongation factor 1-alpha [Medicago truncatula]
Length=448

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_002279598.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN66350.1| hypothetical protein VITISV_044270 [Vitis vinifera]
Length=447

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|WP_041515120.1| elongation factor 1-alpha, partial [Nitrosospira sp. NpAV]
 gb|KIO47757.1| elongation factor 1-alpha, partial [Nitrosospira sp. NpAV]
Length=77

 Score = 98.6 bits (244),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/51 (96%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERF KEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFGKEAAEMNK  51



>gb|AFW87115.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW87116.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW87117.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
 gb|AFW87118.1| putative translation elongation factor Tu family protein isoform 
4 [Zea mays]
 gb|AFW87119.1| putative translation elongation factor Tu family protein isoform 
5 [Zea mays]
Length=255

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AES59072.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=465

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008465824.1| PREDICTED: elongation factor 1-alpha-like [Cucumis melo]
Length=273

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_003588821.1| Elongation factor 1-alpha [Medicago truncatula]
Length=458

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CDY67375.1| BnaC03g71520D [Brassica napus]
Length=278

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_007027265.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY07767.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=566

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AES74993.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH25376.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>dbj|BAC22125.1| eukaryotic elongation factor 1A [Bruguiera sexangula]
Length=449

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_007218005.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
 gb|EMJ19204.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
Length=447

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|EYU18869.1| hypothetical protein MIMGU_mgv1a010191mg [Erythranthe guttata]
 gb|EYU18870.1| hypothetical protein MIMGU_mgv1a010191mg [Erythranthe guttata]
Length=319

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_004143833.1| PREDICTED: uncharacterized protein LOC101220517 [Cucumis sativus]
Length=933

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 60/72 (83%), Gaps = 3/72 (4%)
 Frame = +2

Query  5    LSDSLSFRYSPGFAK*NR---MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVI  175
            LS + S +++P   +  R   MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVI
Sbjct  464  LSPAPSHQWTPDVYEGVRYSSMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVI  523

Query  176  ERFEKEAAEMNK  211
            ERFEKEAAEMNK
Sbjct  524  ERFEKEAAEMNK  535


 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHIN+VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008233357.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
Length=447

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABR13300.1| putative elongation factor eEF1-alpha chain A4 [Prunus dulcis]
Length=58

 Score = 97.4 bits (241),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/51 (96%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIE FEKEAAEMNK
Sbjct  4    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIEGFEKEAAEMNK  54



>gb|ABF94275.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=347

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AFO67216.1| putative elongation factor 1-alpha, partial [Aralia elata]
Length=287

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|EMS65134.1| Elongation factor 1-alpha [Triticum urartu]
Length=639

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 56/69 (81%), Gaps = 6/69 (9%)
 Frame = +2

Query  5    LSDSLSFRYSPGFAK*NRMGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERF  184
            + D + + Y P       MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERF
Sbjct  181  IRDWVVYVYPPA------MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERF  234

Query  185  EKEAAEMNK  211
            EKEAAEMNK
Sbjct  235  EKEAAEMNK  243



>gb|KHG15275.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=431

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_003591959.1| Elongation factor 1-alpha [Medicago truncatula]
Length=566

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/51 (100%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|NP_001077483.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 gb|AEE28214.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=372

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_004138964.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
 ref|XP_004162426.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=447

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CDY61938.1| BnaCnng38780D [Brassica napus]
 emb|CDY34479.1| BnaC04g13200D [Brassica napus]
 emb|CDY10804.1| BnaA05g11320D [Brassica napus]
 emb|CDY09211.1| BnaA02g06370D [Brassica napus]
Length=428

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_011004182.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011010862.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008349743.1| PREDICTED: elongation factor 1-alpha isoform X2 [Malus domestica]
Length=397

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABR17675.1| unknown [Picea sitchensis]
Length=448

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CDY22710.1| BnaC08g43440D [Brassica napus]
 emb|CDY22711.1| BnaC08g43450D [Brassica napus]
Length=427

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKAHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ACN41180.1| unknown [Picea sitchensis]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CDX88757.1| BnaA03g08920D [Brassica napus]
Length=401

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AIZ74328.1| translation elongation factor 1-alpha [Pinus massoniana]
Length=448

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ACN40740.1| unknown [Picea sitchensis]
 gb|ACN41072.1| unknown [Picea sitchensis]
Length=448

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABK25072.1| unknown [Picea sitchensis]
 gb|ABR17295.1| unknown [Picea sitchensis]
 gb|ABR17358.1| unknown [Picea sitchensis]
 gb|ABR18377.1| unknown [Picea sitchensis]
 gb|ACN40111.1| unknown [Picea sitchensis]
 gb|ACN40613.1| unknown [Picea sitchensis]
 gb|ACN40633.1| unknown [Picea sitchensis]
 gb|ACN40825.1| unknown [Picea sitchensis]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AFQ37422.1| translation elongation factor-1 alpha 1 [Larix kaempferi]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABK24265.1| unknown [Picea sitchensis]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CDX93604.1| BnaA06g04440D [Brassica napus]
Length=460

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  33   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  83



>ref|XP_004149547.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ABK24843.1| unknown [Picea sitchensis]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|NP_001032107.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97319.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
Length=400

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KCW51623.1| hypothetical protein EUGRSUZ_J01112 [Eucalyptus grandis]
Length=330

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_002315287.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 ref|XP_002315285.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 ref|XP_002316351.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|ABK95341.1| unknown [Populus trichocarpa]
 gb|ABK95876.1| unknown [Populus trichocarpa]
 gb|EEF01458.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|EEF01456.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 gb|EEF02522.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
Length=449

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ACN40081.1| unknown [Picea sitchensis]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008224492.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AFQ37423.1| translation elongation factor-1 alpha 2 [Larix kaempferi]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_003558459.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003577316.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003581689.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228997.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228998.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009342345.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008385284.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_009338279.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_010456376.1| PREDICTED: elongation factor 1-alpha 1 isoform X7 [Camelina sativa]
Length=400

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_004307410.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>sp|Q03033.1|EF1A_WHEAT RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Triticum 
aestivum]
 gb|AAA34306.1| translation elongation factor 1 alpha-subunit [Triticum aestivum]
 emb|CAA90651.1| elongation factor 1-alpha [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85443.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87634.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT04563.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT21642.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT30905.1| Elongation factor 1-alpha [Aegilops tauschii]
Length=447

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|EMS52529.1| Elongation factor 1-alpha [Triticum urartu]
 gb|EMS55225.1| Elongation factor 1-alpha [Triticum urartu]
Length=447

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_004163381.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-alpha-like 
[Cucumis sativus]
Length=449

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_011031786.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=340

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AFW90638.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=309

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/51 (96%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AAL32631.1| putative elongation factor 1-a [Arabidopsis thaliana]
 gb|AAM47970.1| putative elongation factor 1-a [Arabidopsis thaliana]
Length=449

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008380544.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
Length=447

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|EYU18863.1| hypothetical protein MIMGU_mgv1a006280mg [Erythranthe guttata]
 gb|EYU18864.1| hypothetical protein MIMGU_mgv1a006280mg [Erythranthe guttata]
 gb|EYU18866.1| hypothetical protein MIMGU_mgv11b005172mg [Erythranthe guttata]
 gb|EYU18867.1| hypothetical protein MIMGU_mgv1a006307mg [Erythranthe guttata]
Length=449

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009131916.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>gb|AIX10769.1| elongation factor 1 alpha [Panax notoginseng]
Length=449

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_009421379.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_002488881.1| hypothetical protein SORBIDRAFT_2635s002010 [Sorghum bicolor]
 gb|EES20441.1| hypothetical protein SORBIDRAFT_2635s002010 [Sorghum bicolor]
Length=125

 Score = 98.2 bits (243),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEK HI+IVVIGHVDSGK TTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKTHISIVVIGHVDSGKLTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  211
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNK  51



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556171087500