BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF007A13

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011090791.1|  PREDICTED: basic 7S globulin                     58.5    6e-08   Sesamum indicum [beniseed]
ref|XP_009611838.1|  PREDICTED: basic 7S globulin-like                54.3    2e-06   Nicotiana tomentosiformis
ref|XP_006339396.1|  PREDICTED: basic 7S globulin-like                53.1    4e-06   Solanum tuberosum [potatoes]
ref|XP_004229435.1|  PREDICTED: basic 7S globulin-like                49.3    9e-05   Solanum lycopersicum
ref|XP_002520766.1|  conserved hypothetical protein                   47.0    5e-04   
ref|XP_010546839.1|  PREDICTED: basic 7S globulin                     47.4    5e-04   Tarenaya hassleriana [spider flower]
emb|CDO98999.1|  unnamed protein product                              46.6    0.001   Coffea canephora [robusta coffee]



>ref|XP_011090791.1| PREDICTED: basic 7S globulin [Sesamum indicum]
Length=417

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  135  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVD  263
            S++Q P  P+A +IPV+KDF T QYVA + +G NLAP+KLVVD
Sbjct  20   SVSQNPILPKAGIIPVTKDFSTLQYVADVLVGENLAPVKLVVD  62



>ref|XP_009611838.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=420

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  135  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVD  263
            S++  PF P+AI++PV+KD  T QYV Q+ MG +L P  LVVD
Sbjct  21   SVSHGPFLPKAIILPVNKDLSTFQYVTQVYMGAHLVPTNLVVD  63



>ref|XP_006339396.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=416

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYN-LAPLKLVVD  263
            S++  PF P+AI++PV+KD  T QYV QL MG N LAP+KLVV+
Sbjct  20   SVSHGPFLPKAIILPVNKDPSTFQYVTQLYMGANHLAPIKLVVN  63



>ref|XP_004229435.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=417

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +3

Query  138  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMG-YNLAPLKLVVD  263
            ++  PF P+AI++PV+KD  T QYV QL MG  + AP+KLVVD
Sbjct  21   VSHGPFLPKAIILPVNKDPSTFQYVTQLYMGATHRAPIKLVVD  63



>ref|XP_002520766.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41728.1| conserved hypothetical protein [Ricinus communis]
Length=273

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  135  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVV  260
            S+AQ+ F PRA+V+PVSKD  T QYV Q++    L P+ LVV
Sbjct  21   SIAQQSFRPRALVVPVSKDASTLQYVTQVEQRTPLVPINLVV  62



>ref|XP_010546839.1| PREDICTED: basic 7S globulin [Tarenaya hassleriana]
Length=382

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  165  AIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVD  263
            A+V PVS+D PT QYVAQ+++G +  P+KLVVD
Sbjct  25   AVVFPVSRDLPTGQYVAQIRLGESPEPVKLVVD  57



>emb|CDO98999.1| unnamed protein product [Coffea canephora]
Length=440

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = +3

Query  126  ATISLAQR-PFFPRAIVIPVSKDFPTSQYVAQLQMGYN-LAPLKLVVD  263
             T+++A+  PF P ++++PV+KD  T QYV Q  +G   LAP KLV+D
Sbjct  33   CTVTIAKEGPFLPNSVILPVTKDIATHQYVTQTYVGDQPLAPTKLVID  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567410881500