BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF006P15

Length=207
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004917040.1|  PREDICTED: histone H3.2-like isoform X2            103   9e-26   
ref|XP_003621457.1|  Histone H3                                         103   2e-25   
ref|XP_007971598.1|  PREDICTED: histone H3.1-like                       102   4e-25   Chlorocebus sabaeus
ref|XP_008461433.1|  PREDICTED: histone H3.v1-like                      103   7e-25   Cucumis melo [Oriental melon]
ref|XP_010424704.1|  PREDICTED: histone H3-like centromeric prote...    103   9e-25   
ref|XP_001177217.2|  PREDICTED: histone H3, embryonic-like              100   1e-24   
ref|XP_007483400.1|  PREDICTED: histone H3.2-like                       101   1e-24   
ref|XP_006401653.1|  hypothetical protein EUTSA_v10014731mg             101   1e-24   
ref|XP_010708157.1|  PREDICTED: histone H3-like                         100   1e-24   
ref|XP_007014942.1|  Histone superfamily protein                        100   2e-24   
ref|XP_007013423.1|  Histone superfamily protein                        101   2e-24   
gb|KEH16402.1|  histone H3.2                                          99.4    2e-24   Medicago truncatula
ref|XP_003788936.1|  PREDICTED: histone H3.1-like                       100   3e-24   
ref|XP_008663191.1|  PREDICTED: histone H3.2-like                     99.8    3e-24   
gb|KJB67030.1|  hypothetical protein B456_010G171000                    100   3e-24   Gossypium raimondii
gb|KJB27089.1|  hypothetical protein B456_004G277300                    100   3e-24   Gossypium raimondii
ref|WP_039311803.1|  hypothetical protein                             97.4    4e-24   
ref|XP_004562913.1|  PREDICTED: histone H3-like centromeric prote...    101   4e-24   
ref|XP_003594840.1|  Histone H3                                       97.4    4e-24   
ref|XP_003430322.2|  PREDICTED: uncharacterized protein LOC100093342    102   4e-24   
gb|AAB48833.1|  cleavage stage histone H3                             97.8    4e-24   Psammechinus miliaris [sand sea urchin]
ref|XP_008669428.1|  PREDICTED: histone H3.2-like                       100   4e-24   
gb|KCW51227.1|  hypothetical protein EUGRSUZ_J00806                   99.0    4e-24   Eucalyptus grandis [rose gum]
ref|XP_004384835.1|  PREDICTED: histone H3.1t-like isoform 1          98.6    5e-24   
ref|XP_006368568.1|  hypothetical protein POPTR_0001s05450g             100   5e-24   
ref|XP_005337122.1|  PREDICTED: histone H3.2-like                     98.2    5e-24   
ref|XP_005519548.1|  PREDICTED: histone H3.2-like isoform X1          98.2    5e-24   
gb|EPS65708.1|  hypothetical protein M569_09069                       97.1    5e-24   Genlisea aurea
ref|NP_001183546.1|  uncharacterized LOC100502113                     98.2    6e-24   Zea mays [maize]
ref|XP_009609114.1|  PREDICTED: histone H3.2-like                     96.7    6e-24   Nicotiana tomentosiformis
ref|XP_006366506.1|  PREDICTED: histone H3.2-like isoform X2          97.8    6e-24   
ref|XP_009601229.1|  PREDICTED: histone H3.2-like                     98.2    6e-24   Nicotiana tomentosiformis
gb|ADF58427.1|  histone H3                                            98.2    6e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_005461835.1|  PREDICTED: histone H3.2-like isoform X2            100   6e-24   
ref|XP_006366514.1|  PREDICTED: histone H3.2-like                     96.7    6e-24   
ref|XP_004139024.1|  PREDICTED: histone H3.2-like                     97.8    6e-24   
emb|CBY08974.1|  unnamed protein product                              97.8    6e-24   Oikopleura dioica
ref|XP_003082036.1|  Histones H3 and H4 (ISS)                         98.6    7e-24   
ref|XP_001862683.1|  histone H3.1t                                    98.2    7e-24   Culex quinquefasciatus
gb|EFZ22370.1|  hypothetical protein SINV_16114                       98.2    7e-24   
gb|KGN66469.1|  hypothetical protein Csa_1G612925                     99.0    7e-24   Cucumis sativus [cucumbers]
gb|ABX71451.2|  histone H3                                            97.1    7e-24   Sierraperla cora
ref|XP_001847697.1|  Histone H3c                                      97.4    7e-24   Culex quinquefasciatus
ref|XP_006125985.1|  PREDICTED: uncharacterized protein LOC102454723    101   7e-24   
emb|CBH32561.1|  histone H3, expressed                                97.8    7e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006301260.1|  hypothetical protein CARUB_v10021660mg           98.6    7e-24   
ref|XP_003416447.2|  PREDICTED: uncharacterized protein LOC100664283    102   7e-24   
ref|XP_003979134.1|  PREDICTED: histone H3.2-like                     97.1    7e-24   
sp|Q402E1.3|H32_LILLO  RecName: Full=Histone H3.2                     97.8    7e-24   Lilium longiflorum [Easter lily]
gb|AAA32655.1|  histone H3 (H3-1.1)                                   97.8    7e-24   Medicago sativa [alfalfa]
gb|AFK39648.1|  unknown                                               97.8    7e-24   Medicago truncatula
gb|ACN40064.1|  unknown                                               97.8    8e-24   Picea sitchensis
ref|NP_001238509.1|  uncharacterized protein LOC100306416             97.8    8e-24   Glycine max [soybeans]
ref|XP_008218130.1|  PREDICTED: histone H3.1-like                     97.8    8e-24   Nasonia vitripennis
gb|ABR67482.1|  histone H3                                            97.1    8e-24   Eomantis guttatipennis
gb|AIF33209.1|  histone H3                                            97.1    8e-24   Myctophum phengodes
ref|XP_002739194.1|  PREDICTED: histone H3-like                       97.1    8e-24   Saccoglossus kowalevskii
gb|AAV65112.1|  histone 3                                             97.8    8e-24   Camellia sinensis [black tea]
gb|AAW65278.1|  histone 3                                             96.7    8e-24   Platythelphusa armata
ref|XP_004934091.1|  PREDICTED: histone H3-like                       97.1    8e-24   Bombyx mori [silk moth]
gb|EMT07308.1|  Histone H3.2                                          97.8    8e-24   
ref|NP_189372.1|  histone H3                                          97.8    8e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ADH95969.1|  histone 3                                             97.1    8e-24   Callobius severus
ref|XP_011086031.1|  PREDICTED: histone H3.2-like                     97.8    8e-24   Sesamum indicum [beniseed]
emb|CDP18134.1|  unnamed protein product                              97.8    8e-24   Coffea canephora [robusta coffee]
gb|KDP29737.1|  hypothetical protein JCGZ_18672                       97.8    8e-24   Jatropha curcas
ref|XP_004229367.1|  PREDICTED: histone H3.2-like                     97.8    8e-24   Solanum lycopersicum
gb|AIF33241.1|  histone H3                                            97.1    8e-24   Solivomer arenidens
gb|KHN31394.1|  Histone H3.3                                          99.0    8e-24   Glycine soja [wild soybean]
ref|XP_001967894.1|  GF21629                                          97.1    8e-24   
gb|ADH95968.1|  histone 3                                             97.1    8e-24   Callobius paynei
ref|XP_004252600.1|  PREDICTED: histone H3.2-like                     97.8    8e-24   Solanum lycopersicum
gb|AHZ58439.1|  histone H3                                            97.1    8e-24   Amphiporus lactifloreus
ref|XP_003738531.1|  PREDICTED: histone H3-like                       97.1    8e-24   
ref|XP_007972115.1|  PREDICTED: uncharacterized protein LOC103222373    102   9e-24   Chlorocebus sabaeus
ref|XP_009794208.1|  PREDICTED: histone H3                            96.7    9e-24   Nicotiana sylvestris
sp|P08903.2|H32_ENCAL  RecName: Full=Histone H3.2                     97.8    9e-24   Encephalartos altensteinii
gb|ABX71432.1|  histone H3                                            96.7    9e-24   Cosumnoperla hypocrena
ref|XP_005150558.1|  PREDICTED: histone H3, embryonic-like            95.9    9e-24   
ref|XP_010260926.1|  PREDICTED: histone H3.2-like                     97.8    9e-24   Nelumbo nucifera [Indian lotus]
ref|XP_009598129.1|  PREDICTED: histone H3.2-like                     97.8    9e-24   Nicotiana tomentosiformis
gb|ACG80497.1|  histone 3                                             97.1    9e-24   Austrophlebioides sp. BCOD-2008
gb|ABR67496.1|  histone H3                                            96.7    9e-24   Gildella suavis
gb|ABM53736.1|  histone 3                                             96.7    9e-24   Pseudocreobotra wahlbergii [spiny flower praying mantis]
gb|ACG80495.1|  histone 3                                             96.7    9e-24   Atalophlebia sp. BCOD-2008
gb|ABN80281.1|  histone H3                                            96.7    9e-24   Holcolaetis vellerea
gb|ACG80515.1|  histone 3                                             96.7    9e-24   Leptophlebia intermedia
gb|EFB20850.1|  hypothetical protein PANDA_018542                     97.8    9e-24   Ailuropoda melanoleuca
ref|XP_008560363.1|  PREDICTED: histone H3.2-like                     95.9    9e-24   
gb|ACG30943.1|  histone H3                                            98.6    9e-24   Zea mays [maize]
gb|AEK26353.1|  histone H3                                            96.7    9e-24   Decatopecten plica
ref|XP_006652279.1|  PREDICTED: histone H3.2-like                     97.4    9e-24   
gb|ACG80500.1|  histone 3                                             96.7    9e-24   Isothraulus abditus
gb|AAW65297.1|  histone 3                                             96.7    9e-24   Potamonautes rayboldi
gb|AAW65288.1|  histone 3                                             96.7    9e-24   Potamonautes lividus
gb|ABZ89657.1|  histone H3                                            96.7    9e-24   Pomacea canaliculata
gb|EEE63859.1|  hypothetical protein OsJ_18683                        97.1    1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001853968.1|  histone H3.2                                     97.4    1e-23   Culex quinquefasciatus
ref|XP_001745925.1|  hypothetical protein                             97.4    1e-23   Monosiga brevicollis MX1
ref|XP_009782179.1|  PREDICTED: histone H3.2-like                     97.4    1e-23   Nicotiana sylvestris
gb|AAW65312.1|  histone 3                                             96.7    1e-23   Malagasya goodmani
gb|AAA33907.1|  histone 3                                             97.4    1e-23   Oryza sativa [red rice]
ref|XP_010547605.1|  PREDICTED: histone H3.2-like                     97.4    1e-23   Tarenaya hassleriana [spider flower]
gb|AIF33173.1|  histone H3                                            96.7    1e-23   Lampadena speculigera
gb|ABN80288.1|  histone H3                                            96.7    1e-23   Oxyopes birmanicus
gb|AAW48016.1|  histone 3                                             96.7    1e-23   Irdex sp. 1 DM55
gb|AIF33081.1|  histone H3                                            96.7    1e-23   Benthosema glaciale [glacier lanternfish]
gb|AIF33151.1|  histone H3                                            96.7    1e-23   Electrona antarctica
gb|AIN56052.1|  histone H3                                            97.1    1e-23   Paragoniastrea deformis
gb|ABR67494.1|  histone H3                                            97.1    1e-23   Tropidomantis sp. MN096
ref|XP_001862674.1|  histone H3 type 2                                97.8    1e-23   Culex quinquefasciatus
gb|AIS22439.1|  histone H3                                            96.7    1e-23   Halocynthia pyriformis
ref|XP_009629722.1|  PREDICTED: histone H3.2-like                     98.2    1e-23   Nicotiana tomentosiformis
gb|AFK35319.1|  unknown                                               95.9    1e-23   Medicago truncatula
gb|ACG80523.1|  histone 3                                             96.7    1e-23   Paraleptophlebia vaciva
ref|XP_007177425.1|  PREDICTED: histone H3.1-like isoform X1          97.8    1e-23   Balaenoptera acutorostrata scammoni
ref|XP_004432230.1|  PREDICTED: uncharacterized protein LOC101398437    100   1e-23   
gb|ABV02068.1|  histone H3                                            96.7    1e-23   Dunaliella salina
gb|ABR67505.1|  histone H3                                            96.7    1e-23   Acanthops sp. MN112
ref|XP_009017710.1|  hypothetical protein HELRODRAFT_79262            96.7    1e-23   Helobdella robusta
ref|XP_002928569.2|  PREDICTED: histone H3.1-like                     98.2    1e-23   
gb|ADV77204.1|  histone H3                                            97.1    1e-23   Ignatius tetrasporus
ref|XP_010830602.1|  PREDICTED: histone H3.1                          99.8    1e-23   Bison bison bison
gb|ADH95984.1|  histone 3                                             96.7    1e-23   Callobius bennetti
gb|ADZ49070.1|  histone H3                                            96.7    1e-23   Ulvella repens
ref|XP_003630193.1|  Histone H3                                       99.0    1e-23   
gb|AIN56048.1|  histone H3                                            96.7    1e-23   Paragoniastrea australensis
gb|AAW48017.1|  histone 3                                             97.1    1e-23   Irdex sp. 2 DM56
ref|XP_008585856.1|  PREDICTED: histone H3.1-like                     96.7    1e-23   Galeopterus variegatus [Malayan flying lemur]
gb|AGT20422.1|  histone H3                                            96.7    1e-23   Conothele sp. MY2070
gb|ABR67490.1|  histone H3                                            96.7    1e-23   Thrinaconyx fumosus
gb|ACD37543.1|  histone H3                                            97.1    1e-23   Adineta vaga
gb|AGM53633.1|  histone H3                                            96.7    1e-23   Orcula dolium
gb|AGM53552.1|  histone H3                                            96.7    1e-23   Orcula dolium
gb|ABR67500.1|  histone H3                                            96.7    1e-23   Amorphoscelis borneana
gb|ACG80534.1|  histone 3                                             95.9    1e-23   Euthraulus elegans
gb|AIF33248.1|  histone H3                                            97.1    1e-23   Taaningichthys bathyphilus
gb|AIM45540.1|  histone H3                                            97.1    1e-23   Botryllus schlosseri
gb|AHZ58409.1|  histone H3                                            95.9    1e-23   Alitta virens
gb|ACG80532.1|  histone 3                                             96.7    1e-23   Neochoroterpes nanita
gb|AAY98294.1|  histone H3                                            96.7    1e-23   Attenella margarita
ref|XP_005063136.1|  PREDICTED: histone H3, embryonic-like            95.1    1e-23   
gb|AGM53512.1|  histone H3                                            96.7    1e-23   Orcula dolium
ref|XP_002045548.1|  GM18817                                          95.5    1e-23   Drosophila sechellia
gb|AIF33126.1|  histone H3                                            96.7    1e-23   Diaphus perspicillatus
ref|XP_002731485.1|  PREDICTED: histone H3-like                       96.7    1e-23   Saccoglossus kowalevskii
gb|AAX92952.1|  histone H3 - maize                                    97.8    1e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AAY98302.1|  histone H3                                            96.7    1e-23   Stygifloris sp. EP141
gb|ABX71430.1|  histone H3                                            96.7    1e-23   Isogenoides olivaceus
gb|ABR67468.1|  histone H3                                            96.7    1e-23   Oligonicella scudderi
gb|AHZ58402.1|  histone H3                                            96.7    1e-23   Acanthonotozoma inflatum
gb|ABX71359.1|  histone H3                                            97.1    1e-23   Crypturoperla paradoxa
ref|XP_002733098.1|  PREDICTED: histone H3-like                       96.7    1e-23   Saccoglossus kowalevskii
gb|KFW88175.1|  Histone H3                                            96.7    1e-23   Manacus vitellinus
gb|AHV90958.1|  histone H3                                            96.7    1e-23   Folsomia quadrioculata
gb|ADV77191.1|  histone H3                                            96.7    1e-23   Bolbocoleon piliferum
gb|AIN56127.1|  histone H3                                            96.7    1e-23   Merulina scabricula
gb|ADX77799.1|  histone H3                                            96.7    1e-23   Favia favus
gb|KIY70680.1|  histone 3                                             97.1    1e-23   Cylindrobasidium torrendii FP15055 ss-10
emb|CBY05454.1|  histone 3                                            96.7    1e-23   Antiporus hollingsworthi
gb|AHZ58404.1|  histone H3                                            96.7    1e-23   Aglantha digitale
gb|ADV77215.1|  histone H3                                            96.7    1e-23   Ulva intestinalis
gb|ACD37575.1|  histone H3                                            97.1    1e-23   Philodina roseola
ref|XP_008930489.1|  PREDICTED: histone H3                            96.7    1e-23   
gb|ABR67515.1|  histone H3                                            96.7    1e-23   Coptopteryx sp. MN136
gb|AIF33194.1|  histone H3                                            96.7    1e-23   Lepidophanes guentheri
gb|AIF33080.1|  histone H3                                            96.7    1e-23   Benthosema fibulatum
gb|AAW48003.1|  histone 3                                             96.7    1e-23   Thekalabis sp. DM16
gb|AHM91952.1|  histone H3                                            96.7    1e-23   Eusparassus cf. doriae SD810
gb|AAB49451.1|  histone H3                                            95.9    1e-23   Drosophila virilis
gb|AHZ58427.1|  histone H3                                            96.7    1e-23   Asterias rubens
gb|AHE81414.1|  histone H3                                            96.7    1e-23   Dyopedos bispinis
ref|XP_009017680.1|  hypothetical protein HELRODRAFT_79413            97.1    1e-23   Helobdella robusta
gb|AHC04275.1|  histone H3                                            96.7    1e-23   Folsomia quadrioculata
gb|ADX77778.1|  histone H3                                            96.7    1e-23   Caulastraea furcata
gb|AGT20435.1|  histone H3                                            97.1    1e-23   Ummidia sp. MY2716
ref|XP_009053417.1|  hypothetical protein LOTGIDRAFT_147385           96.7    1e-23   Lottia gigantea
ref|XP_008669425.1|  PREDICTED: histone H3.2-like                     97.8    1e-23   Zea mays [maize]
gb|AIF33143.1|  histone H3                                            96.7    1e-23   Diaphus thiollierei
gb|ABX71374.1|  histone H3                                            96.7    1e-23   Sasquaperla hoopa
ref|XP_008558783.1|  PREDICTED: histone H3, embryonic-like            95.1    1e-23   
gb|ABX71412.1|  histone H3                                            96.7    1e-23   Austronemoura sp. BYU_PL149
ref|XP_008484412.1|  PREDICTED: histone H3                            95.9    1e-23   
gb|AIF33249.1|  histone H3                                            96.7    1e-23   Taaningichthys minimus
ref|XP_010158279.1|  PREDICTED: histone H3                            96.7    1e-23   Eurypyga helias
gb|ADH95980.1|  histone 3                                             96.7    1e-23   Callobius sp. Josephine Co population
gb|KHJ86469.1|  core histone H2A/H2B/H3/H4                            96.7    1e-23   Oesophagostomum dentatum [nodule worm]
gb|AIF33098.1|  histone H3                                            96.7    1e-23   Ceratoscopelus townsendi
gb|ABR67508.1|  histone H3                                            96.7    1e-23   Angela sp. MN120
gb|ABR67516.1|  histone H3                                            96.7    1e-23   Musoniella sp. MN137
gb|AAW48001.1|  histone 3                                             96.7    1e-23   Chelisoches annulatus
ref|XP_004670965.1|  PREDICTED: histone H3, embryonic-like            95.1    1e-23   
gb|ACG80487.1|  histone 3                                             96.7    1e-23   Radima sp. 1 BCOD-2008
ref|XP_003980057.1|  PREDICTED: histone H3.1-like                     95.5    1e-23   
gb|AHZ58432.1|  histone H3                                            97.1    1e-23   Boreotrophon clathratus
ref|XP_009301170.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    100   1e-23   
ref|XP_004349092.1|  histone                                          97.1    1e-23   Capsaspora owczarzaki ATCC 30864
ref|XP_002155115.2|  PREDICTED: histone H3.1-like                     96.3    1e-23   
ref|XP_009951278.1|  PREDICTED: histone H3                            96.7    1e-23   Leptosomus discolor
ref|XP_003494930.1|  PREDICTED: histone H3-like                       96.7    1e-23   
ref|XP_009892706.1|  PREDICTED: uncharacterized protein LOC104294757    100   1e-23   Charadrius vociferus
gb|ABZ89650.1|  histone H3                                            95.5    2e-23   Lanistes sp. 1 AJ-2008
gb|ERZ94804.1|  hypothetical protein GLOINDRAFT_341556                97.1    2e-23   
ref|XP_004977985.1|  PREDICTED: histone H3-like centromeric prote...    100   2e-23   
gb|ABR67504.1|  histone H3                                            96.7    2e-23   Acontista sp. MN111
gb|ABR67479.1|  histone H3                                            96.7    2e-23   Hapalopeza nilgirica
gb|AIT12989.1|  histone H3                                            96.3    2e-23   Orcula restituta
gb|AHZ58420.1|  histone H3                                            97.1    2e-23   Amphitrite figulus
ref|XP_001862705.1|  histone H3.2                                     97.4    2e-23   Culex quinquefasciatus
gb|AIY68794.1|  histone 3                                             96.7    2e-23   Ostrea circumpicta
gb|ABX71413.1|  histone H3                                            95.5    2e-23   Udamocercia sp. BYU_PL150
gb|AJD38722.1|  histone H3                                            96.7    2e-23   Ophryotrocha cyclops
gb|ADH95979.1|  histone 3                                             96.7    2e-23   Callobius sp. x101
gb|AIF33199.1|  histone H3                                            96.7    2e-23   Metelectrona ventralis
gb|AGM53617.1|  histone H3                                            96.3    2e-23   Orcula dolium
gb|AIY68793.1|  histone 3                                             96.7    2e-23   Ostrea circumpicta
ref|XP_008313557.1|  PREDICTED: histone H3-like                       97.1    2e-23   Cynoglossus semilaevis [half-smooth tongue sole]
gb|AFI61665.1|  histone 3                                             97.1    2e-23   Ruditapes philippinarum [Japanese littleneck]
gb|AEK26349.1|  histone H3                                            96.7    2e-23   Delectopecten vancouverensis
gb|ABR67467.1|  histone H3                                            96.7    2e-23   Cliomantis obscura
gb|AHZ58403.1|  histone H3                                            96.7    2e-23   Acanthonotozoma inflatum
gb|ABX71391.1|  histone H3                                            96.7    2e-23   Moselia infuscata
gb|AEK26336.1|  histone H3                                            96.7    2e-23   Laevichlamys cuneata
gb|AIN56055.1|  histone H3                                            96.7    2e-23   Paragoniastrea deformis
gb|KDD73857.1|  hypothetical protein H632_c1781p0                     95.5    2e-23   Helicosporidium sp. ATCC 50920
gb|AHZ58414.1|  histone H3                                            96.7    2e-23   Ectopleura larynx
gb|EFB20847.1|  hypothetical protein PANDA_018538                     97.1    2e-23   Ailuropoda melanoleuca
gb|AHZ58425.1|  histone H3                                            96.7    2e-23   Arctica islandica
ref|XP_008558785.1|  PREDICTED: histone H3-like                       96.7    2e-23   
ref|XP_011397775.1|  Histone H3.1                                     97.1    2e-23   Auxenochlorella protothecoides
gb|AHZ58423.1|  histone H3                                            96.7    2e-23   Arctica islandica
gb|KFZ56463.1|  Histone H3                                            96.7    2e-23   Podiceps cristatus
ref|XP_010796966.1|  PREDICTED: histone H3.1-like                     95.9    2e-23   
gb|ABM53708.1|  histone 3                                             96.7    2e-23   Latiblattella sp. 3 DJGI-2006
gb|ABX71390.1|  histone H3                                            95.5    2e-23   Megaleuctra kincaidi
ref|XP_005643646.1|  histone H3                                       97.1    2e-23   Coccomyxa subellipsoidea C-169
gb|AAP94664.1|  histone H3                                            97.1    2e-23   Mytilus californianus
gb|AEK26338.1|  histone H3                                            96.7    2e-23   Veprichlamys jousseaumei
ref|XP_010668604.1|  PREDICTED: histone H3-like isoform X2            97.1    2e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|AET97543.1|  histone 3                                             96.7    2e-23   Panopeus herbstii
gb|ELK02686.1|  Histone H3                                            95.5    2e-23   Pteropus alecto
gb|AAI29394.1|  Zgc:158701 protein                                    95.1    2e-23   Danio rerio [leopard danio]
gb|AIF33097.1|  histone H3                                            96.7    2e-23   Ceratoscopelus maderensis
gb|ACP74198.1|  histone H3                                            96.7    2e-23   Campeloma floridense
gb|KFM02264.1|  Histone H3                                            95.5    2e-23   Aptenodytes forsteri
ref|XP_001620157.1|  hypothetical protein NEMVEDRAFT_v1g148952        97.1    2e-23   Nematostella vectensis
gb|AAW48000.1|  histone 3                                             96.7    2e-23   Opisthocosmia tenuis
gb|ADX77863.1|  histone H3                                            96.7    2e-23   Phymastrea multipunctata
gb|ABR67478.1|  histone H3                                            96.7    2e-23   Humbertiella similis
gb|AHZ58405.1|  histone H3                                            96.3    2e-23   Aglantha digitale
ref|XP_005527779.1|  PREDICTED: histone H3.2-like isoform X1          97.1    2e-23   
gb|ABM53670.1|  histone 3                                             96.7    2e-23   Aeluropoda insignis
ref|XP_002586362.1|  hypothetical protein BRAFLDRAFT_108838           97.1    2e-23   Branchiostoma floridae
ref|XP_002045096.1|  GM19740                                          97.1    2e-23   Drosophila sechellia
ref|XP_004576419.1|  PREDICTED: histone H3.2-like                     97.1    2e-23   
gb|AFI61667.1|  histone 3                                             97.1    2e-23   Ruditapes philippinarum [Japanese littleneck]
pdb|3LEL|A  Chain A, Structural Insight Into The Sequence-Depende...  97.1    2e-23   Xenopus laevis [clawed frog]
ref|XP_006162733.1|  PREDICTED: histone H3.1-like                     97.4    2e-23   Tupaia chinensis
ref|XP_001967747.1|  GF18982                                          97.1    2e-23   Drosophila ananassae
gb|AFI61675.1|  histone 3                                             97.1    2e-23   Ruditapes variegatus
gb|ADH96025.1|  histone 3                                             96.7    2e-23   Callobius guachama
ref|XP_002075944.1|  GK12402                                          97.1    2e-23   Drosophila willistoni
sp|Q9HDN1.3|H3_MORAP  RecName: Full=Histone H3                        97.1    2e-23   Mortierella alpina
gb|ABX71420.1|  histone H3                                            96.7    2e-23   Chernokrilus misnomus
gb|ADX77860.1|  histone H3                                            96.7    2e-23   Astrea curta
gb|ADV77202.1|  histone H3                                            96.7    2e-23   Halimeda cuneata
ref|XP_006752198.1|  PREDICTED: histone H3, embryonic-like            95.1    2e-23   Leptonychotes weddellii
gb|KJB71213.1|  hypothetical protein B456_011G110600                  97.8    2e-23   Gossypium raimondii
ref|XP_004778825.1|  PREDICTED: histone H3-like                       96.7    2e-23   
ref|NP_999712.1|  histone H3, embryonic                               96.7    2e-23   Strongylocentrotus purpuratus [purple urchin]
gb|AEW46685.1|  histone type 2                                        96.7    2e-23   Ulva linza
ref|XP_004787914.1|  PREDICTED: histone H3.1-like                     96.7    2e-23   
emb|CBY05452.1|  histone 3                                            96.7    2e-23   Antiporus gilbertii
ref|XP_003769946.1|  PREDICTED: histone H3.2-like                     98.2    2e-23   
ref|XP_003505638.2|  PREDICTED: uncharacterized protein LOC100759437    100   2e-23   Cricetulus griseus [Chinese hamsters]
gb|AGB34244.1|  histone H3                                            95.5    2e-23   Macromia illinoiensis
ref|XP_009017720.1|  hypothetical protein HELRODRAFT_79110            95.1    2e-23   Helobdella robusta
ref|XP_011496732.1|  PREDICTED: histone H3-like                       96.7    2e-23   Ceratosolen solmsi marchali
gb|ABB85267.1|  histone 3                                             96.7    2e-23   Acilius sylvanus
gb|AHZ58406.1|  histone H3                                            96.3    2e-23   
ref|XP_001657153.1|  AAEL003685-PA                                    96.7    2e-23   
gb|ADH95978.1|  histone 3                                             96.7    2e-23   
ref|XP_007620855.1|  PREDICTED: uncharacterized protein LOC100759437    100   2e-23   
gb|AAP94665.1|  histone H3                                            96.7    2e-23   
ref|XP_007177446.1|  PREDICTED: histone H3.1-like                     96.7    2e-23   
ref|XP_006680289.1|  histone H3                                       96.7    2e-23   
gb|AAI57347.1|  Unknown (protein for MGC:147886)                      96.7    2e-23   
dbj|BAD90754.1|  histone 3                                            96.7    2e-23   
emb|CAI23568.1|  histone cluster 2, H3, pseudogene 2                  96.7    2e-23   
ref|XP_009448956.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    100   2e-23   
gb|AIN56126.1|  histone H3                                            96.3    2e-23   
ref|XP_009206163.1|  PREDICTED: histone H3.1-like                     96.3    2e-23   
ref|NP_001104686.1|  histone cluster 3, H3                            96.7    2e-23   
ref|XP_003770651.1|  PREDICTED: histone H3.2-like                     96.7    2e-23   
ref|XP_003451182.1|  PREDICTED: histone H3-like                       95.9    2e-23   
gb|AAH66884.1|  Histone cluster 1, H3i                                96.7    2e-23   
ref|XP_002502604.1|  histone H3                                       96.7    2e-23   
ref|XP_001624255.1|  predicted protein                                96.7    2e-23   
ref|XP_002044884.1|  GM18811                                          97.1    2e-23   
ref|XP_001753449.1|  histone H3                                       96.7    2e-23   
ref|XP_782990.1|  PREDICTED: histone H3, embryonic-like               96.7    2e-23   
ref|XP_009098977.1|  PREDICTED: histone H3, embryonic-like            95.1    2e-23   
ref|XP_001862696.1|  Histone H3c                                      97.4    2e-23   
emb|CEF62715.1|  Histone H3                                           96.7    2e-23   
gb|AAY98303.1|  histone H3                                            96.3    2e-23   
ref|XP_003724461.1|  PREDICTED: histone H3, embryonic-like            96.7    2e-23   
ref|XP_001418070.1|  predicted protein                                96.7    2e-23   
gb|ADV77209.1|  histone H3                                            96.3    2e-23   
ref|XP_004670966.1|  PREDICTED: histone H3, embryonic-like            95.5    2e-23   
ref|XP_004781594.1|  PREDICTED: histone H3.1-like                     95.9    2e-23   
emb|CAA32434.1|  H3 histone                                           96.7    2e-23   
ref|XP_002943219.2|  PREDICTED: histone H3.2-like                     96.7    2e-23   
gb|AAI53404.1|  Zgc:113984 protein                                    96.7    2e-23   
ref|XP_009085209.1|  PREDICTED: uncharacterized protein LOC103813629    100   2e-23   
ref|XP_001892001.1|  histone H3                                       96.7    2e-23   
gb|AAO06264.1|  histone protein Hist2h3c1                             97.8    2e-23   
ref|NP_038576.1|  histone H3.2                                        96.7    2e-23   
ref|XP_004562239.1|  PREDICTED: histone H3.2-like                     96.7    2e-23   
ref|XP_009301168.1|  PREDICTED: histone H3                            96.7    2e-23   
gb|AAK51836.1|AF356516_2  early histone H3                            95.1    2e-23   
emb|CEF65438.1|  Histone H3                                           96.7    2e-23   
gb|EWM24685.1|  histone 3                                             96.7    2e-23   
ref|XP_006024249.1|  PREDICTED: histone H3.2-like                     96.7    2e-23   
ref|XP_005756396.1|  putative histone H3                              96.7    2e-23   
emb|CAA34274.1|  unnamed protein product                              96.7    2e-23   
ref|XP_004933313.1|  PREDICTED: histone H3-like                       96.7    2e-23   
ref|XP_005852293.1|  hypothetical protein CHLNCDRAFT_28967            96.7    2e-23   
ref|XP_003768748.1|  PREDICTED: histone H3.2-like                     96.7    2e-23   
ref|XP_001657283.1|  AAEL003827-PA                                    96.7    2e-23   
ref|XP_002045486.1|  GM19351                                          96.7    2e-23   
ref|XP_002962371.1|  hypothetical protein SELMODRAFT_78992            96.7    2e-23   
gb|EMC89182.1|  Histone H3                                            96.7    2e-23   
gb|KFP37625.1|  Histone H3                                            96.7    2e-23   
ref|XP_004576699.1|  PREDICTED: histone H3.2-like                     96.7    2e-23   
ref|XP_003259196.1|  PREDICTED: histone H3.2-like isoform 1           96.7    2e-23   
ref|XP_009027709.1|  hypothetical protein HELRODRAFT_185127           96.7    2e-23   
ref|XP_004712543.1|  PREDICTED: histone H3.2-like                     96.7    2e-23   
dbj|BAD90798.1|  histone 3                                            96.7    2e-23   
emb|CDJ98273.1|  histone H3.1-like                                    94.7    2e-23   
ref|XP_003746454.1|  PREDICTED: uncharacterized protein LOC100903667    100   2e-23   
ref|XP_006387391.1|  hypothetical protein POPTR_1112s00210g           95.5    2e-23   
ref|XP_009321196.1|  PREDICTED: histone H3                            96.7    2e-23   
ref|XP_010223166.1|  PREDICTED: histone H3-like                       96.7    2e-23   
gb|AAA48795.1|  histone H3                                            96.7    2e-23   
ref|XP_004043454.1|  PREDICTED: histone H3.1-like                     96.7    2e-23   
ref|XP_001618260.1|  hypothetical protein NEMVEDRAFT_v1g196043        96.7    2e-23   
gb|AAB27669.2|  H3 histone                                            96.7    2e-23   
gb|KFP71487.1|  Histone H3, embryonic                                 94.7    2e-23   
ref|NP_999709.1|  histone H3                                          96.7    2e-23   
gb|AFI61666.1|  histone 3                                             96.7    2e-23   
ref|XP_003113948.1|  hypothetical protein CRE_27089                   96.7    2e-23   
emb|CCD60248.1|  histone H3, putative                                 96.7    2e-23   
gb|AIY68792.1|  histone 3                                             96.3    2e-23   
emb|CAP53901.1|  histone H3                                           96.7    2e-23   
emb|CDS28816.1|  histone cluster 2, H3c2                              96.7    2e-23   
gb|ELU16492.1|  hypothetical protein CAPTEDRAFT_90093                 96.7    2e-23   
ref|XP_001619077.1|  hypothetical protein NEMVEDRAFT_v1g227757        96.7    2e-23   
emb|CAD38827.1|  histone h3.1                                         96.7    2e-23   
ref|XP_010823699.1|  PREDICTED: uncharacterized protein LOC528329       100   2e-23   
ref|XP_005982811.1|  PREDICTED: histone H3.1-like                     96.7    2e-23   
gb|KFQ43810.1|  Histone H3, embryonic                                 94.7    2e-23   
ref|XP_008615723.1|  histone H3                                       96.7    2e-23   
ref|XP_001640436.1|  predicted protein                                96.7    2e-23   
ref|NP_001091119.1|  histone cluster 1, H3g protein                   96.7    2e-23   
ref|XP_001967888.1|  GF13905                                          96.7    2e-23   
ref|XP_004839868.1|  PREDICTED: histone H3, embryonic-like            94.7    2e-23   
ref|XP_008172420.1|  PREDICTED: histone H3, embryonic-like            95.1    2e-23   
ref|XP_011384484.1|  PREDICTED: histone H3                            96.7    2e-23   
ref|XP_007882585.1|  PREDICTED: histone H3-like                       96.7    2e-23   
ref|XP_002164221.1|  PREDICTED: histone H3-like                       96.7    2e-23   
ref|XP_002045602.1|  GM25125                                          96.7    2e-23   
ref|XP_010567534.1|  PREDICTED: histone H2A type 2-C-like             96.3    2e-23   
ref|XP_005759351.1|  hypothetical protein EMIHUDRAFT_60840            94.4    2e-23   
emb|CAR63687.1|  Putative protein similar to H3 histone, family 2...  96.7    2e-23   
ref|XP_001865500.1|  histone H3.3 type 2                              97.1    2e-23   
gb|KDO16952.1|  histone H3                                            96.3    2e-23   
emb|CAB64685.1|  putative H3 histone                                  96.7    2e-23   
gb|EFB20876.1|  hypothetical protein PANDA_018573                     96.7    2e-23   
ref|XP_008539398.1|  PREDICTED: histone H3.1-like                     97.1    2e-23   
gb|KDP20192.1|  hypothetical protein JCGZ_07912                       98.6    2e-23   
ref|XP_002430912.1|  histone H3                                       96.7    2e-23   
ref|XP_002612136.1|  hypothetical protein BRAFLDRAFT_125364           96.7    2e-23   
gb|EPY83085.1|  histone 1, H2ai isoform 3-like protein                96.7    2e-23   
ref|XP_004717866.1|  PREDICTED: histone H3.2-like                     96.7    2e-23   
ref|XP_003384122.1|  PREDICTED: histone H3-like                       96.7    2e-23   
gb|EGI60526.1|  Histone H3                                            96.7    2e-23   
ref|XP_010816813.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3.1...  96.7    2e-23   
gb|AAA30003.1|  histone H3                                            96.7    2e-23   
ref|XP_004696931.1|  PREDICTED: histone H3.1-like                     96.7    2e-23   
ref|XP_002077478.1|  GD14342                                          95.5    2e-23   
gb|KHJ85982.1|  core histone H2A/H2B/H3/H4                            96.7    2e-23   
ref|XP_010634570.1|  PREDICTED: histone H3.1-like                     97.4    2e-23   
ref|XP_009084851.1|  PREDICTED: histone H3-like                       96.7    2e-23   
ref|XP_004389664.1|  PREDICTED: histone H3.2-like                     96.7    2e-23   
ref|XP_008691320.1|  PREDICTED: histone H3, embryonic-like            94.7    2e-23   
pdb|3AV1|A  Chain A, The Human Nucleosome Structure Containing Th...  96.7    2e-23   
ref|XP_002045660.1|  GM18832                                          96.7    2e-23   
ref|NP_003520.1|  histone H3.1                                        96.7    2e-23   
gb|ADH96035.1|  histone 3                                             95.5    2e-23   
gb|AAP80717.1|  putative histone H3 protein                           96.7    2e-23   
ref|XP_002177514.1|  histone H3 isoform 1c                            96.7    2e-23   
ref|XP_003612851.1|  Histone H3                                       98.6    2e-23   
ref|XP_002045584.1|  GM20952                                          96.7    2e-23   
emb|CBJ32075.1|  conserved unknown protein                            96.7    2e-23   
ref|XP_001619752.1|  hypothetical protein NEMVEDRAFT_v1g231526        96.7    2e-23   
gb|AAA52651.1|  histone H3                                            96.3    2e-23   
gb|EPY79586.1|  histone H3.2-like protein                             97.1    2e-23   
ref|XP_002999294.1|  histone, putative                                96.3    2e-23   
ref|XP_006801198.1|  PREDICTED: histone H3.3-like isoform X1          96.3    2e-23   
gb|AGN29609.1|  histone H3                                            96.3    2e-23   
gb|EHH18025.1|  Histone H3/a                                          96.3    2e-23   
ref|XP_003977328.1|  PREDICTED: histone H3.2-like                     97.1    3e-23   
ref|XP_001996809.1|  GH23336                                          96.7    3e-23   
gb|KHJ88043.1|  histone H3 family protein                             95.5    3e-23   
ref|XP_005892261.1|  PREDICTED: histone H3.1-like                     96.3    3e-23   
sp|Q7XYZ0.3|H3_GRIJA  RecName: Full=Histone H3                        96.3    3e-23   
gb|EFB20869.1|  hypothetical protein PANDA_018566                     96.7    3e-23   
ref|XP_009049687.1|  hypothetical protein LOTGIDRAFT_176498           97.8    3e-23   
ref|XP_005906213.1|  PREDICTED: histone H3.1-like                     96.3    3e-23   
ref|XP_004778837.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3.1...  96.3    3e-23   
gb|EFB20866.1|  hypothetical protein PANDA_018563                     96.3    3e-23   
ref|XP_002045675.1|  GM19751                                          96.7    3e-23   
ref|XP_006040627.1|  PREDICTED: histone H3.1-like                     96.3    3e-23   
emb|CAB02546.1|  histone H3                                           96.3    3e-23   
ref|XP_006821693.1|  PREDICTED: histone H3-like                       97.1    3e-23   
ref|XP_001061048.2|  PREDICTED: histone H3.1                          97.8    3e-23   
ref|XP_011088023.1|  PREDICTED: histone H3.2-like                     97.8    3e-23   
ref|XP_004384101.1|  PREDICTED: histone H3.1-like                     95.5    3e-23   
ref|XP_006974382.1|  PREDICTED: histone H3.3-like isoform X2          95.5    3e-23   
gb|ACI68311.1|  Histone H3.3                                          96.3    3e-23   
ref|XP_009032312.1|  histone 3                                        96.3    3e-23   
ref|NP_001020342.1|  uncharacterized protein LOC573992                96.3    3e-23   
ref|XP_002422632.1|  histone H3, putative                             96.7    3e-23   
ref|XP_008992030.1|  PREDICTED: histone H3.1                          97.1    3e-23   
ref|XP_007471286.1|  PREDICTED: histone H3.1-like                     96.3    3e-23   
ref|XP_001618210.1|  hypothetical protein NEMVEDRAFT_v1g155317        94.0    3e-23   
dbj|BAD02414.1|  histone 3                                            96.3    3e-23   
ref|XP_003776823.2|  PREDICTED: uncharacterized protein LOC100935714  99.8    3e-23   
ref|XP_003970928.1|  PREDICTED: histone H3, embryonic-like            95.9    3e-23   
emb|CBY42178.1|  unnamed protein product                              96.3    3e-23   
gb|AAH67493.1|  Histone cluster 1, H3i                                96.3    3e-23   
emb|CAD38833.1|  histone h3.2                                         96.3    3e-23   
ref|XP_002803683.1|  PREDICTED: histone H3.2-like isoform 2           95.9    3e-23   
emb|CCA15304.1|  histone putative                                     96.3    3e-23   
ref|XP_002045797.1|  GM16878                                          96.3    3e-23   
ref|XP_002406905.1|  histone H3, putative                             96.3    3e-23   
ref|XP_004286162.1|  PREDICTED: histone H3.1-like                     96.3    3e-23   
ref|XP_006735988.1|  PREDICTED: histone H3.1-like                     95.5    3e-23   
gb|AFI61670.1|  histone 3                                             96.3    3e-23   
ref|XP_001997795.1|  GH23257                                          96.3    3e-23   
ref|XP_001621118.1|  hypothetical protein NEMVEDRAFT_v1g48395         94.0    3e-23   
ref|XP_007179127.1|  PREDICTED: histone H3.1-like isoform X2          96.3    3e-23   
ref|XP_003980052.1|  PREDICTED: histone H3, embryonic-like            95.5    3e-23   
ref|XP_003502227.1|  PREDICTED: histone H3.1                          96.3    3e-23   
ref|XP_008331672.1|  PREDICTED: histone H3-like                       97.4    3e-23   
ref|XP_007163668.1|  hypothetical protein PHAVU_001G253800g           97.8    3e-23   
ref|XP_002077412.1|  GD13419                                          95.5    3e-23   
ref|XP_001865165.1|  conserved hypothetical protein                   95.5    3e-23   
ref|XP_006736850.1|  PREDICTED: histone H3.1-like                     95.5    3e-23   
ref|XP_004621953.1|  PREDICTED: histone H3.1-like                     96.3    3e-23   
tpg|DAA55311.1|  TPA: histone H3.2                                    98.6    3e-23   
gb|AJA38233.1|  histone H3                                            95.9    3e-23   
gb|ACS13004.1|  histone H3                                            95.9    3e-23   
ref|XP_002802179.1|  PREDICTED: histone H3.2-like isoform 2           95.5    3e-23   
ref|XP_004694924.1|  PREDICTED: histone H3.3-like                     95.5    3e-23   
ref|XP_004695483.1|  PREDICTED: histone H3.1-like                     96.3    3e-23   
ref|XP_004621945.1|  PREDICTED: histone H3.1-like                     96.3    3e-23   
ref|XP_001366052.3|  PREDICTED: histone H3-like centromeric prote...  99.4    3e-23   
ref|XP_002422654.1|  histone H3, putative                             96.7    3e-23   
ref|XP_010444908.1|  PREDICTED: histone H3.3-like                     95.1    3e-23   
ref|XP_002045558.1|  GM16403                                          96.7    3e-23   
ref|XP_002131734.2|  PREDICTED: histone H3.3                          97.1    3e-23   
ref|XP_004917457.1|  PREDICTED: uncharacterized protein LOC100496129    102   3e-23   
gb|EFB21581.1|  hypothetical protein PANDA_016834                     96.3    3e-23   
pdb|3AZH|A  Chain A, Crystal Structure Of Human Nucleosome Core P...  96.3    3e-23   
pdb|3AZG|A  Chain A, Crystal Structure Of Human Nucleosome Core P...  96.3    3e-23   
pdb|3AZF|A  Chain A, Crystal Structure Of Human Nucleosome Core P...  96.3    3e-23   
pdb|3AZE|A  Chain A, Crystal Structure Of Human Nucleosome Core P...  96.3    3e-23   
pdb|3AYW|A  Chain A, Crystal Structure Of Human Nucleosome Core P...  96.3    3e-23   
ref|XP_008055796.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.4    3e-23   
ref|XP_004002474.1|  PREDICTED: histone H3.2-like                     96.3    3e-23   
ref|XP_003145584.1|  histone type 2                                   96.7    3e-23   
gb|EJT46200.1|  histone H3.2-like protein                             96.3    3e-23   
gb|ACG30033.1|  histone H3                                            97.1    3e-23   
gb|AFW84465.1|  putative vesicle-associated membrane protein fami...  99.8    3e-23   
emb|CBY10450.1|  unnamed protein product                              95.1    3e-23   
gb|AGM53577.1|  histone H3                                            95.5    3e-23   
gb|KHJ89566.1|  core histone H2A/H2B/H3/H4                            96.3    3e-23   
pdb|3AFA|A  Chain A, The Human Nucleosome Structure                   96.3    3e-23   
ref|XP_006024231.1|  PREDICTED: histone H3, embryonic-like            95.1    3e-23   
ref|XP_007471296.1|  PREDICTED: histone H3.1-like                     95.5    3e-23   
emb|CAH61023.1|  histone H3                                           95.5    3e-23   
ref|XP_006024237.1|  PREDICTED: histone H3.2-like isoform X1          96.7    4e-23   
ref|XP_010916709.1|  PREDICTED: histone H3.3-like                     95.9    4e-23   
ref|XP_006288773.1|  hypothetical protein CARUB_v10002094mg           97.1    4e-23   
ref|XP_004432231.1|  PREDICTED: histone H3.1-like                     95.5    4e-23   
ref|XP_005150559.1|  PREDICTED: histone H3.2-like                     96.7    4e-23   
gb|EJK54772.1|  hypothetical protein THAOC_25571                      97.8    4e-23   
gb|AIE41520.1|  histone H3                                            95.5    4e-23   
dbj|BAC56518.1|  similar to H3 histone, family 3A                     94.7    4e-23   



>ref|XP_004917040.1| PREDICTED: histone H3.2-like isoform X2 [Xenopus (Silurana) tropicalis]
Length=148

 Score =   103 bits (256),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  33   IQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            IQ   ++V MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  4    IQLHSAVVAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  61



>ref|XP_003621457.1| Histone H3 [Medicago truncatula]
 gb|AES77675.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=235

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  27   LYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            ++     S+ PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  89   IFFLSNFSLFPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  148



>ref|XP_007971598.1| PREDICTED: histone H3.1-like [Chlorocebus sabaeus]
Length=181

 Score =   102 bits (253),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +3

Query  9    HSNFCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFR  188
            H +F  L+     SI  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+R
Sbjct  31   HCSFSALFQSIAFSI--MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYR  88

Query  189  PGTVAL  206
            PGTVAL
Sbjct  89   PGTVAL  94



>ref|XP_008461433.1| PREDICTED: histone H3.v1-like [Cucumis melo]
Length=331

 Score =   103 bits (258),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +3

Query  12   SNFCNLYIQFELSIVP-MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFR  188
            SNF     QF L   P MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFR
Sbjct  179  SNFRTQIFQFLLYQFPRMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFR  238

Query  189  PGTVAL  206
            PGTVAL
Sbjct  239  PGTVAL  244


 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_010424704.1| PREDICTED: histone H3-like centromeric protein CNA1 [Camelina 
sativa]
Length=302

 Score =   103 bits (257),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 55/65 (85%), Gaps = 5/65 (8%)
 Frame = +3

Query  12   SNFCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP  191
            +N C   I FE     MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP
Sbjct  156  TNICFKLIHFE-----MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP  210

Query  192  GTVAL  206
            GTVAL
Sbjct  211  GTVAL  215


 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_001177217.2| PREDICTED: histone H3, embryonic-like [Strongylocentrotus purpuratus]
 ref|XP_794816.3| PREDICTED: histone H3, embryonic-like [Strongylocentrotus purpuratus]
Length=145

 Score =   100 bits (248),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  48   SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            SI  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  6    SIFSMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  58



>ref|XP_007483400.1| PREDICTED: histone H3.2-like [Monodelphis domestica]
 ref|XP_007483403.1| PREDICTED: histone H3.2-like [Monodelphis domestica]
Length=196

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +3

Query  6    IHSNFCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRF  185
            +HS F  L  +F    V MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+
Sbjct  44   LHSRF-GLLGKFASPYVAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRY  102

Query  186  RPGTVAL  206
            RPGTVAL
Sbjct  103  RPGTVAL  109



>ref|XP_006401653.1| hypothetical protein EUTSA_v10014731mg [Eutrema salsugineum]
 gb|ESQ43106.1| hypothetical protein EUTSA_v10014731mg [Eutrema salsugineum]
Length=195

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +3

Query  3    SIHSNFCNLYIQFEL-SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH  179
            S+H +    +  F + S+  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH
Sbjct  40   SLHKSSLQKFKNFSIPSLNQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH  99

Query  180  RFRPGTVAL  206
            RFRPGTVAL
Sbjct  100  RFRPGTVAL  108



>ref|XP_010708157.1| PREDICTED: histone H3-like [Meleagris gallopavo]
Length=165

 Score =   100 bits (249),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = +3

Query  18   FCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGT  197
            F  L++ +  S V MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGT
Sbjct  17   FVVLFLTWCCSFV-MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGT  75

Query  198  VAL  206
            VAL
Sbjct  76   VAL  78



>ref|XP_007014942.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY32561.1| Histone superfamily protein [Theobroma cacao]
Length=176

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 57/65 (88%), Gaps = 4/65 (6%)
 Frame = +3

Query  15   NFCNLYIQFELSI-VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP  191
            +F NL   F LS  + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP
Sbjct  28   SFDNL---FHLSSQITMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP  84

Query  192  GTVAL  206
            GTVAL
Sbjct  85   GTVAL  89



>ref|XP_007013423.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY31042.1| Histone superfamily protein [Theobroma cacao]
Length=220

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +3

Query  48   SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            + +PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  81   TFLPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  133



>gb|KEH16402.1| histone H3.2 [Medicago truncatula]
Length=140

 Score = 99.4 bits (246),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_003788936.1| PREDICTED: histone H3.1-like [Otolemur garnettii]
Length=175

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  45   LSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            L ++ MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  35   LEVLVMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  88



>ref|XP_008663191.1| PREDICTED: histone H3.2-like [Zea mays]
 gb|AFW58221.1| histone H3.2 [Zea mays]
Length=171

 Score = 99.8 bits (247),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +3

Query  51   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            + PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  33   LSPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  84



>gb|KJB67030.1| hypothetical protein B456_010G171000 [Gossypium raimondii]
Length=193

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = +3

Query  18   FCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGT  197
            +  L   +++ ++ MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGT
Sbjct  45   YFRLIFSYQI-VLQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGT  103

Query  198  VAL  206
            VAL
Sbjct  104  VAL  106



>gb|KJB27089.1| hypothetical protein B456_004G277300 [Gossypium raimondii]
Length=193

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  48   SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            +I  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  54   TISSMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  106



>ref|WP_039311803.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91115.1| hypothetical protein QW71_36555, partial [Paenibacillus sp. IHB 
B 3415]
Length=98

 Score = 97.4 bits (241),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_004562913.1| PREDICTED: histone H3-like centromeric protein CSE4-like [Maylandia 
zebra]
Length=275

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  33   IQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            I+ E S+V MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVAL
Sbjct  131  IRGERSVVAMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVAL  188


 Score = 95.5 bits (236),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVAL  49



>ref|XP_003594840.1| Histone H3, partial [Medicago truncatula]
Length=97

 Score = 97.4 bits (241),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_003430322.2| PREDICTED: uncharacterized protein LOC100093342 [Ornithorhynchus 
anatinus]
Length=432

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 58/72 (81%), Gaps = 11/72 (15%)
 Frame = +3

Query  3    SIHSNF----CNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVK  170
            ++ SNF    C LY        PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVK
Sbjct  281  TLKSNFGFSYCVLY-------CPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVK  333

Query  171  KPHRFRPGTVAL  206
            KPHR+RPGTVAL
Sbjct  334  KPHRYRPGTVAL  345


 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AAB48833.1| cleavage stage histone H3 [Psammechinus miliaris]
Length=111

 Score = 97.8 bits (242),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_008669428.1| PREDICTED: histone H3.2-like [Zea mays]
Length=235

 Score =   100 bits (250),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 58/68 (85%), Gaps = 3/68 (4%)
 Frame = +3

Query  6    IHSNFCNLYIQFELSIV-PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR  182
            IHS+    Y   E S+  PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR
Sbjct  83   IHSS--QPYSCLESSLAAPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR  140

Query  183  FRPGTVAL  206
            FRPGTVAL
Sbjct  141  FRPGTVAL  148



>gb|KCW51227.1| hypothetical protein EUGRSUZ_J00806, partial [Eucalyptus grandis]
Length=161

 Score = 99.0 bits (245),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  42   ELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            E S + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  20   ESSPIGMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  74



>ref|XP_004384835.1| PREDICTED: histone H3.1t-like isoform 1 [Trichechus manatus latirostris]
Length=146

 Score = 98.6 bits (244),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  45   LSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            L +V MARTKQTARKSTGGKAPRKQLATK ARKSAPATGGVKKPHR+RPGTVAL
Sbjct  6    LILVVMARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVAL  59



>ref|XP_006368568.1| hypothetical protein POPTR_0001s05450g [Populus trichocarpa]
 gb|ERP65137.1| hypothetical protein POPTR_0001s05450g [Populus trichocarpa]
Length=221

 Score =   100 bits (248),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  57   PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  85   PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  134



>ref|XP_005337122.1| PREDICTED: histone H3.2-like [Ictidomys tridecemlineatus]
Length=140

 Score = 98.2 bits (243),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +3

Query  51   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            ++ MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  2    VLAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  53



>ref|XP_005519548.1| PREDICTED: histone H3.2-like isoform X1 [Pseudopodoces humilis]
Length=140

 Score = 98.2 bits (243),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +3

Query  51   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            ++ MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  2    VLAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  53



>gb|EPS65708.1| hypothetical protein M569_09069, partial [Genlisea aurea]
Length=88

 Score = 97.1 bits (240),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|NP_001183546.1| uncharacterized LOC100502113 [Zea mays]
 gb|ACG40473.1| histone H3 [Zea mays]
 gb|ACR37474.1| unknown [Zea mays]
 gb|ACR37478.1| unknown [Zea mays]
 gb|ACR37540.1| unknown [Zea mays]
 gb|ACR38114.1| unknown [Zea mays]
 tpg|DAA56682.1| TPA: histone H3 [Zea mays]
Length=136

 Score = 98.2 bits (243),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_009609114.1| PREDICTED: histone H3.2-like, partial [Nicotiana tomentosiformis]
Length=86

 Score = 96.7 bits (239),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_006366506.1| PREDICTED: histone H3.2-like isoform X2 [Solanum tuberosum]
Length=125

 Score = 97.8 bits (242),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_009601229.1| PREDICTED: histone H3.2-like [Nicotiana tomentosiformis]
Length=136

 Score = 98.2 bits (243),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|ADF58427.1| histone H3 [Oryza sativa Indica Group]
Length=136

 Score = 98.2 bits (243),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_005461835.1| PREDICTED: histone H3.2-like isoform X2 [Oreochromis niloticus]
Length=221

 Score =   100 bits (248),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +3

Query  51   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            + PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  83   LSPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  134



>ref|XP_006366514.1| PREDICTED: histone H3.2-like, partial [Solanum tuberosum]
Length=91

 Score = 96.7 bits (239),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_004139024.1| PREDICTED: histone H3.2-like [Cucumis sativus]
Length=136

 Score = 97.8 bits (242),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>emb|CBY08974.1| unnamed protein product [Oikopleura dioica]
 emb|CBY34391.1| unnamed protein product [Oikopleura dioica]
Length=136

 Score = 97.8 bits (242),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_003082036.1| Histones H3 and H4 (ISS) [Ostreococcus tauri]
Length=167

 Score = 98.6 bits (244),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  48   SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            S V MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  28   STVNMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  80



>ref|XP_001862683.1| histone H3.1t [Culex quinquefasciatus]
 gb|EDS37375.1| histone H3.1t [Culex quinquefasciatus]
Length=151

 Score = 98.2 bits (243),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  33   IQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
             +++ + + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  7    FEYKSTSIAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  64



>gb|EFZ22370.1| hypothetical protein SINV_16114 [Solenopsis invicta]
Length=147

 Score = 98.2 bits (243),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +3

Query  51   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            I  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  9    IFAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  60



>gb|KGN66469.1| hypothetical protein Csa_1G612925 [Cucumis sativus]
Length=171

 Score = 99.0 bits (245),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  48   SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            S+  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  32   SLSQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  84



>gb|ABX71451.2| histone H3, partial [Sierraperla cora]
Length=110

 Score = 97.1 bits (240),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_001847697.1| Histone H3c [Culex quinquefasciatus]
 gb|EDS26759.1| Histone H3c [Culex quinquefasciatus]
Length=121

 Score = 97.4 bits (241),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_006125985.1| PREDICTED: uncharacterized protein LOC102454723 [Pelodiscus sinensis]
Length=354

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 2/62 (3%)
 Frame = +3

Query  27   LYIQFE--LSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTV  200
            + + FE  LS V MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTV
Sbjct  51   VLVIFEASLSCVKMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTV  110

Query  201  AL  206
            AL
Sbjct  111  AL  112


 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/51 (96%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            V MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  217  VKMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  267



>emb|CBH32561.1| histone H3, expressed [Triticum aestivum]
 dbj|BAJ89751.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01873.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06522.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88326.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07409.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04782.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05326.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CDM85134.1| unnamed protein product [Triticum aestivum]
Length=136

 Score = 97.8 bits (242),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_006301260.1| hypothetical protein CARUB_v10021660mg, partial [Capsella rubella]
 gb|EOA34158.1| hypothetical protein CARUB_v10021660mg, partial [Capsella rubella]
Length=169

 Score = 98.6 bits (244),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   YIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            +  F +    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  24   FSSFRIYSKEMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  82



>ref|XP_003416447.2| PREDICTED: uncharacterized protein LOC100664283 [Loxodonta africana]
Length=510

 Score =   102 bits (255),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  21   CNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTV  200
            C LY     S + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTV
Sbjct  362  CYLYCPEVYSAISMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTV  421

Query  201  AL  206
            AL
Sbjct  422  AL  423


 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  111  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  159



>ref|XP_003979134.1| PREDICTED: histone H3.2-like, partial [Takifugu rubripes]
Length=108

 Score = 97.1 bits (240),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>sp|Q402E1.3|H32_LILLO RecName: Full=Histone H3.2 [Lilium longiflorum]
 dbj|BAE20250.1| histone H3 [Lilium longiflorum]
Length=136

 Score = 97.8 bits (242),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|AAA32655.1| histone H3 (H3-1.1) [Medicago sativa]
Length=136

 Score = 97.8 bits (242),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|AFK39648.1| unknown [Medicago truncatula]
Length=136

 Score = 97.8 bits (242),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|ACN40064.1| unknown [Picea sitchensis]
Length=136

 Score = 97.8 bits (242),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|NP_001238509.1| uncharacterized protein LOC100306416 [Glycine max]
 ref|XP_003529355.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003531787.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003531853.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003537953.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003539404.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003542714.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003546675.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_003557185.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_003564281.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_003568367.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_003575094.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_003592468.1| Histone H3 [Medicago truncatula]
 ref|XP_003612856.1| Histone H3 [Medicago truncatula]
 ref|XP_003622981.1| Histone H3 [Medicago truncatula]
 ref|XP_003628691.1| Histone H3 [Medicago truncatula]
 ref|XP_003630185.1| Histone H3 [Medicago truncatula]
 ref|XP_004140867.1| PREDICTED: histone H3.2-like [Cucumis sativus]
 ref|XP_004160811.1| PREDICTED: histone H3.2-like [Cucumis sativus]
 ref|XP_004488709.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004489510.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004489511.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004489512.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004489513.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004503973.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004505111.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_004512510.1| PREDICTED: histone H3.2-like [Cicer arietinum]
 ref|XP_006383727.1| hypothetical protein POPTR_0005s25530g [Populus trichocarpa]
 ref|XP_006595049.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_006597243.1| PREDICTED: histone H3.2-like [Glycine max]
 ref|XP_006846511.1| hypothetical protein AMTR_s00018p00168040 [Amborella trichopoda]
 ref|XP_007131986.1| hypothetical protein PHAVU_011G057200g [Phaseolus vulgaris]
 ref|XP_007133533.1| hypothetical protein PHAVU_011G187100g [Phaseolus vulgaris]
 ref|XP_007139488.1| hypothetical protein PHAVU_008G033700g [Phaseolus vulgaris]
 ref|XP_007153894.1| hypothetical protein PHAVU_003G073800g [Phaseolus vulgaris]
 ref|XP_007159809.1| hypothetical protein PHAVU_002G269200g [Phaseolus vulgaris]
 ref|XP_007159810.1| hypothetical protein PHAVU_002G269300g [Phaseolus vulgaris]
 ref|XP_008352444.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008384522.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008384524.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008445689.1| PREDICTED: histone H3.2 [Cucumis melo]
 ref|XP_008657023.1| PREDICTED: histone H3.2 [Zea mays]
 ref|XP_008784458.1| PREDICTED: histone H3.2 [Phoenix dactylifera]
 ref|XP_008785823.1| PREDICTED: histone H3.2 [Phoenix dactylifera]
 ref|XP_009374750.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009379418.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009379421.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009414586.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_010025543.1| PREDICTED: histone H3.2 [Eucalyptus grandis]
 ref|XP_010025545.1| PREDICTED: histone H3.2 [Eucalyptus grandis]
 ref|XP_010246200.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010231094.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_010231492.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_010237279.1| PREDICTED: histone H3.2 [Brachypodium distachyon]
 ref|XP_010523315.1| PREDICTED: histone H3.2 [Tarenaya hassleriana]
 ref|XP_010928463.1| PREDICTED: histone H3.2 [Elaeis guineensis]
 ref|XP_011045162.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_011014732.1| PREDICTED: histone H3.2 [Populus euphratica]
 sp|P68427.2|H32_PEA RecName: Full=Histone H3.2 [Pisum sativum]
 sp|P68428.2|H32_WHEAT RecName: Full=Histone H3.2 [Triticum aestivum]
 sp|P68429.2|H32_MEDSA RecName: Full=Histone H3.2; AltName: Full=Histone H3.1; AltName: 
Full=Major histone H3 [Medicago sativa]
 sp|P68430.2|H32_ONOVI RecName: Full=Histone H3.2 [Onobrychis viciifolia]
 emb|CAA31964.1| unnamed protein product [Medicago sativa]
 emb|CAA31965.1| unnamed protein product [Medicago sativa]
 emb|CAA25451.1| unnamed protein product [Triticum aestivum]
 gb|AAB49545.1| histone H3.1 [Medicago sativa]
 gb|AAB81995.1| histone H3 [Onobrychis viciifolia]
 gb|ACG24791.1| histone H3 [Zea mays]
 gb|ACG27393.1| histone H3 [Zea mays]
 gb|ACG33231.1| histone H3 [Zea mays]
 gb|ACJ86155.1| unknown [Medicago truncatula]
 gb|ACU14577.1| unknown [Glycine max]
 gb|ACZ74621.1| histone H3-like protein [Wolffia arrhiza]
 gb|ADE76568.1| unknown [Picea sitchensis]
 gb|ADE76659.1| unknown [Picea sitchensis]
 dbj|BAK05448.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85119.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85969.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88067.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01074.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AES79199.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AES95814.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AET03167.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AET04661.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AFK40853.1| unknown [Medicago truncatula]
 gb|AFK41087.1| unknown [Medicago truncatula]
 gb|AFK42486.1| unknown [Medicago truncatula]
 gb|AFK42592.1| unknown [Lotus japonicus]
 gb|AFK43073.1| unknown [Medicago truncatula]
 gb|AFK47036.1| unknown [Medicago truncatula]
 gb|AFW71715.1| histone H3 [Zea mays]
 gb|AFW84464.1| putative vesicle-associated membrane protein family protein [Zea 
mays]
 gb|ERN08186.1| hypothetical protein AMTR_s00018p00168040 [Amborella trichopoda]
 gb|ERP61524.1| hypothetical protein POPTR_0005s25530g [Populus trichocarpa]
 gb|ESW03980.1| hypothetical protein PHAVU_011G057200g [Phaseolus vulgaris]
 gb|ESW05527.1| hypothetical protein PHAVU_011G187100g [Phaseolus vulgaris]
 gb|ESW11482.1| hypothetical protein PHAVU_008G033700g [Phaseolus vulgaris]
 gb|ESW25888.1| hypothetical protein PHAVU_003G073800g [Phaseolus vulgaris]
 gb|ESW31803.1| hypothetical protein PHAVU_002G269200g [Phaseolus vulgaris]
 gb|ESW31804.1| hypothetical protein PHAVU_002G269300g [Phaseolus vulgaris]
 gb|AET04671.2| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|KEH21352.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AES95809.2| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|KEH30259.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|KEH30956.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AES65091.2| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 emb|CDM83919.1| unnamed protein product [Triticum aestivum]
 gb|KHN21882.1| Histone H3.2 [Glycine soja]
 gb|KHN30118.1| Histone H3.2 [Glycine soja]
 gb|KHN34049.1| Histone H3.2 [Glycine soja]
Length=136

 Score = 97.8 bits (242),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_008218130.1| PREDICTED: histone H3.1-like [Nasonia vitripennis]
Length=136

 Score = 97.8 bits (242),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|ABR67482.1| histone H3 [Eomantis guttatipennis]
 gb|ACG80524.1| histone 3 [Paraleptophlebia volitans]
 gb|ACG80525.1| histone 3 [Paraleptophlebia westoni]
 gb|AHZ58408.1| histone H3, partial [Alitta virens]
Length=109

 Score = 97.1 bits (240),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIF33209.1| histone H3, partial [Myctophum phengodes]
Length=110

 Score = 97.1 bits (240),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_002739194.1| PREDICTED: histone H3-like, partial [Saccoglossus kowalevskii]
 ref|XP_005140124.1| PREDICTED: histone H3.2-like, partial [Melopsittacus undulatus]
 ref|XP_008401840.1| PREDICTED: histone H3-like, partial [Poecilia reticulata]
Length=110

 Score = 97.1 bits (240),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AAV65112.1| histone 3 [Camellia sinensis]
Length=136

 Score = 97.8 bits (242),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|AAW65278.1| histone 3, partial [Platythelphusa armata]
 gb|AAW65279.1| histone 3, partial [Potamonautes brincki]
 gb|AAW65280.1| histone 3, partial [Potamonautes calcaratus]
 gb|AAW65281.1| histone 3, partial [Potamonautes clarus]
 gb|AAW65282.1| histone 3, partial [Potamonautes dentatus]
 gb|AAW65283.1| histone 3, partial [Potamonautes depressus]
 gb|AAW65284.1| histone 3, partial [Potamonautes ecorssei]
 gb|AAW65286.1| histone 3, partial [Potamonautes granularis]
 gb|AAW65287.1| histone 3, partial [Potamonautes lirrangensis]
 gb|AAW65289.1| histone 3, partial [Potamonautes sp. SAD-2004]
 gb|AAW65290.1| histone 3, partial [Potamonautes niloticus]
 gb|AAW65291.1| histone 3, partial [Potamonautes obesus]
 gb|AAW65293.1| histone 3, partial [Potamonautes parvispina]
 gb|AAW65294.1| histone 3, partial [Potamonautes parvicorpus]
 gb|AAW65295.1| histone 3, partial [Potamonautes perlatus]
 gb|AAW65296.1| histone 3, partial [Potamonautes platynotus]
 gb|AAW65298.1| histone 3, partial [Potamonautes sidneyi]
 gb|AAW65299.1| histone 3, partial [Potamonautes unispinus]
 gb|AAW65300.1| histone 3, partial [Potamonautes warreni]
 gb|AAW65301.1| histone 3, partial [Sudanonautes floweri]
 gb|AAW65304.1| histone 3, partial [Seychellum alluaudi]
 gb|AAW65305.1| histone 3, partial [Hydrothelphusa agilis]
 gb|AAW65306.1| histone 3, partial [Hydrothelphusa sp. SAD-2004]
 gb|AAW65307.1| histone 3, partial [Hydrothelphusa goudoti]
 gb|AAW65308.1| histone 3, partial [Hydrothelphusa madagascariensis]
 gb|AAW65309.1| histone 3, partial [Madagapotamon humberti]
 gb|AAW65314.1| histone 3, partial [Skelosophusa eumeces]
 gb|AAW65317.1| histone 3, partial [Johora tiomanensis]
 gb|AAW65319.1| histone 3, partial [Geothelphusa sp. SAD-2004]
 gb|AAW65320.1| histone 3, partial [Geothelphusa albogilva]
 gb|AAW65322.1| histone 3, partial [Parathelphusa sp. SAD-2004]
 gb|AAW65323.1| histone 3, partial [Rouxana sp. 1 SAD-2004]
 gb|AAW65324.1| histone 3, partial [Rouxana sp. 2 SAD-2004]
 gb|AAW65325.1| histone 3, partial [Phricothelphusa limula]
 gb|AAW65327.1| histone 3, partial [Guinotia dentata]
 gb|ACG80479.1| histone 3 [Radima sp. 4 BCOD-2008]
Length=102

 Score = 96.7 bits (239),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_004934091.1| PREDICTED: histone H3-like, partial [Bombyx mori]
Length=109

 Score = 97.1 bits (240),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|EMT07308.1| Histone H3.2 [Aegilops tauschii]
Length=144

 Score = 97.8 bits (242),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|NP_189372.1| histone H3  [Arabidopsis thaliana]
 ref|NP_201339.1| histone H3.1 [Arabidopsis thaliana]
 ref|NP_563838.1| histone H3  [Arabidopsis thaliana]
 ref|NP_568227.1| histone H3 [Arabidopsis thaliana]
 ref|NP_568228.1| histone H3 [Arabidopsis thaliana]
 ref|NP_001044904.1| Os01g0866200 [Oryza sativa Japonica Group]
 ref|NP_001052776.1| Os04g0419600 [Oryza sativa Japonica Group]
 ref|NP_001055660.1| Os05g0438700 [Oryza sativa Japonica Group]
 ref|NP_001056877.1| Os06g0160100 [Oryza sativa Japonica Group]
 ref|NP_001065791.1| Os11g0155900 [Oryza sativa Japonica Group]
 ref|NP_001131276.1| histone H3.2 [Zea mays]
 ref|NP_001174611.1| Os06g0159501 [Oryza sativa Japonica Group]
 ref|NP_001174613.1| Os06g0160001 [Oryza sativa Japonica Group]
 ref|XP_002299242.1| histone H3 family protein [Populus trichocarpa]
 ref|XP_002304754.1| hypothetical protein POPTR_0003s22120g [Populus trichocarpa]
 ref|XP_002282606.1| PREDICTED: histone H3.2 [Vitis vinifera]
 ref|XP_002285556.1| PREDICTED: histone H3.2 [Vitis vinifera]
 ref|XP_002285562.1| PREDICTED: histone H3.2 [Vitis vinifera]
 ref|XP_002264961.1| PREDICTED: histone H3.2 [Vitis vinifera]
 ref|XP_002457320.1| hypothetical protein SORBIDRAFT_03g005550 [Sorghum bicolor]
 ref|XP_002452234.1| hypothetical protein SORBIDRAFT_04g022160 [Sorghum bicolor]
 ref|XP_002446458.1| hypothetical protein SORBIDRAFT_06g016330 [Sorghum bicolor]
 ref|XP_002447846.1| hypothetical protein SORBIDRAFT_06g016850 [Sorghum bicolor]
 ref|XP_002441172.1| hypothetical protein SORBIDRAFT_09g021650 [Sorghum bicolor]
 ref|XP_002436522.1| hypothetical protein SORBIDRAFT_10g004110 [Sorghum bicolor]
 ref|XP_002437869.1| hypothetical protein SORBIDRAFT_10g004100 [Sorghum bicolor]
 ref|XP_002522502.1| histone h3, putative [Ricinus communis]
 ref|XP_002524630.1| histone h3, putative [Ricinus communis]
 ref|XP_002533558.1| histone h3, putative [Ricinus communis]
 ref|XP_002533561.1| histone h3, putative [Ricinus communis]
 ref|XP_002533563.1| histone h3, putative [Ricinus communis]
 ref|XP_002533564.1| histone h3, putative [Ricinus communis]
 ref|XP_002873454.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002873455.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002877045.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002892490.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002894648.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_004142133.1| PREDICTED: histone H3.2-like [Cucumis sativus]
 ref|XP_004154620.1| PREDICTED: histone H3.2-like isoform 1 [Cucumis sativus]
 ref|XP_004154621.1| PREDICTED: histone H3.2-like isoform 2 [Cucumis sativus]
 ref|XP_004158207.1| PREDICTED: histone H3.2-like [Cucumis sativus]
 ref|XP_004167423.1| PREDICTED: histone H3.2-like [Cucumis sativus]
 ref|XP_004173594.1| PREDICTED: histone H3.2-like [Cucumis sativus]
 ref|XP_004229355.1| PREDICTED: histone H3.2 [Solanum lycopersicum]
 ref|XP_004229356.1| PREDICTED: histone H3.2 [Solanum lycopersicum]
 ref|XP_004229488.1| PREDICTED: histone H3.2 [Solanum lycopersicum]
 ref|XP_004248123.1| PREDICTED: histone H3.2 [Solanum lycopersicum]
 ref|XP_004293906.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca]
 ref|XP_004294584.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca]
 ref|XP_004294793.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca]
 ref|XP_004295221.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca]
 ref|XP_004300433.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca]
 ref|XP_004952690.1| PREDICTED: histone H3.2-like [Setaria italica]
 ref|XP_004964781.1| PREDICTED: histone H3.2-like [Setaria italica]
 ref|XP_004970697.1| PREDICTED: histone H3.2-like [Setaria italica]
 ref|XP_004975679.1| PREDICTED: histone H3.2-like [Setaria italica]
 ref|XP_006359169.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_006359170.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_006361042.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_006364319.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_006365266.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_006366504.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_006366505.1| PREDICTED: histone H3.2-like isoform X1 [Solanum tuberosum]
 ref|XP_006289123.1| hypothetical protein CARUB_v10002544mg [Capsella rubella]
 ref|XP_006289801.1| hypothetical protein CARUB_v10003405mg [Capsella rubella]
 ref|XP_006292533.1| hypothetical protein CARUB_v10018763mg [Capsella rubella]
 ref|XP_006304637.1| hypothetical protein CARUB_v10011755mg [Capsella rubella]
 ref|XP_006386195.1| hypothetical protein POPTR_0002s03030g [Populus trichocarpa]
 ref|XP_006386111.1| hypothetical protein POPTR_0003s22240g [Populus trichocarpa]
 ref|XP_002320408.2| hypothetical protein POPTR_0014s09260g [Populus trichocarpa]
 ref|XP_006394044.1| hypothetical protein EUTSA_v10005111mg [Eutrema salsugineum]
 ref|XP_006394194.1| hypothetical protein EUTSA_v10005114mg [Eutrema salsugineum]
 ref|XP_006396911.1| hypothetical protein EUTSA_v10029057mg [Eutrema salsugineum]
 ref|XP_006399532.1| hypothetical protein EUTSA_v10014986mg [Eutrema salsugineum]
 ref|XP_006399534.1| hypothetical protein EUTSA_v10014985mg [Eutrema salsugineum]
 ref|XP_006426310.1| hypothetical protein CICLE_v10026742mg [Citrus clementina]
 ref|XP_006446007.1| hypothetical protein CICLE_v10017132mg [Citrus clementina]
 ref|XP_006446012.1| hypothetical protein CICLE_v10017131mg [Citrus clementina]
 ref|XP_006446027.1| hypothetical protein CICLE_v10017133mg [Citrus clementina]
 ref|XP_006466277.1| PREDICTED: histone H3.2-like [Citrus sinensis]
 ref|XP_006493650.1| PREDICTED: histone H3.2-like [Citrus sinensis]
 ref|XP_006493653.1| PREDICTED: histone H3.2-like isoform X1 [Citrus sinensis]
 ref|XP_006493654.1| PREDICTED: histone H3.2-like isoform X2 [Citrus sinensis]
 ref|XP_006493658.1| PREDICTED: histone H3.2-like isoform X1 [Citrus sinensis]
 ref|XP_006493659.1| PREDICTED: histone H3.2-like isoform X2 [Citrus sinensis]
 ref|XP_006656199.1| PREDICTED: histone H3.2-like [Oryza brachyantha]
 ref|XP_006662745.1| PREDICTED: histone H3.2-like [Oryza brachyantha]
 ref|XP_006827607.1| hypothetical protein AMTR_s00009p00240080 [Amborella trichopoda]
 ref|XP_006854535.1| hypothetical protein AMTR_s00030p00044250 [Amborella trichopoda]
 ref|XP_007014937.1| Histone superfamily protein [Theobroma cacao]
 ref|XP_007047838.1| Histone superfamily protein [Theobroma cacao]
 ref|XP_007206130.1| hypothetical protein PRUPE_ppa013165mg [Prunus persica]
 ref|XP_007206131.1| hypothetical protein PRUPE_ppa013174mg [Prunus persica]
 ref|XP_007213974.1| hypothetical protein PRUPE_ppa013173mg [Prunus persica]
 ref|XP_008219239.1| PREDICTED: histone H3.2 [Prunus mume]
 ref|XP_008219284.1| PREDICTED: histone H3.2 [Prunus mume]
 ref|XP_008243610.1| PREDICTED: histone H3.2 [Prunus mume]
 ref|XP_008245364.1| PREDICTED: histone H3.2 [Prunus mume]
 ref|XP_008383674.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008384460.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008384469.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008349461.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008358867.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008366176.1| PREDICTED: histone H3.2 [Malus domestica]
 ref|XP_008449740.1| PREDICTED: histone H3.2 [Cucumis melo]
 ref|XP_008466947.1| PREDICTED: histone H3.2 [Cucumis melo]
 ref|XP_008678686.1| PREDICTED: histone H3.2 [Zea mays]
 ref|XP_008659267.1| PREDICTED: histone H3.2 [Zea mays]
 ref|XP_008777421.1| PREDICTED: histone H3.2 [Phoenix dactylifera]
 ref|XP_008781402.1| PREDICTED: histone H3.2 [Phoenix dactylifera]
 ref|XP_008793940.1| PREDICTED: histone H3.2 [Phoenix dactylifera]
 ref|XP_009125303.1| PREDICTED: histone H3.2 [Brassica rapa]
 ref|XP_009131154.1| PREDICTED: histone H3.2 [Brassica rapa]
 ref|XP_009110843.1| PREDICTED: histone H3.2 [Brassica rapa]
 ref|XP_009112178.1| PREDICTED: histone H3.2 [Brassica rapa]
 ref|XP_009114048.1| PREDICTED: histone H3.2 [Brassica rapa]
 ref|XP_009374897.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009352838.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009364707.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009364738.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009379413.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri]
 ref|XP_009418349.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009393405.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009399186.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009404906.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009405329.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009411937.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009420590.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis]
 ref|XP_009612389.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis]
 ref|XP_009588612.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis]
 ref|XP_009588620.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis]
 ref|XP_009589159.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis]
 ref|XP_009594168.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis]
 ref|XP_009597397.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis]
 ref|XP_009795193.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009790377.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009792014.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009794411.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009794577.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009800087.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009768852.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_009776512.1| PREDICTED: histone H3.2 [Nicotiana sylvestris]
 ref|XP_010044997.1| PREDICTED: histone H3.2 [Eucalyptus grandis]
 ref|XP_010031842.1| PREDICTED: histone H3.2 [Eucalyptus grandis]
 ref|XP_010033130.1| PREDICTED: histone H3.2 [Eucalyptus grandis]
 ref|XP_010087371.1| Histone [Morus notabilis]
 ref|XP_010087372.1| Histone [Morus notabilis]
 ref|XP_010091983.1| Histone [Morus notabilis]
 ref|XP_010091985.1| Histone [Morus notabilis]
 ref|XP_010111157.1| Histone [Morus notabilis]
 ref|XP_010257371.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010257381.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010258545.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010260368.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010260930.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010263130.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010265797.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010241721.1| PREDICTED: histone H3.2 [Nelumbo nucifera]
 ref|XP_010324306.1| PREDICTED: histone H3.2 [Solanum lycopersicum]
 ref|XP_010316780.1| PREDICTED: histone H3.2 [Solanum lycopersicum]
 ref|XP_010463183.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010489841.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010502711.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010514443.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010425488.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010444536.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010458200.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010475747.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010484375.1| PREDICTED: histone H3.2 [Camelina sativa]
 ref|XP_010519319.1| PREDICTED: histone H3.2 [Tarenaya hassleriana]
 ref|XP_010536065.1| PREDICTED: histone H3.2 [Tarenaya hassleriana]
 ref|XP_010544196.1| PREDICTED: histone H3.2 [Tarenaya hassleriana]
 ref|XP_010673587.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673590.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010675450.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010675457.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010675458.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679903.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010911970.1| PREDICTED: histone H3.2 [Elaeis guineensis]
 ref|XP_010912408.1| PREDICTED: histone H3.2 [Elaeis guineensis]
 ref|XP_011037963.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_010930992.1| PREDICTED: histone H3.2 [Elaeis guineensis]
 ref|XP_011028938.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_010904890.1| PREDICTED: histone H3.2 [Elaeis guineensis]
 ref|XP_011037873.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_011037877.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_011042066.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_011042070.1| PREDICTED: histone H3.2 [Populus euphratica]
 ref|XP_011087280.1| PREDICTED: histone H3.2 [Sesamum indicum]
 ref|XP_011080254.1| PREDICTED: histone H3.2 [Sesamum indicum]
 ref|XP_011090392.1| PREDICTED: histone H3.2 [Sesamum indicum]
 ref|XP_011092467.1| PREDICTED: histone H3.2 [Sesamum indicum]
 ref|XP_011093538.1| PREDICTED: histone H3.2 [Sesamum indicum]
 ref|XP_011463287.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca]
 sp|P59226.2|H32_ARATH RecName: Full=Histone H3.2; AltName: Full=Histone H3.1 [Arabidopsis 
thaliana]
 sp|P69246.2|H32_MAIZE RecName: Full=Histone H3.2 [Zea mays]
 sp|P69248.2|H32_PETCR RecName: Full=Histone H3.2 [Petroselinum crispum]
 sp|Q71T45.3|H32_EUPES RecName: Full=Histone H3.2 [Euphorbia esula]
 sp|Q6LBE3.3|H32_ASPOF RecName: Full=Histone H3.2 [Asparagus officinalis]
 sp|Q6LCK1.3|H32_BRANA RecName: Full=Histone H3.2 [Brassica napus]
 sp|Q76MV0.1|H32_TOBAC RecName: Full=Histone H3.2 [Nicotiana tabacum]
 sp|Q2RAD9.1|H32_ORYSJ RecName: Full=Histone H3.2 [Oryza sativa Japonica Group]
 sp|A2Y533.1|H32_ORYSI RecName: Full=Histone H3.2 [Oryza sativa Indica Group]
 gb|AAF64452.1|AF239930_1 histone H3 [Euphorbia esula]
 gb|AAK49583.1|AF370577_1 histone H3 [Arabidopsis thaliana]
 emb|CAA31969.1| unnamed protein product [Oryza sativa]
 emb|CAA31970.1| unnamed protein product [Oryza sativa]
 gb|AAA33471.1| histone H3 (H3C3) [Zea mays]
 gb|AAA33472.1| histone H3 [Zea mays]
 gb|AAA33473.1| histone H3 [Zea mays]
 gb|AAA66265.1| histone H3 [Zea mays]
 gb|AAA33852.1| histone H3 [Petroselinum crispum]
 gb|AAA33853.1| histone H3 [Petroselinum crispum]
 gb|AAA33854.1| histone H3 [Petroselinum crispum]
 gb|AAA32808.1| histone H3 [Arabidopsis thaliana]
 gb|AAA32809.1| histone H3 [Arabidopsis thaliana]
 emb|CAA59111.1| histone 3 [Zea mays]
 gb|AAA79889.1| histone H3 [Arabidopsis thaliana]
 gb|AAB67837.1| histone H3 homolog [Brassica napus]
 emb|CAA57811.1| Histone H3 [Asparagus officinalis]
 gb|AAB18816.1| histone 3 [Oryza sativa Indica Group]
 gb|AAC24084.1| Match to histone H3 gene gb|M17131 and gb|M35387 from A. thaliana. 
ESTs gb|H76511 gb|H76255, gb|AA712452, gb|N65260 and gb|T42306 
come from this gene [Arabidopsis thaliana]
 dbj|BAA81840.1| histone H3 [Oryza sativa Japonica Group]
 dbj|BAA81841.1| histone H3 [Oryza sativa Japonica Group]
 emb|CAB89403.1| histone H3-like protein [Arabidopsis thaliana]
 emb|CAB89404.1| histone H3-like protein [Arabidopsis thaliana]
 dbj|BAA95712.1| histone H3-like protein [Arabidopsis thaliana]
 dbj|BAB11558.1| histone H3 [Arabidopsis thaliana]
 gb|AAK59851.1| AT3g27360/K1G2_6 [Arabidopsis thaliana]
 gb|AAK64008.1| AT5g65360/MNA5_9 [Arabidopsis thaliana]
 gb|AAL76132.1| AT3g27360/K1G2_6 [Arabidopsis thaliana]
 gb|AAL87394.1| AT5g65360/MNA5_9 [Arabidopsis thaliana]
 gb|AAM60903.1| histone H3-like protein [Arabidopsis thaliana]
 dbj|BAC01212.1| histone H3 [Oryza sativa Japonica Group]
 gb|AAM95675.1| histone H3 [Orobanche cernua var. cumana]
 dbj|BAC41835.1| putative histone H3 [Arabidopsis thaliana]
 dbj|BAC53942.1| H3 histone [Nicotiana tabacum]
 gb|AAO23616.1| At5g10400 [Arabidopsis thaliana]
 gb|AAO24594.1| At1g09200 [Arabidopsis thaliana]
 gb|AAO64207.1| putative histone H3 [Arabidopsis thaliana]
 gb|AAP04053.1| putative histone H3 [Arabidopsis thaliana]
 emb|CAE02924.1| OSJNBb0108J11.17 [Oryza sativa Japonica Group]
 gb|AAT07615.1| putative histone H3 [Oryza sativa Japonica Group]
 dbj|BAD46448.1| histone H3 [Oryza sativa Japonica Group]
 dbj|BAD46453.1| histone H3 [Oryza sativa Japonica Group]
 dbj|BAD46454.1| histone H3 [Oryza sativa Japonica Group]
 gb|AAX92719.1| histone H3 - maize [Oryza sativa Japonica Group]
 gb|AAZ66939.1| 117M18_20 [Brassica rapa]
 gb|ABA91537.2| Histone H3, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF00340.1| histone H3 like protein [Arabidopsis thaliana]
 dbj|BAE99603.1| histone H3 like protein [Arabidopsis thaliana]
 dbj|BAE99643.1| histone H3 like protein [Arabidopsis thaliana]
 dbj|BAF06818.1| Os01g0866200 [Oryza sativa Japonica Group]
 dbj|BAF14690.1| Os04g0419600 [Oryza sativa Japonica Group]
 dbj|BAF17574.1| Os05g0438700 [Oryza sativa Japonica Group]
 dbj|BAF18791.1| Os06g0160100 [Oryza sativa Japonica Group]
 dbj|BAF27636.1| Os11g0155900 [Oryza sativa Japonica Group]
 gb|ABK21761.1| unknown [Picea sitchensis]
 gb|ABK25492.1| unknown [Picea sitchensis]
 gb|ABK92858.1| unknown [Populus trichocarpa]
 gb|ABK93905.1| unknown [Populus trichocarpa]
 gb|ABK93950.1| unknown [Populus trichocarpa]
 gb|ABK95888.1| unknown [Populus trichocarpa]
 gb|EAY80005.1| hypothetical protein OsI_35174 [Oryza sativa Indica Group]
 gb|EAY98193.1| hypothetical protein OsI_20106 [Oryza sativa Indica Group]
 gb|EAY99776.1| hypothetical protein OsI_21763 [Oryza sativa Indica Group]
 gb|EAY99779.1| hypothetical protein OsI_21766 [Oryza sativa Indica Group]
 gb|EAZ14271.1| hypothetical protein OsJ_04197 [Oryza sativa Japonica Group]
 gb|EAZ30723.1| hypothetical protein OsJ_14783 [Oryza sativa Japonica Group]
 gb|EAZ35903.1| hypothetical protein OsJ_20204 [Oryza sativa Japonica Group]
 emb|CAN73758.1| hypothetical protein VITISV_031197 [Vitis vinifera]
 emb|CAN80002.1| hypothetical protein VITISV_043973 [Vitis vinifera]
 emb|CAN83843.1| hypothetical protein VITISV_044079 [Vitis vinifera]
 emb|CAN80880.1| hypothetical protein VITISV_018649 [Vitis vinifera]
 emb|CAN83194.1| hypothetical protein VITISV_010341 [Vitis vinifera]
 gb|ABS11143.1| histone H3 [Nicotiana benthamiana]
 dbj|BAF76800.1| histone H3.1 [Nicotiana tabacum]
 gb|ACF79612.1| unknown [Zea mays]
 gb|ACF82232.1| unknown [Zea mays]
 gb|ACF86247.1| unknown [Zea mays]
 gb|ACF88431.1| unknown [Zea mays]
 gb|ACG25137.1| histone H3 [Zea mays]
 gb|ACG27345.1| histone H3 [Zea mays]
 gb|ACG30057.1| histone H3 [Zea mays]
 gb|ACG30474.1| histone H3 [Zea mays]
 gb|ACG30701.1| histone H3 [Zea mays]
 gb|ACG30707.1| histone H3 [Zea mays]
 gb|ACG30791.1| histone H3 [Zea mays]
 gb|ACG30950.1| histone H3 [Zea mays]
 gb|ACG31934.1| histone H3 [Zea mays]
 gb|ACG36961.1| histone H3 [Zea mays]
 gb|ACG39635.1| histone H3 [Zea mays]
 gb|ACG40073.1| histone H3 [Zea mays]
 gb|ACG40983.1| histone H3 [Zea mays]
 gb|ACG47284.1| histone H3 [Zea mays]
 gb|ACG70966.1| histone H3 [Ziziphus jujuba]
 dbj|BAH00243.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80059.1| hypothetical protein OsI_21765 [Oryza sativa Indica Group]
 gb|EEE51672.1| hypothetical protein OsJ_33018 [Oryza sativa Japonica Group]
 gb|EEE79733.1| hypothetical protein POPTR_0003s22120g [Populus trichocarpa]
 gb|EEE84047.1| histone H3 family protein [Populus trichocarpa]
 gb|EEF28815.1| histone h3, putative [Ricinus communis]
 gb|EEF28818.1| histone h3, putative [Ricinus communis]
 gb|EEF28820.1| histone h3, putative [Ricinus communis]
 gb|EEF28821.1| histone h3, putative [Ricinus communis]
 gb|EEF37755.1| histone h3, putative [Ricinus communis]
 gb|EEF39802.1| histone h3, putative [Ricinus communis]
 gb|ACN33923.1| unknown [Zea mays]
 gb|ACR37182.1| unknown [Zea mays]
 gb|ACR37485.1| unknown [Zea mays]
 gb|ACR37603.1| unknown [Zea mays]
 gb|ACR37986.1| unknown [Zea mays]
 gb|ACR38054.1| unknown [Zea mays]
 gb|EER87889.1| hypothetical protein SORBIDRAFT_10g004110 [Sorghum bicolor]
 gb|EER89236.1| hypothetical protein SORBIDRAFT_10g004100 [Sorghum bicolor]
 gb|EES02440.1| hypothetical protein SORBIDRAFT_03g005550 [Sorghum bicolor]
 gb|EES05210.1| hypothetical protein SORBIDRAFT_04g022160 [Sorghum bicolor]
 gb|EES10786.1| hypothetical protein SORBIDRAFT_06g016330 [Sorghum bicolor]
 gb|EES12174.1| hypothetical protein SORBIDRAFT_06g016850 [Sorghum bicolor]
 gb|EES19602.1| hypothetical protein SORBIDRAFT_09g021650 [Sorghum bicolor]
 dbj|BAH93339.1| Os06g0159501 [Oryza sativa Japonica Group]
 dbj|BAH93341.1| Os06g0160001 [Oryza sativa Japonica Group]
 gb|ADC54261.1| histone H3 [Oryza sativa Japonica Group]
 gb|ADE76159.1| unknown [Picea sitchensis]
 gb|ADE76345.1| unknown [Picea sitchensis]
 gb|ADE76464.1| unknown [Picea sitchensis]
 gb|ADE77414.1| unknown [Picea sitchensis]
 gb|EFH49713.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49714.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53304.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68749.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70907.1| histone H3 [Arabidopsis lyrata subsp. lyrata]
 gb|ADR30794.1| histone H3.1 [Hevea brasiliensis]
 dbj|BAJ53177.1| JHL18I08.11 [Jatropha curcas]
 gb|AED91535.1| histone H3 [Arabidopsis thaliana]
 gb|AED91536.1| histone H3 [Arabidopsis thaliana]
 gb|AED98043.1| histone H3 [Arabidopsis thaliana]
 gb|AEE28413.1| histone H3 [Arabidopsis thaliana]
 gb|AEE77308.1| histone H3 [Arabidopsis thaliana]
 emb|CCD74495.1| histone H3 [Arabidopsis halleri subsp. halleri]
 gb|AFW58222.1| histone H3.2 isoform 1 [Zea mays]
 gb|AFW58223.1| histone H3.2 isoform 2 [Zea mays]
 gb|AFW58244.1| histone H3.2 [Zea mays]
 gb|AFW62565.1| histone H3.2 [Zea mays]
 gb|AFW75594.1| histone H3.2 [Zea mays]
 gb|AFW85733.1| histone H3.2 isoform 1 [Zea mays]
 gb|AFW85734.1| histone H3.2 isoform 2 [Zea mays]
 tpg|DAA37864.1| TPA: histone H3.2 [Zea mays]
 tpg|DAA53403.1| TPA: histone H3.2 [Zea mays]
 gb|EMJ07329.1| hypothetical protein PRUPE_ppa013165mg [Prunus persica]
 gb|EMJ07330.1| hypothetical protein PRUPE_ppa013174mg [Prunus persica]
 gb|EMJ15173.1| hypothetical protein PRUPE_ppa013173mg [Prunus persica]
 gb|EOA22021.1| hypothetical protein CARUB_v10002544mg [Capsella rubella]
 gb|EOA22699.1| hypothetical protein CARUB_v10003405mg [Capsella rubella]
 gb|EOA25431.1| hypothetical protein CARUB_v10018763mg [Capsella rubella]
 gb|EOA37535.1| hypothetical protein CARUB_v10011755mg [Capsella rubella]
 gb|EOX91995.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY32556.1| Histone superfamily protein [Theobroma cacao]
 gb|EPS69903.1| hypothetical protein M569_04854 [Genlisea aurea]
 gb|ERM95023.1| hypothetical protein AMTR_s00009p00240080 [Amborella trichopoda]
 gb|ERN16002.1| hypothetical protein AMTR_s00030p00044250 [Amborella trichopoda]
 gb|EEE98723.2| hypothetical protein POPTR_0014s09260g [Populus trichocarpa]
 gb|ERP63908.1| hypothetical protein POPTR_0003s22240g [Populus trichocarpa]
 gb|ERP63992.1| hypothetical protein POPTR_0002s03030g [Populus trichocarpa]
 gb|ESQ31330.1| hypothetical protein EUTSA_v10005111mg [Eutrema salsugineum]
 gb|ESQ31480.1| hypothetical protein EUTSA_v10005114mg [Eutrema salsugineum]
 gb|ESQ38364.1| hypothetical protein EUTSA_v10029057mg [Eutrema salsugineum]
 gb|ESQ40985.1| hypothetical protein EUTSA_v10014986mg [Eutrema salsugineum]
 gb|ESQ40987.1| hypothetical protein EUTSA_v10014985mg [Eutrema salsugineum]
 gb|ESR39550.1| hypothetical protein CICLE_v10026742mg [Citrus clementina]
 gb|ESR59247.1| hypothetical protein CICLE_v10017132mg [Citrus clementina]
 gb|ESR59252.1| hypothetical protein CICLE_v10017131mg [Citrus clementina]
 gb|ESR59267.1| hypothetical protein CICLE_v10017133mg [Citrus clementina]
 gb|EXB28981.1| Histone [Morus notabilis]
 gb|EXB28982.1| Histone [Morus notabilis]
 gb|EXB48389.1| Histone [Morus notabilis]
 gb|EXB48391.1| Histone [Morus notabilis]
 gb|EXC30548.1| Histone [Morus notabilis]
 gb|EYU18019.1| hypothetical protein MIMGU_mgv1a016053mg [Erythranthe guttata]
 gb|EYU18357.1| hypothetical protein MIMGU_mgv1a016039mg [Erythranthe guttata]
 gb|EYU26936.1| hypothetical protein MIMGU_mgv1a016046mg [Erythranthe guttata]
 gb|EYU39090.1| hypothetical protein MIMGU_mgv1a016037mg [Erythranthe guttata]
 gb|EYU43364.1| hypothetical protein MIMGU_mgv1a024982mg [Erythranthe guttata]
 gb|EYU46298.1| hypothetical protein MIMGU_mgv1a016044mg [Erythranthe guttata]
 gb|KCW52687.1| hypothetical protein EUGRSUZ_J02055 [Eucalyptus grandis]
 gb|KCW87138.1| hypothetical protein EUGRSUZ_B03665 [Eucalyptus grandis]
 gb|KDO60645.1| hypothetical protein CISIN_1g032664mg [Citrus sinensis]
 gb|KDO64858.1| hypothetical protein CISIN_1g032661mg [Citrus sinensis]
 gb|KDO64866.1| hypothetical protein CISIN_1g032673mg [Citrus sinensis]
 gb|KDO64873.1| hypothetical protein CISIN_1g032676mg [Citrus sinensis]
 gb|KDP20190.1| hypothetical protein JCGZ_07910 [Jatropha curcas]
 gb|KDP21024.1| hypothetical protein JCGZ_21495 [Jatropha curcas]
 emb|CDP11387.1| unnamed protein product [Coffea canephora]
 emb|CDP07721.1| unnamed protein product [Coffea canephora]
 emb|CDP07722.1| unnamed protein product [Coffea canephora]
 gb|KFK25331.1| hypothetical protein AALP_AA8G099000 [Arabis alpina]
 gb|KFK25332.1| hypothetical protein AALP_AA8G099100 [Arabis alpina]
 gb|KFK28215.1| hypothetical protein AALP_AA8G487700 [Arabis alpina]
 gb|KFK28217.1| hypothetical protein AALP_AA8G487900 [Arabis alpina]
 gb|KFK43216.1| hypothetical protein AALP_AA1G095700 [Arabis alpina]
 emb|CDX96998.1| BnaC09g46270D [Brassica napus]
 emb|CDX69839.1| BnaA10g21880D [Brassica napus]
 gb|KGN54155.1| histone H3 [Cucumis sativus]
 gb|AIZ04726.1| histone 3 [Elettaria cardamomum]
 gb|KJB21399.1| hypothetical protein B456_004G040400 [Gossypium raimondii]
 gb|KJB21400.1| hypothetical protein B456_004G040400 [Gossypium raimondii]
 gb|KJB27088.1| hypothetical protein B456_004G277200 [Gossypium raimondii]
 gb|KJB54045.1| hypothetical protein B456_009G018200 [Gossypium raimondii]
 gb|KJB70057.1| hypothetical protein B456_011G056400 [Gossypium raimondii]
 gb|KJB70058.1| hypothetical protein B456_011G056400 [Gossypium raimondii]
 gb|KJB70059.1| hypothetical protein B456_011G056500 [Gossypium raimondii]
 gb|KJB83503.1| hypothetical protein B456_013G250500 [Gossypium raimondii]
 prf||1303352A histone H3
 prf||1314298B histone H3
Length=136

 Score = 97.8 bits (242),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|ADH95969.1| histone 3 [Callobius severus]
Length=106

 Score = 97.1 bits (240),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_011086031.1| PREDICTED: histone H3.2-like [Sesamum indicum]
Length=136

 Score = 97.8 bits (242),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>emb|CDP18134.1| unnamed protein product [Coffea canephora]
Length=136

 Score = 97.8 bits (242),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|KDP29737.1| hypothetical protein JCGZ_18672 [Jatropha curcas]
Length=136

 Score = 97.8 bits (242),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_004229367.1| PREDICTED: histone H3.2-like [Solanum lycopersicum]
 ref|XP_006349141.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
Length=136

 Score = 97.8 bits (242),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|AIF33241.1| histone H3, partial [Solivomer arenidens]
Length=111

 Score = 97.1 bits (240),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|KHN31394.1| Histone H3.3 [Glycine soja]
Length=186

 Score = 99.0 bits (245),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 55/72 (76%), Gaps = 8/72 (11%)
 Frame = +3

Query  15   NFCNLYIQFELS--------IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVK  170
            N C L+IQ   S           MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVK
Sbjct  28   NLCILFIQDSASAFRKQRPKYFEMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVK  87

Query  171  KPHRFRPGTVAL  206
            KPHR+RPGTVAL
Sbjct  88   KPHRYRPGTVAL  99



>ref|XP_001967894.1| GF21629 [Drosophila ananassae]
 gb|EDV44813.1| GF21629 [Drosophila ananassae]
Length=119

 Score = 97.1 bits (240),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ADH95968.1| histone 3 [Callobius paynei]
 gb|ADH95970.1| histone 3 [Callobius nevadensis]
 gb|ADH95972.1| histone 3, partial [Callobius olympus]
Length=108

 Score = 97.1 bits (240),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_004252600.1| PREDICTED: histone H3.2-like [Solanum lycopersicum]
 ref|XP_006364137.1| PREDICTED: histone H3.2-like [Solanum tuberosum]
 ref|XP_008795734.1| PREDICTED: histone H3.2 [Phoenix dactylifera]
Length=136

 Score = 97.8 bits (242),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|AHZ58439.1| histone H3, partial [Amphiporus lactifloreus]
Length=111

 Score = 97.1 bits (240),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  3    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  51



>ref|XP_003738531.1| PREDICTED: histone H3-like, partial [Metaseiulus occidentalis]
Length=107

 Score = 97.1 bits (240),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_007972115.1| PREDICTED: uncharacterized protein LOC103222373 [Chlorocebus 
sabaeus]
Length=460

 Score =   102 bits (253),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  15   NFCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG  194
            N C       L  +PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPG
Sbjct  31   NNCWFRCDRCLKPIPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG  90

Query  195  TVAL  206
            TVAL
Sbjct  91   TVAL  94


 Score = 96.7 bits (239),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  325  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  373



>ref|XP_009794208.1| PREDICTED: histone H3, partial [Nicotiana sylvestris]
Length=100

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>sp|P08903.2|H32_ENCAL RecName: Full=Histone H3.2 [Encephalartos altensteinii]
Length=136

 Score = 97.8 bits (242),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|ABX71432.1| histone H3, partial [Cosumnoperla hypocrena]
Length=104

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_005150558.1| PREDICTED: histone H3, embryonic-like, partial [Melopsittacus 
undulatus]
Length=78

 Score = 95.9 bits (237),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_010260926.1| PREDICTED: histone H3.2-like [Nelumbo nucifera]
Length=136

 Score = 97.8 bits (242),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_009598129.1| PREDICTED: histone H3.2-like [Nicotiana tomentosiformis]
Length=136

 Score = 97.8 bits (242),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|ACG80497.1| histone 3 [Austrophlebioides sp. BCOD-2008]
Length=108

 Score = 97.1 bits (240),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABR67496.1| histone H3 [Gildella suavis]
 gb|ACG80507.1| histone 3 [Nousia bella]
 gb|ACG80509.1| histone 3 [Penaphlebia barriai]
 gb|ACG80511.1| histone 3 [Penaphlebia vinosa]
 gb|ACG80512.1| histone 3 [Tepakia caligata]
 gb|ACG80526.1| histone 3 [Habrophlebiodes americana]
 gb|ACG80536.1| histone 3 [Thraulodes sp. BCOD-2008]
 gb|ACG80537.1| histone 3 [Traverella albertana]
 gb|ACG80542.1| histone 3 [Isonychia sp. BCOD-2008]
Length=99

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABM53736.1| histone 3, partial [Pseudocreobotra wahlbergii]
 gb|ABX71406.1| histone H3, partial [Nanonemoura wahkeena]
 gb|ACG80491.1| histone 3 [Radima sp. 2 BCOD-2008]
Length=108

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ACG80495.1| histone 3 [Atalophlebia sp. BCOD-2008]
Length=108

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABN80281.1| histone H3 [Holcolaetis vellerea]
Length=100

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ACG80515.1| histone 3 [Leptophlebia intermedia]
 gb|AHE81416.1| histone H3, partial [Dyopedos bispinis]
Length=106

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|EFB20850.1| hypothetical protein PANDA_018542 [Ailuropoda melanoleuca]
Length=141

 Score = 97.8 bits (242),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  45   LSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            L    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    LQFFQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  54



>ref|XP_008560363.1| PREDICTED: histone H3.2-like [Microplitis demolitor]
Length=78

 Score = 95.9 bits (237),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ACG30943.1| histone H3 [Zea mays]
Length=178

 Score = 98.6 bits (244),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|AEK26353.1| histone H3 [Decatopecten plica]
Length=99

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_006652279.1| PREDICTED: histone H3.2-like [Oryza brachyantha]
Length=136

 Score = 97.4 bits (241),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|ACG80500.1| histone 3 [Isothraulus abditus]
Length=99

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AAW65297.1| histone 3, partial [Potamonautes rayboldi]
Length=102

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AAW65288.1| histone 3, partial [Potamonautes lividus]
Length=102

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABZ89657.1| histone H3, partial [Pomacea canaliculata]
Length=105

 Score = 96.7 bits (239),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|EEE63859.1| hypothetical protein OsJ_18683 [Oryza sativa Japonica Group]
Length=121

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_001853968.1| histone H3.2 [Culex quinquefasciatus]
 gb|EDS34369.1| histone H3.2 [Culex quinquefasciatus]
Length=136

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_001745925.1| hypothetical protein [Monosiga brevicollis MX1]
 ref|XP_001747171.1| hypothetical protein [Monosiga brevicollis MX1]
 ref|XP_001749159.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ85965.1| predicted protein [Monosiga brevicollis MX1]
 gb|EDQ88095.1| predicted protein [Monosiga brevicollis MX1]
 gb|EDQ89349.1| predicted protein [Monosiga brevicollis MX1]
Length=136

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_009782179.1| PREDICTED: histone H3.2-like [Nicotiana sylvestris]
 ref|XP_010276199.1| PREDICTED: histone H3.2-like [Nelumbo nucifera]
Length=136

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|AAW65312.1| histone 3, partial [Malagasya goodmani]
Length=102

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AAA33907.1| histone 3 [Oryza sativa]
 gb|AAA74190.1| histone H3 [Oryza sativa Indica Group]
Length=136

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>ref|XP_010547605.1| PREDICTED: histone H3.2-like [Tarenaya hassleriana]
Length=136

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|AIF33173.1| histone H3, partial [Lampadena speculigera]
Length=112

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABN80288.1| histone H3 [Oxyopes birmanicus]
 gb|ACG80481.1| histone 3 [Leptophlebiidae sp. Malagasy taxon 12]
 gb|ACG80489.1| histone 3 [Leptophlebiidae sp. Malagasy taxon 5]
 gb|ACP74168.1| histone H3, partial [Bellamya unicolor elatior]
Length=112

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AAW48016.1| histone 3 [Irdex sp. 1 DM55]
Length=107

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIF33081.1| histone H3, partial [Benthosema glaciale]
Length=113

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIF33151.1| histone H3, partial [Electrona antarctica]
Length=113

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIN56052.1| histone H3, partial [Paragoniastrea deformis]
Length=121

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABR67494.1| histone H3 [Tropidomantis sp. MN096]
Length=125

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_001862674.1| histone H3 type 2 [Culex quinquefasciatus]
 ref|XP_001862721.1| histone H3 type 2 [Culex quinquefasciatus]
 ref|XP_001862725.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37366.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37413.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37417.1| histone H3 type 2 [Culex quinquefasciatus]
Length=146

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  9    IAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  59



>gb|AIS22439.1| histone H3, partial [Halocynthia pyriformis]
 gb|AIS22440.1| histone H3, partial [Halocynthia pyriformis]
 gb|AIS22441.1| histone H3, partial [Halocynthia pyriformis]
 gb|AIS22442.1| histone H3, partial [Halocynthia pyriformis]
Length=114

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_009629722.1| PREDICTED: histone H3.2-like [Nicotiana tomentosiformis]
Length=169

 Score = 98.2 bits (243),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|AFK35319.1| unknown [Medicago truncatula]
Length=81

 Score = 95.9 bits (237),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|ACG80523.1| histone 3 [Paraleptophlebia vaciva]
Length=111

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_007177425.1| PREDICTED: histone H3.1-like isoform X1 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007471302.1| PREDICTED: histone H3.1-like isoform X1 [Lipotes vexillifer]
Length=150

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +3

Query  51   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            ++ MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  12   VLVMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  63



>ref|XP_004432230.1| PREDICTED: uncharacterized protein LOC101398437 [Ceratotherium 
simum simum]
Length=387

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  15   NFCNLYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG  194
            N+C    +  L  + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPG
Sbjct  237  NWCASISELCLQPLVMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG  296

Query  195  TVAL  206
            TVAL
Sbjct  297  TVAL  300


 Score = 96.7 bits (239),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABV02068.1| histone H3 [Dunaliella salina]
Length=110

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABR67505.1| histone H3 [Acanthops sp. MN112]
 gb|AFD02121.1| histone H3, partial [Orconectes rusticus]
 gb|AIE41522.1| histone H3, partial [Conchodytes meleagrinae]
 gb|AIE41523.1| histone H3, partial [Coralliocaris graminea]
 gb|AIE41529.1| histone H3, partial [Harpiliopsis spinigera]
 gb|AIE41530.1| histone H3, partial [Harpilius lutescens]
 gb|AIE41531.1| histone H3, partial [Ischnopontonia lophos]
 gb|AIE41537.1| histone H3, partial [Periclimenaeus gorgonidarum]
 gb|AIE41542.1| histone H3, partial [Zenopontonia soror]
Length=118

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_009017710.1| hypothetical protein HELRODRAFT_79262, partial [Helobdella robusta]
 gb|ESO04441.1| hypothetical protein HELRODRAFT_79262, partial [Helobdella robusta]
Length=117

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_002928569.2| PREDICTED: histone H3.1-like [Ailuropoda melanoleuca]
Length=176

 Score = 98.2 bits (243),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  45   LSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            L    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  36   LQFFQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  89



>gb|ADV77204.1| histone H3, partial [Ignatius tetrasporus]
Length=122

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_010830602.1| PREDICTED: histone H3.1 [Bison bison bison]
Length=246

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  27   LYIQFELSIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            L +Q     V MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  100  LELQQFFGFVVMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  159



>gb|ADH95984.1| histone 3 [Callobius bennetti]
Length=115

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ADZ49070.1| histone H3, partial [Ulvella repens]
Length=119

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_003630193.1| Histone H3 [Medicago truncatula]
 ref|XP_003630195.1| Histone H3 [Medicago truncatula]
Length=213

 Score = 99.0 bits (245),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|AIN56048.1| histone H3, partial [Paragoniastrea australensis]
 gb|AIN56101.1| histone H3, partial [Goniastrea retiformis]
 gb|AIN56111.1| histone H3, partial [Goniastrea retiformis]
Length=121

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AAW48017.1| histone 3 [Irdex sp. 2 DM56]
Length=125

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_008585856.1| PREDICTED: histone H3.1-like [Galeopterus variegatus]
Length=115

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AGT20422.1| histone H3, partial [Conothele sp. MY2070]
Length=122

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  4    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  52



>gb|ABR67490.1| histone H3 [Thrinaconyx fumosus]
 gb|AEK26323.1| histone H3 [Mimachlamys asperrima]
 gb|AHE81418.1| histone H3, partial [Cryptonatica affinis]
Length=121

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ACD37543.1| histone H3 [Adineta vaga]
 gb|ACD37558.1| histone H3 [Adineta vaga]
 gb|ACF75484.1| histone H3 [Adineta vaga]
 gb|ACF75493.1| histone H3 [Adineta vaga]
Length=136

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGG+KKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGIKKPHRFRPGTVAL  49



>gb|AGM53633.1| histone H3, partial [Orcula dolium]
Length=115

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AGM53552.1| histone H3, partial [Orcula dolium]
Length=115

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABR67500.1| histone H3 [Amorphoscelis borneana]
 gb|ACG80494.1| histone 3 [Arachnocolus phillipsi]
 gb|ACG80516.1| histone 3 [Leptophlebia johnsoni]
 gb|ACG80528.1| histone 3 [Habrophlebia vibrans]
 gb|AEK26358.1| histone H3 [Excellichlamys spectabilis]
 gb|AEK26364.1| histone H3 [Anguipecten picturatus]
Length=117

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ACG80534.1| histone 3 [Euthraulus elegans]
 emb|CAP53842.1| histone H3, partial [Xenoturbella bocki]
 emb|CAP53860.1| histone H3, partial [Xenoturbella bocki]
 emb|CAP53861.1| histone H3, partial [Xenoturbella bocki]
 emb|CAP53866.1| histone H3, partial [Xenoturbella bocki]
 emb|CAP53867.1| histone H3, partial [Xenoturbella bocki]
 emb|CAP53874.1| histone H3, partial [Xenoturbella bocki]
 gb|AHZ58410.1| histone H3, partial [Alitta virens]
Length=90

 Score = 95.9 bits (237),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIF33248.1| histone H3, partial [Taaningichthys bathyphilus]
Length=124

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIM45540.1| histone H3, partial [Botryllus schlosseri]
Length=128

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHZ58409.1| histone H3, partial [Alitta virens]
Length=92

 Score = 95.9 bits (237),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ACG80532.1| histone 3 [Neochoroterpes nanita]
Length=117

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AAY98294.1| histone H3 [Attenella margarita]
Length=124

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_005063136.1| PREDICTED: histone H3, embryonic-like, partial [Ficedula albicollis]
 ref|XP_009287484.1| PREDICTED: histone H3, embryonic-like, partial [Aptenodytes forsteri]
 ref|XP_009584574.1| PREDICTED: histone H3, embryonic, partial [Fulmarus glacialis]
 ref|XP_009686075.1| PREDICTED: histone H3, embryonic-like, partial [Struthio camelus 
australis]
Length=66

 Score = 95.1 bits (235),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AGM53512.1| histone H3, partial [Orcula dolium]
 gb|AGM53514.1| histone H3, partial [Orcula dolium]
 gb|AGM53516.1| histone H3, partial [Orcula dolium]
 gb|AGM53518.1| histone H3, partial [Orcula dolium]
 gb|AGM53520.1| histone H3, partial [Orcula dolium]
 gb|AGM53522.1| histone H3, partial [Orcula dolium]
 gb|AGM53524.1| histone H3, partial [Orcula dolium]
 gb|AGM53526.1| histone H3, partial [Orcula dolium]
 gb|AGM53528.1| histone H3, partial [Orcula dolium]
 gb|AGM53530.1| histone H3, partial [Orcula dolium]
 gb|AGM53532.1| histone H3, partial [Orcula dolium]
 gb|AGM53534.1| histone H3, partial [Orcula dolium]
 gb|AGM53536.1| histone H3, partial [Orcula dolium]
 gb|AGM53538.1| histone H3, partial [Orcula dolium]
 gb|AGM53540.1| histone H3, partial [Orcula dolium]
 gb|AGM53542.1| histone H3, partial [Orcula dolium]
 gb|AGM53544.1| histone H3, partial [Orcula dolium]
 gb|AGM53546.1| histone H3, partial [Orcula dolium]
 gb|AGM53548.1| histone H3, partial [Orcula dolium]
 gb|AGM53550.1| histone H3, partial [Orcula dolium]
 gb|AGM53554.1| histone H3, partial [Orcula dolium]
 gb|AGM53556.1| histone H3, partial [Orcula dolium]
 gb|AGM53558.1| histone H3, partial [Orcula dolium]
 gb|AGM53559.1| histone H3, partial [Orcula dolium]
 gb|AGM53561.1| histone H3, partial [Orcula dolium]
 gb|AGM53563.1| histone H3, partial [Orcula dolium]
 gb|AGM53565.1| histone H3, partial [Orcula dolium]
 gb|AGM53567.1| histone H3, partial [Orcula dolium]
 gb|AGM53569.1| histone H3, partial [Orcula dolium]
 gb|AGM53571.1| histone H3, partial [Orcula dolium]
 gb|AGM53573.1| histone H3, partial [Orcula dolium]
 gb|AGM53575.1| histone H3, partial [Orcula dolium]
 gb|AGM53579.1| histone H3, partial [Orcula dolium]
 gb|AGM53581.1| histone H3, partial [Orcula dolium]
 gb|AGM53583.1| histone H3, partial [Orcula dolium]
 gb|AGM53585.1| histone H3, partial [Orcula dolium]
 gb|AGM53591.1| histone H3, partial [Orcula dolium]
 gb|AGM53593.1| histone H3, partial [Orcula dolium]
 gb|AGM53595.1| histone H3, partial [Orcula dolium]
 gb|AGM53597.1| histone H3, partial [Orcula dolium]
 gb|AGM53599.1| histone H3, partial [Orcula dolium]
 gb|AGM53601.1| histone H3, partial [Orcula dolium]
 gb|AGM53603.1| histone H3, partial [Orcula dolium]
 gb|AGM53605.1| histone H3, partial [Orcula dolium]
 gb|AGM53607.1| histone H3, partial [Orcula dolium]
 gb|AGM53609.1| histone H3, partial [Orcula dolium]
 gb|AGM53611.1| histone H3, partial [Orcula dolium]
 gb|AGM53613.1| histone H3, partial [Orcula dolium]
 gb|AGM53615.1| histone H3, partial [Orcula dolium]
 gb|AGM53619.1| histone H3, partial [Orcula dolium]
 gb|AGM53621.1| histone H3, partial [Orcula dolium]
 gb|AGM53623.1| histone H3, partial [Orcula dolium]
 gb|AGM53625.1| histone H3, partial [Orcula dolium]
 gb|AGM53627.1| histone H3, partial [Orcula dolium]
 gb|AGM53629.1| histone H3, partial [Orcula dolium]
 gb|AGM53631.1| histone H3, partial [Orcula dolium]
 gb|AGM53639.1| histone H3, partial [Orcula dolium]
 gb|AGM53641.1| histone H3, partial [Orcula dolium]
 gb|AGM53643.1| histone H3, partial [Orcula dolium]
 gb|AIT12907.1| histone H3, partial [Orcula jetschini]
 gb|AIT12909.1| histone H3, partial [Orcula jetschini]
 gb|AIT12911.1| histone H3, partial [Orcula gularis]
 gb|AIT12913.1| histone H3, partial [Orcula gularis]
 gb|AIT12915.1| histone H3, partial [Orcula gularis]
 gb|AIT12917.1| histone H3, partial [Orcula gularis]
 gb|AIT12919.1| histone H3, partial [Orcula gularis]
 gb|AIT12921.1| histone H3, partial [Orcula gularis]
 gb|AIT12923.1| histone H3, partial [Orcula gularis]
 gb|AIT12925.1| histone H3, partial [Orcula sp. AL1393]
 gb|AIT12927.1| histone H3, partial [Orcula sp. AL1394]
 gb|AIT12929.1| histone H3, partial [Orcula austriaca]
 gb|AIT12931.1| histone H3, partial [Orcula austriaca]
 gb|AIT12933.1| histone H3, partial [Orcula austriaca]
 gb|AIT12935.1| histone H3, partial [Orcula restituta]
 gb|AIT12937.1| histone H3, partial [Orcula tolminensis]
 gb|AIT12939.1| histone H3, partial [Orcula austriaca]
 gb|AIT12941.1| histone H3, partial [Orcula tolminensis]
 gb|AIT12943.1| histone H3, partial [Orcula conica]
 gb|AIT12945.1| histone H3, partial [Orcula conica]
 gb|AIT12947.1| histone H3, partial [Orcula austriaca]
 gb|AIT12949.1| histone H3, partial [Orcula conica]
 gb|AIT12951.1| histone H3, partial [Orcula fuchsi]
 gb|AIT12953.1| histone H3, partial [Orcula austriaca]
 gb|AIT12955.1| histone H3, partial [Orcula fuchsi]
 gb|AIT12957.1| histone H3, partial [Orcula austriaca]
 gb|AIT12959.1| histone H3, partial [Orcula pseudodolium]
 gb|AIT12961.1| histone H3, partial [Orcula pseudodolium]
 gb|AIT12963.1| histone H3, partial [Orcula pseudodolium]
 gb|AIT12965.1| histone H3, partial [Orcula pseudodolium]
 gb|AIT12967.1| histone H3, partial [Orcula pseudodolium]
 gb|AIT12969.1| histone H3, partial [Orcula pseudodolium]
 gb|AIT12971.1| histone H3, partial [Orcula pseudodolium]
 gb|AIT12973.1| histone H3, partial [Orcula pseudodolium]
 gb|AIT12975.1| histone H3, partial [Orcula pseudodolium]
 gb|AIT12977.1| histone H3, partial [Orcula sp. AL3543]
 gb|AIT12979.1| histone H3, partial [Orcula sp. AL3544]
 gb|AIT12981.1| histone H3, partial [Orcula sp. AL3538]
 gb|AIT12985.1| histone H3, partial [Orcula austriaca]
 gb|AIT12987.1| histone H3, partial [Orcula restituta]
 gb|AIT12991.1| histone H3, partial [Orcula zilchi]
 gb|AIT12993.1| histone H3, partial [Orcula zilchi]
 gb|AIT12995.1| histone H3, partial [Orcula zilchi]
 gb|AIT12997.1| histone H3, partial [Orcula gularis]
 gb|AIT13001.1| histone H3, partial [Orcula sp. AL3542]
 gb|AIT13003.1| histone H3, partial [Orcula sp. AL7138]
 gb|AIT13005.1| histone H3, partial [Orcula sp. AL7139]
 gb|AIT13007.1| histone H3, partial [Orcula gularis]
 gb|AIT13009.1| histone H3, partial [Orcula spoliata]
 gb|AIT13011.1| histone H3, partial [Orcula spoliata]
Length=115

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_002045548.1| GM18817 [Drosophila sechellia]
 gb|EDW51645.1| GM18817 [Drosophila sechellia]
Length=71

 Score = 95.5 bits (236),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIF33126.1| histone H3, partial [Diaphus perspicillatus]
Length=116

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_002731485.1| PREDICTED: histone H3-like, partial [Saccoglossus kowalevskii]
 gb|ACG80496.1| histone 3 [Austroclima jollyae]
 gb|ACG80504.1| histone 3 [Meridialaris diguillina]
 gb|ACG80505.1| histone 3 [Meridialaris laminata]
 gb|ACG80506.1| histone 3 [Neozephlebia scita]
 gb|ACG80520.1| histone 3 [Paraleptophlebia heteronea]
 gb|ACP74174.1| histone H3, partial [Bellamya trochlearis]
Length=116

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AAX92952.1| histone H3 - maize [Oryza sativa Japonica Group]
Length=168

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|AAY98302.1| histone H3 [Stygifloris sp. EP141]
 gb|AAY98304.1| histone H3 [Rhoenanthus sp. EP143]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABX71430.1| histone H3, partial [Isogenoides olivaceus]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABR67468.1| histone H3 [Oligonicella scudderi]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHZ58402.1| histone H3, partial [Acanthonotozoma inflatum]
Length=112

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABX71359.1| histone H3, partial [Crypturoperla paradoxa]
Length=126

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_002733098.1| PREDICTED: histone H3-like, partial [Saccoglossus kowalevskii]
Length=116

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|KFW88175.1| Histone H3, partial [Manacus vitellinus]
Length=120

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHV90958.1| histone H3, partial [Folsomia quadrioculata]
Length=124

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ADV77191.1| histone H3, partial [Bolbocoleon piliferum]
 gb|ADV77203.1| histone H3, partial [Halochlorococcum tenue]
Length=122

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIN56127.1| histone H3, partial [Merulina scabricula]
 gb|AIN56128.1| histone H3, partial [Merulina scabricula]
 gb|AIN56129.1| histone H3, partial [Merulina scabricula]
 gb|AIN56131.1| histone H3, partial [Merulina scabricula]
Length=120

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ADX77799.1| histone H3, partial [Favia favus]
 gb|ADX77804.1| histone H3, partial [Favia lizardensis]
 gb|ADX77812.1| histone H3, partial [Favia cf. maxima DH-2011]
 gb|ADX77818.1| histone H3, partial [Favia rotundata]
 gb|ADX77827.1| histone H3, partial [Favites flexuosa]
 gb|ADX77831.1| histone H3, partial [Favites pentagona]
 gb|ADX77847.1| histone H3, partial [Goniastrea retiformis]
 gb|ADX77848.1| histone H3, partial [Hydnophora exesa]
 gb|ADX77849.1| histone H3, partial [Hydnophora microconos]
 gb|ADX77853.1| histone H3, partial [Merulina ampliata]
 gb|ADX77857.1| histone H3, partial [Montastraea cf. annuligera DH-2011]
 gb|ADX77858.1| histone H3, partial [Phymastrea colemani]
 gb|ADX77868.1| histone H3, partial [Phymastrea valenciennesi]
 gb|ADX77876.1| histone H3, partial [Pectinia alcicornis]
 gb|ADX77879.1| histone H3, partial [Pectinia paeonia]
 gb|ADX77880.1| histone H3, partial [Platygyra acuta]
 gb|ADX77888.1| histone H3, partial [Platygyra ryukyuensis]
 gb|ADX77890.1| histone H3, partial [Platygyra sinensis]
 gb|AIN56057.1| histone H3, partial [Goniastrea edwardsi]
 gb|AIN56058.1| histone H3, partial [Goniastrea edwardsi]
 gb|AIN56059.1| histone H3, partial [Goniastrea edwardsi]
 gb|AIN56060.1| histone H3, partial [Goniastrea edwardsi]
 gb|AIN56069.1| histone H3, partial [Goniastrea edwardsi]
 gb|AIN56071.1| histone H3, partial [Goniastrea edwardsi]
 gb|AIN56072.1| histone H3, partial [Goniastrea favulus]
 gb|AIN56073.1| histone H3, partial [Goniastrea favulus]
 gb|AIN56075.1| histone H3, partial [Goniastrea favulus]
 gb|AIN56076.1| histone H3, partial [Goniastrea favulus]
 gb|AIN56077.1| histone H3, partial [Goniastrea favulus]
 gb|AIN56078.1| histone H3, partial [Goniastrea favulus]
 gb|AIN56079.1| histone H3, partial [Goniastrea favulus]
 gb|AIN56084.1| histone H3, partial [Goniastrea minuta]
 gb|AIN56088.1| histone H3, partial [Goniastrea pectinata]
 gb|AIN56089.1| histone H3, partial [Goniastrea pectinata]
 gb|AIN56102.1| histone H3, partial [Goniastrea retiformis]
 gb|AIN56105.1| histone H3, partial [Goniastrea retiformis]
 gb|AIN56106.1| histone H3, partial [Goniastrea retiformis]
 gb|AIN56113.1| histone H3, partial [Goniastrea retiformis]
 gb|AIN56116.1| histone H3, partial [Goniastrea stelligera]
 gb|AIN56117.1| histone H3, partial [Goniastrea stelligera]
 gb|AIN56121.1| histone H3, partial [Merulina ampliata]
 gb|AIN56124.1| histone H3, partial [Merulina ampliata]
 gb|AIN56125.1| histone H3, partial [Merulina ampliata]
 gb|AIN56134.1| histone H3, partial [Merulina scabricula]
 gb|AIN56135.1| histone H3, partial [Merulina scheeri]
 gb|AIN56137.1| histone H3, partial [Merulina scheeri]
 gb|AIN56145.1| histone H3, partial [Scapophyllia cylindrica]
Length=119

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|KIY70680.1| histone 3 [Cylindrobasidium torrendii FP15055 ss-10]
Length=136

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARK+APATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKTAPATGGVKKPHRFRPGTVAL  49



>emb|CBY05454.1| histone 3 [Antiporus hollingsworthi]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHZ58404.1| histone H3, partial [Aglantha digitale]
Length=115

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  4    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  52



>gb|ADV77215.1| histone H3, partial [Ulva intestinalis]
 gb|ADV77216.1| histone H3, partial [Ulva sp. EE2]
Length=122

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ACD37575.1| histone H3 [Philodina roseola]
 gb|ACD37586.1| histone H3 [Philodina roseola]
 gb|ACF75501.1| histone H3 [Philodina roseola]
 gb|ACF75519.1| histone H3 [Philodina roseola]
Length=136

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGG+KKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGIKKPHRFRPGTVAL  49



>ref|XP_008930489.1| PREDICTED: histone H3, partial [Manacus vitellinus]
 gb|ADU18166.1| histone H3 [Lumbrineris zonata]
 gb|AEA73449.1| histone H3, partial [Novafabricia sp. Australia DH-2011]
 gb|AGB34243.1| histone H3, partial [Macromia illinoiensis]
Length=119

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABR67515.1| histone H3 [Coptopteryx sp. MN136]
Length=119

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIF33194.1| histone H3, partial [Lepidophanes guentheri]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIF33080.1| histone H3, partial [Benthosema fibulatum]
 gb|AIF33083.1| histone H3, partial [Benthosema pterotum]
 gb|AIF33094.1| histone H3, partial [Centrobranchus cf. brevirostris AMNH 261206]
 gb|AIF33100.1| histone H3, partial [Ceratoscopelus warmingii]
 gb|AIF33101.1| histone H3, partial [Ceratoscopelus warmingii]
 gb|AIF33102.1| histone H3, partial [Ceratoscopelus warmingii]
 gb|AIF33104.1| histone H3, partial [Diaphus aliciae]
 gb|AIF33105.1| histone H3, partial [Diaphus anderseni]
 gb|AIF33106.1| histone H3, partial [Diaphus anderseni]
 gb|AIF33107.1| histone H3, partial [Diaphus antonbruuni]
 gb|AIF33108.1| histone H3, partial [Diaphus brachycephalus]
 gb|AIF33109.1| histone H3, partial [Diaphus cf. mollis AMNH 261262]
 gb|AIF33110.1| histone H3, partial [Diaphus chrysorhynchus]
 gb|AIF33111.1| histone H3, partial [Diaphus chrysorhynchus]
 gb|AIF33113.1| histone H3, partial [Diaphus fragilis]
 gb|AIF33114.1| histone H3, partial [Diaphus fragilis]
 gb|AIF33116.1| histone H3, partial [Diaphus garmani]
 gb|AIF33117.1| histone H3, partial [Diaphus lobatus]
 gb|AIF33118.1| histone H3, partial [Diaphus malayanus]
 gb|AIF33121.1| histone H3, partial [Diaphus mollis]
 gb|AIF33122.1| histone H3, partial [Diaphus nielseni]
 gb|AIF33123.1| histone H3, partial [Diaphus parri]
 gb|AIF33124.1| histone H3, partial [Diaphus parri]
 gb|AIF33125.1| histone H3, partial [Diaphus parri]
 gb|AIF33127.1| histone H3, partial [Diaphus perspicillatus]
 gb|AIF33128.1| histone H3, partial [Diaphus perspicillatus]
 gb|AIF33129.1| histone H3, partial [Diaphus phillipsi]
 gb|AIF33130.1| histone H3, partial [Diaphus regani]
 gb|AIF33131.1| histone H3, partial [Diaphus schmidti]
 gb|AIF33132.1| histone H3, partial [Diaphus signatus]
 gb|AIF33133.1| histone H3, partial [Diaphus sp. AMNH 261198]
 gb|AIF33134.1| histone H3, partial [Diaphus sp. AMNH 261125]
 gb|AIF33135.1| histone H3, partial [Diaphus sp. AMNH 33211]
 gb|AIF33137.1| histone H3, partial [Diaphus splendidus]
 gb|AIF33138.1| histone H3, partial [Diaphus suborbitalis]
 gb|AIF33139.1| histone H3, partial [Diaphus suborbitalis]
 gb|AIF33140.1| histone H3, partial [Diaphus termophilus]
 gb|AIF33141.1| histone H3, partial [Diaphus theta]
 gb|AIF33142.1| histone H3, partial [Diaphus theta]
 gb|AIF33144.1| histone H3, partial [Diaphus umbroculus]
 gb|AIF33147.1| histone H3, partial [Diaphus whitleyi]
 gb|AIF33149.1| histone H3, partial [Diogenichthys atlanticus]
 gb|AIF33152.1| histone H3, partial [Electrona carlsbergi]
 gb|AIF33153.1| histone H3, partial [Electrona paucirastra]
 gb|AIF33155.1| histone H3, partial [Electrona risso]
 gb|AIF33164.1| histone H3, partial [Hygophum hanseni]
 gb|AIF33170.1| histone H3, partial [Lampadena luminosa]
 gb|AIF33171.1| histone H3, partial [Lampadena luminosa]
 gb|AIF33172.1| histone H3, partial [Lampadena luminosa]
 gb|AIF33180.1| histone H3, partial [Lampanyctus alatus]
 gb|AIF33181.1| histone H3, partial [Lampanyctus festivus]
 gb|AIF33182.1| histone H3, partial [Lampanyctus festivus]
 gb|AIF33186.1| histone H3, partial [Lampanyctus macdonaldi]
 gb|AIF33187.1| histone H3, partial [Lampanyctus parvicauda]
 gb|AIF33190.1| histone H3, partial [Lampanyctus turneri]
 gb|AIF33191.1| histone H3, partial [Lampanyctus vadulus]
 gb|AIF33198.1| histone H3, partial [Loweina rara]
 gb|AIF33208.1| histone H3, partial [Myctophum orientale]
 gb|AIF33210.1| histone H3, partial [Myctophum punctatum]
 gb|AIF33214.1| histone H3, partial [Myctophum spinosum]
 gb|AIF33215.1| histone H3, partial [Myctophum spinosum]
 gb|AIF33218.1| histone H3, partial [Nannobrachium bristori]
 gb|AIF33219.1| histone H3, partial [Nannobrachium fernae]
 gb|AIF33220.1| histone H3, partial [Nannobrachium hawaiiensis]
 gb|AIF33221.1| histone H3, partial [Nannobrachium hawaiiensis]
 gb|AIF33222.1| histone H3, partial [Nannobrachium hawaiiensis]
 gb|AIF33230.1| histone H3, partial [Notolychnus valdiviae]
 gb|AIF33233.1| histone H3, partial [Protomyctophum andriashevi]
 gb|AIF33234.1| histone H3, partial [Protomyctophum bolini]
 gb|AIF33235.1| histone H3, partial [Protomyctophum crockeri]
 gb|AIF33236.1| histone H3, partial [Protomyctophum parallelum]
 gb|AIF33243.1| histone H3, partial [Symbolophorus californiensis]
 gb|AIF33244.1| histone H3, partial [Symbolophorus californiensis]
 gb|AIF33253.1| histone H3, partial [Triphoturus nigrescens]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AAW48003.1| histone 3 [Thekalabis sp. DM16]
 gb|AAW48004.1| histone 3 [Euborellia femoralis]
 gb|AAW48005.1| histone 3 [Forcipula decolyi]
 gb|AAW48006.1| histone 3 [Anisolabididae sp. DM22]
 gb|AAW48007.1| histone 3 [Auchenomus forcipatus]
 gb|AAW48009.1| histone 3 [Anisolabididae sp. DM26]
 gb|AAW48011.1| histone 3 [Nala tenuicornis]
 gb|AAW48012.1| histone 3 [Auchenomus sp. DM48]
 gb|AAW48018.1| histone 3 [Galloisiana sp. GB13.1]
 gb|AAW48019.1| histone 3 [Grylloblattina djakonovi]
 gb|AAX52091.1| histone H3 [Haliotis jacnensis]
 gb|AAX52092.1| histone H3 [Haliotis asinina]
 gb|AAX52093.1| histone H3 [Haliotis pustulata]
 gb|AAX52094.1| histone H3 [Haliotis virginea]
 gb|AAX52096.1| histone H3 [Haliotis midae]
 gb|AAX52098.1| histone H3 [Lepetodrilus elevatus]
 gb|AAX52099.1| histone H3 [Lepetodrilus pustulosus]
 gb|AAX52102.1| histone H3 [Nerita polita]
 gb|AAX52104.1| histone H3 [Perotrochus amabilis]
 gb|AAX52106.1| histone H3 [Peltospira delicata]
 gb|AAX52107.1| histone H3 [Rhynchopelta sp. CET-2005]
 gb|AAX52114.1| histone H3 [Stomatella sp. CET-2005]
 gb|AAX52115.1| histone H3 [Tectus niloticus]
 gb|AAX52118.1| histone H3 [Tegula eiseni]
 gb|AAX52119.1| histone H3 [Megastraea undosa]
 gb|AAX52120.1| histone H3 [Turbo setosus]
 gb|AAY98261.1| histone H3 [Drunella doddsi]
 gb|AAY98263.1| histone H3 [Ephemerella sp. EP008]
 gb|AAY98264.1| histone H3 [Paraleptophlebia vaciva]
 gb|AAY98265.1| histone H3 [Thraulodes sp. EP014]
 gb|AAY98267.1| histone H3 [Rhithrogena sp. EP021]
 gb|AAY98268.1| histone H3 [Choroterpes sp. EP024]
 gb|AAY98270.1| histone H3 [Leptophlebiidae sp. EP030]
 gb|AAY98271.1| histone H3 [Baetis tricaudatus]
 gb|AAY98272.1| histone H3 [Mystaxiops venatoris]
 gb|AAY98273.1| histone H3 [Centroptilum luteolum]
 gb|AAY98274.1| histone H3 [Ecdyonurus dispar]
 gb|AAY98275.1| histone H3 [Euthyplocia hecuba]
 gb|AAY98276.1| histone H3 [Penaphlebia sp. EP076]
 gb|AAY98278.1| histone H3 [Metamonius sp. EP079]
 gb|AAY98286.1| histone H3 [Siphlaenigma janae]
 gb|AAY98287.1| histone H3 [Nesameletus ornatus]
 gb|AAY98288.1| histone H3 [Rallidens mcfarlanei]
 gb|AAY98292.1| histone H3 [Edmundsius agilis]
 gb|AAY98293.1| histone H3 [Cinygma sp. EP123]
 gb|AAY98299.1| histone H3 [Atopopus sp. EP134]
 gb|AAY98300.1| histone H3 [Platybaetis probus]
 gb|AAY98301.1| histone H3 [Jubabaetis sp. EP139]
 gb|AAY98305.1| histone H3 [Hyrtanella sp. EP144]
 gb|AAY98306.1| histone H3 [Ichthybotus hudsoni]
 gb|AAY98307.1| histone H3 [Dipteromimus sp. EP150]
 gb|ABB85254.1| histone 3 [Acilius abbreviatus]
 gb|ABB85255.1| histone 3 [Acilius athabascae]
 gb|ABB85256.1| histone 3 [Acilius canaliculatus]
 gb|ABB85257.1| histone 3 [Acilius confusus]
 gb|ABB85258.1| histone 3 [Acilius duvergeri]
 gb|ABB85260.1| histone 3 [Graphoderus fascicollis]
 gb|ABB85261.1| histone 3 [Graphoderus zonatus]
 gb|ABB85262.1| histone 3 [Acilius japonicus]
 gb|ABB85263.1| histone 3 [Acilius kishii]
 gb|ABB85264.1| histone 3 [Acilius mediatus]
 gb|ABB85265.1| histone 3 [Acilius semisulcatus]
 gb|ABB85266.1| histone 3 [Acilius sulcatus]
 gb|ABR67473.1| histone H3 [Ephestiasula sp. MN063]
 gb|ABR67474.1| histone H3 [Eremiaphila rotundipennis]
 gb|ABR67475.1| histone H3 [Schizocephala bicornis]
 gb|ABR67476.1| histone H3 [Deiphobella laticeps]
 gb|ABR67477.1| histone H3 [Toxoderopsis taurus]
 gb|ABR67480.1| histone H3 [Elmantis trincomaliae]
 gb|ABR67481.1| histone H3 [Creobroter apicalis]
 gb|ABR67484.1| histone H3 [Phyllothelys westwoodi]
 gb|ABR67485.1| histone H3 [Euantissa pulchra]
 gb|ABR67487.1| histone H3 [Acromantis montana]
 gb|ABR67488.1| histone H3 [Amantis biroi]
 gb|ABR67489.1| histone H3 [Austrovates variegata]
 gb|ABR67491.1| histone H3 [Didymocorypha lanceolata]
 gb|ABR67492.1| histone H3 [Dysaules himalayanus]
 gb|ABR67493.1| histone H3 [Stenotoxodera porioni]
 gb|ABR67495.1| histone H3 [Gonypeta borneana]
 gb|ABR67497.1| histone H3 [Xanthomantis sp. MN099]
 gb|ABR67498.1| histone H3 [Phyllothelys sp. MN101]
 gb|ABR67499.1| histone H3 [Citharomantis falcata]
 gb|ABR67501.1| histone H3 [Sceptuchus simplex]
 gb|ABR67502.1| histone H3 [Rhomantis sp. MN106]
 gb|ABR67503.1| histone H3 [Leptomantella sp. MN108]
 gb|ABR67506.1| histone H3 [Pseudomiopteryx sp. MN114]
 gb|ABR67509.1| histone H3 [Thesprotiella sp. MN121]
 gb|ABR67510.1| histone H3 [Eumusonia livida]
 gb|ABR67511.1| histone H3 [Brunneria sp. MN124]
 gb|ABR67513.1| histone H3 [Empusa guttula]
 gb|ABR67514.1| histone H3 [Popa spurca]
 gb|ABR67517.1| histone H3 [Macromantis nicaraguae]
 gb|ABR67518.1| histone H3 [Liturgusa maya]
 gb|ABR67519.1| histone H3 [Metilia brunnerii]
 gb|ABR67520.1| histone H3 [Antemna rapax]
 gb|ABR67522.1| histone H3 [Parastagmatoptera sp. MN151]
 gb|ABR67523.1| histone H3 [Oromantis sp. MN152]
 gb|ABR67525.1| histone H3 [Otomantis sp. MN161]
 gb|ABR67526.1| histone H3 [Taumantis sigiana]
 gb|ABR67527.1| histone H3 [Theopropus elegans]
 gb|ABR67528.1| histone H3 [Polyspilota aeruginosa]
 gb|ABR67532.1| histone H3 [Raptrix perspicua]
 gb|ABR67533.1| histone H3 [Cardioptera squalodon]
 gb|ABR67539.1| histone H3 [Iris oratoria]
 gb|ABR67540.1| histone H3 [Parasphendale sp. MN195]
 gb|ABR67541.1| histone H3 [Dystactula grisea]
 gb|ABR67546.1| histone H3 [Heterochaetula fissispinis]
 gb|ABR67547.1| histone H3 [Eomantis iridipennis]
 gb|ABR67556.1| histone H3 [Hyalomantis sp. MN220]
 gb|ABR67557.1| histone H3 [Pyrgomantis jonesi]
 gb|ABR67558.1| histone H3 [Chrysomantis cachani]
 gb|ABR67561.1| histone H3 [Miomantis aurea]
 gb|ABR67562.1| histone H3 [Congoharpax aberrans]
 gb|ABR67563.1| histone H3 [Theopompella chopardi]
 gb|ABR67568.1| histone H3 [Tarachina occidentalis]
 gb|ABR67569.1| histone H3 [Tarachodes afzelii]
 gb|ABR67571.1| histone H3 [Anasigerpes bifasciata]
 gb|ABR67573.1| histone H3 [Paragalepsus toganus]
 gb|ABR67576.1| histone H3 [Calofulcinia sp. MN251]
 gb|ABR67577.1| histone H3 [Eumionyx sp. MN252]
 gb|ABR67579.1| histone H3 [Galepsus sp. MN259]
 gb|ABV00897.1| histone H3 [Isogenoides varians]
 gb|ABV00899.1| histone H3 [Isogenoides elongatus]
 gb|ABV00900.1| histone H3 [Isogenoides colubrinus]
 gb|ABV00901.1| histone H3 [Isogenoides doratus]
 gb|ABX71362.1| histone H3, partial [Paracapnia opis]
 gb|ABX71363.1| histone H3, partial [Allocapnia minima]
 gb|ABX71364.1| histone H3, partial [Bolshecapnia sp. BYU_PL183]
 gb|ABX71365.1| histone H3, partial [Isocapnia hyalita]
 gb|ABX71368.1| histone H3, partial [Paraperla frontalis]
 gb|ABX71369.1| histone H3, partial [Chloroperla tripunctata]
 gb|ABX71370.1| histone H3, partial [Neaviperla forcipata]
 gb|ABX71371.1| histone H3, partial [Utaperla sopladora]
 gb|ABX71372.1| histone H3, partial [Alloperla severa]
 gb|ABX71375.1| histone H3, partial [Cosmioperla australis]
 gb|ABX71377.1| histone H3, partial [Zelandoperla agnetis]
 gb|ABX71381.1| histone H3, partial [Newmanoperla exigua]
 gb|ABX71384.1| histone H3, partial [Dinotoperla serricauda]
 gb|ABX71387.1| histone H3, partial [Rhithroperla sp. BYU_PL167]
 gb|ABX71388.1| histone H3, partial [Riekoperla triloba]
 gb|ABX71389.1| histone H3, partial [Paraleuctra vershina]
 gb|ABX71392.1| histone H3, partial [Leuctra inermis]
 gb|ABX71393.1| histone H3, partial [Despaxia augusta]
 gb|ABX71394.1| histone H3, partial [Paraleuctra occidentalis]
 gb|ABX71395.1| histone H3, partial [Perlomyia utahensis]
 gb|ABX71396.1| histone H3, partial [Zealeuctra arnoldi]
 gb|ABX71397.1| histone H3, partial [Calileuctra ephemera]
 gb|ABX71398.1| histone H3, partial [Zapada cinctipes]
 gb|ABX71400.1| histone H3, partial [Visoka cataractae]
 gb|ABX71401.1| histone H3, partial [Nemurella pictetii]
 gb|ABX71402.1| histone H3, partial [Protonemura meyeri]
 gb|ABX71404.1| histone H3, partial [Amphinemura sulcicollis]
 gb|ABX71405.1| histone H3, partial [Soyedina producta]
 gb|ABX71409.1| histone H3, partial [Cristaperla waharoa]
 gb|ABX71410.1| histone H3, partial [Austrocercella sp. BYU_PL104]
 gb|ABX71416.1| histone H3, partial [Neonemura sp. BYU_PL153]
 gb|ABX71417.1| histone H3, partial [Austrocerca rieka]
 gb|ABX71423.1| histone H3, partial [Setvena wahkeena]
 gb|ABX71424.1| histone H3, partial [Kogotus nonus]
 gb|ABX71427.1| histone H3, partial [Isoperla oxylepis]
 gb|ABX71428.1| histone H3, partial [Salmoperla sylvanica]
 gb|ABX71431.1| histone H3, partial [Cascadoperla trictura]
 gb|ABX71433.1| histone H3, partial [Helopicus bogaloosa]
 gb|ABX71434.1| histone H3, partial [Susulus venastus]
 gb|ABX71435.1| histone H3, partial [Baumanella alameda]
 gb|ABX71436.1| histone H3, partial [Hesperoperla pacifica]
 gb|ABX71439.1| histone H3, partial [Perlesta decipines]
 gb|ABX71440.1| histone H3, partial [Doroneuria baumanni]
 gb|ABX71442.1| histone H3, partial [Inconeuria sp. BYU_PL154]
 gb|ABX71443.1| histone H3, partial [Kempnyella sp. BYU_PL155]
 gb|ABX71444.1| histone H3, partial [Pictetoperla sp. BYU_PL156]
 gb|ABX71445.1| histone H3, partial [Beloneuria stewarti]
 gb|ABX71446.1| histone H3, partial [Claassenia sabulosa]
 gb|ABX71448.1| histone H3, partial [Eccoptura xanthenes]
 gb|ABX71449.1| histone H3, partial [Paragnetina media]
 gb|ABX71450.1| histone H3, partial [Neoperla clymene]
 gb|ABX71453.1| histone H3, partial [Yoraperla nigrisoma]
 gb|ABX71454.1| histone H3, partial [Peltoperla arcuata]
 gb|ABX71457.1| histone H3, partial [Pteronarcys scotti]
 gb|ABX71458.1| histone H3, partial [Pteronarcys sachalina]
 gb|ABX71460.1| histone H3, partial [Brachyptera seticornis]
 gb|ABX71461.1| histone H3, partial [Bolotoperla rossi]
 gb|ABX71462.1| histone H3, partial [Taeniopteryx nivalis]
 gb|ABX71463.1| histone H3, partial [Doddsia occidentalis]
 gb|ABX71464.1| histone H3, partial [Strophopteryx appalachia]
 gb|ABZ89644.1| histone H3, partial [Bellamya rubicunda]
 gb|ABZ89646.1| histone H3, partial [Afropomus balanoideus]
 gb|ABZ89647.1| histone H3, partial [Afropomus balanoideus]
 gb|ABZ89648.1| histone H3, partial [Lanistes ellipticus]
 gb|ABZ89649.1| histone H3, partial [Lanistes nyassanus]
 gb|ABZ89651.1| histone H3, partial [Lanistes ovum]
 gb|ABZ89652.1| histone H3, partial [Lanistes varicus]
 gb|ABZ89653.1| histone H3, partial [Marisa cornuarietis]
 gb|ABZ89654.1| histone H3, partial [Pila conica]
 gb|ABZ89655.1| histone H3, partial [Pila polita]
 gb|ABZ89656.1| histone H3, partial [Pomacea bridgesi]
 gb|ABZ89658.1| histone H3, partial [Saulea vitrea]
 gb|ACP74163.1| histone H3, partial [Viviparus contectus]
 gb|ACP74164.1| histone H3, partial [Bellamya pagodiformis]
 gb|ACP74165.1| histone H3, partial [Neothauma tanganyicense]
 gb|ACP74166.1| histone H3, partial [Bellamya sp. 9 AJ-2009]
 gb|ACP74167.1| histone H3, partial [Bellamya trochlearis]
 gb|ACP74170.1| histone H3, partial [Bellamya capillata]
 gb|ACP74171.1| histone H3, partial [Bellamya capillata]
 gb|ACP74172.1| histone H3, partial [Bellamya crawshayi]
 gb|ACP74173.1| histone H3, partial [Bellamya robertsoni]
 gb|ACP74175.1| histone H3, partial [Bellamya mweruensis]
 gb|ACP74176.1| histone H3, partial [Bellamya rubicunda]
 gb|ACP74177.1| histone H3, partial [Bellamya sp. 8 AJ-2009]
 gb|ACP74178.1| histone H3, partial [Bellamya jeffreysi]
 gb|ACP74179.1| histone H3, partial [Bellamya mweruensis]
 gb|ACP74180.1| histone H3, partial [Bellamya capillata]
 gb|ACP74181.1| histone H3, partial [Bellamya sp. 1 AJ-2009]
 gb|ACP74182.1| histone H3, partial [Bellamya sp. 2 AJ-2009]
 gb|ACP74183.1| histone H3, partial [Bellamya sp. 5 AJ-2009]
 gb|ACP74184.1| histone H3, partial [Bellamya sp. 6 AJ-2009]
 gb|ACP74186.1| histone H3, partial [Bellamya jeffreysi]
 gb|ACP74187.1| histone H3, partial [Bellamya jeffreysi]
 gb|ACP74188.1| histone H3, partial [Bellamya jeffreysi]
 gb|ACP74189.1| histone H3, partial [Bellamya jeffreysi]
 gb|ACP74190.1| histone H3, partial [Larina sp. AJ-2009]
 gb|ACP74191.1| histone H3, partial [Bellamya bengalensis]
 gb|ACP74192.1| histone H3, partial [Bellamya bengalensis]
 gb|ACP74193.1| histone H3, partial [Mekongia sp. 1 AJ-2009]
 gb|ACP74194.1| histone H3, partial [Sinotaia sp. 1 AJ-2009]
 gb|ACP74195.1| histone H3, partial [Angulyagra sp. 1 AJ-2009]
 gb|ACP74196.1| histone H3, partial [Filopaludina sumatrensis peninsularis]
 gb|ACP74197.1| histone H3, partial [Taia polyzonata]
 gb|ACP74199.1| histone H3, partial [Campeloma decisum]
 gb|ACP74200.1| histone H3, partial [Viviparus ater]
 gb|ACP74201.1| histone H3, partial [Viviparidae sp. 2 AJ-2009]
 gb|ACP74202.1| histone H3, partial [Bellamya sp. china 2 AJ-2009]
 gb|ACP74203.1| histone H3, partial [Cipangopaludina japonica]
 gb|ACS12999.1| histone H3 [Stenonema sp. BYU IGCEP026]
 gb|ADU18164.1| histone H3 [Glycera tridactyla]
 gb|ADU18173.1| histone H3 [Polyphysia crassa]
 gb|ADU18174.1| histone H3 [Sternaspis fossor]
 gb|ADU18176.1| histone H3 [Travisia pupa]
 gb|ADZ56336.1| histone H3, partial [Physa sp. AJ-2011]
 gb|ADZ56337.1| histone H3, partial [Planorbarius corneus]
 gb|ADZ56338.1| histone H3, partial [Planorbella duryi]
 gb|ADZ56339.1| histone H3, partial [Indoplanorbis exustus]
 gb|ADZ56340.1| histone H3, partial [Bulinus globosus]
 gb|ADZ56341.1| histone H3, partial [Bulinus globosus]
 gb|ADZ56342.1| histone H3, partial [Bulinus globosus]
 gb|ADZ56343.1| histone H3, partial [Bulinus liratus]
 gb|ADZ56344.1| histone H3, partial [Bulinus liratus]
 gb|ADZ56345.1| histone H3, partial [Bulinus nasutus]
 gb|ADZ56346.1| histone H3, partial [Bulinus obtusispira]
 gb|ADZ56347.1| histone H3, partial [Bulinus cf. obtusispira AJ-2011]
 gb|ADZ56348.1| histone H3, partial [Bulinus sp. n. AJ-2011]
 gb|ADZ56349.1| histone H3, partial [Bulinus sp. 1 AJ-2011]
 gb|ADZ56350.1| histone H3, partial [Bulinus barthi]
 gb|ADZ56351.1| histone H3, partial [Bulinus bavayi]
 gb|ADZ56352.1| histone H3, partial [Bulinus cernicus]
 gb|ADZ56353.1| histone H3, partial [Bulinus forskalii]
 gb|ADZ56354.1| histone H3, partial [Bulinus forskalii]
 gb|ADZ56355.1| histone H3, partial [Bulinus scalaris]
 gb|ADZ56356.1| histone H3, partial [Bulinus wrighti]
 gb|ADZ56357.1| histone H3, partial [Bulinus guernei]
 gb|ADZ56358.1| histone H3, partial [Bulinus hexaploidus]
 gb|ADZ56359.1| histone H3, partial [Bulinus natalensis]
 gb|ADZ56360.1| histone H3, partial [Bulinus nyassanus]
 gb|ADZ56361.1| histone H3, partial [Bulinus permembranaceus]
 gb|ADZ56362.1| histone H3, partial [Bulinus succinoides]
 gb|ADZ56363.1| histone H3, partial [Bulinus tropicus]
 gb|ADZ56364.1| histone H3, partial [Bulinus truncatus]
 gb|ADZ56365.1| histone H3, partial [Bulinus sp. 2 AJ-2011]
 emb|CBY05436.1| histone 3 [Antiporus interrogationis]
 emb|CBY05438.1| histone 3 [Megaporus ruficeps]
 emb|CBY05439.1| histone 3, partial [Antiporus interrogationis]
 emb|CBY05441.1| histone 3 [Carabhydrus niger]
 emb|CBY05442.1| histone 3 [Antiporus bakewellii]
 emb|CBY05455.1| histone 3 [Necterosoma dispar]
 emb|CBY05456.1| histone 3 [Antiporus wilsoni]
 gb|AEK26322.1| histone H3 [Mimachlamys asperrima]
 gb|AEK26330.1| histone H3 [Talochlamys pusio]
 gb|AEK26341.1| histone H3 [Caribachlamys ornata]
 gb|AEK26342.1| histone H3, partial [Caribachlamys ornata]
 gb|AEK26361.1| histone H3 [Pascahinnites coruscans coruscans]
 gb|AEK26363.1| histone H3 [Amusium pleuronectes]
 gb|AET79399.1| histone H3, partial [Ophelina sp. pol243]
 gb|AET79400.1| histone H3, partial [Ophelina sp. pol244]
 gb|AET79405.1| histone H3, partial [Ophelina sp. pol406]
 gb|AET79406.1| histone H3, partial [Ophelina sp. pol407]
 gb|AET79407.1| histone H3, partial [Ophelina sp. pol408]
 gb|AET79408.1| histone H3, partial [Ophelina sp. pol409]
 gb|AGS12519.1| histone H3, partial [Ophryotrocha orensanzi]
 gb|AHM91948.1| histone H3, partial [Carparachne alba]
 gb|AHM91950.1| histone H3, partial [Cercetius perezi]
 gb|AHM91951.1| histone H3, partial [cf. Remmius sp. SD1107]
 gb|AHM91956.1| histone H3, partial [Eusparassus laevatus]
 gb|AHM91957.1| histone H3, partial [Eusparassus levantinus]
 gb|AHM91960.1| histone H3, partial [Eusparassus sp. SD842]
 gb|AHM91961.1| histone H3, partial [Eusparassus walckenaeri]
 gb|AHM91976.1| histone H3, partial [Pseudomicrommata sp. SD1105]
 gb|KFQ68857.1| Histone H3, partial [Phaethon lepturus]
 gb|KFV96719.1| Histone H3, partial [Eurypyga helias]
 gb|KHJ78375.1| core histone H2A/H2B/H3/H4, partial [Oesophagostomum dentatum]
 gb|AJF98702.1| histone H3, partial [Eulagisca gigantea]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHM91952.1| histone H3, partial [Eusparassus cf. doriae SD810]
 gb|AHM91958.1| histone H3, partial [Eusparassus mesopotamicus]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  2    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  50



>gb|AAB49451.1| histone H3, partial [Drosophila virilis]
Length=88

 Score = 95.9 bits (237),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHZ58427.1| histone H3, partial [Asterias rubens]
 gb|AHZ58428.1| histone H3, partial [Asterias rubens]
 gb|AHZ58429.1| histone H3, partial [Asterias rubens]
 gb|AHZ58430.1| histone H3, partial [Asterias rubens]
 gb|AHZ58431.1| histone H3, partial [Asterias rubens]
Length=126

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHE81414.1| histone H3, partial [Dyopedos bispinis]
 gb|AHE81415.1| histone H3, partial [Dyopedos bispinis]
 gb|AHE81417.1| histone H3, partial [Dyopedos bispinis]
Length=126

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_009017680.1| hypothetical protein HELRODRAFT_79413 [Helobdella robusta]
 gb|ESO04411.1| hypothetical protein HELRODRAFT_79413 [Helobdella robusta]
Length=135

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHC04275.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04276.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04277.1| histone H3, partial [Folsomia quadrioculata]
Length=124

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ADX77778.1| histone H3, partial [Caulastraea furcata]
 gb|ADX77811.1| histone H3, partial [Favia maxima]
 gb|ADX77850.1| histone H3, partial [Hydnophora pilosa]
 gb|ADX77851.1| histone H3, partial [Leptoria irregularis]
 gb|AIN56070.1| histone H3, partial [Goniastrea edwardsi]
 gb|AIN56085.1| histone H3, partial [Goniastrea minuta]
Length=124

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AGT20435.1| histone H3, partial [Ummidia sp. MY2716]
Length=128

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  2    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  50



>ref|XP_009053417.1| hypothetical protein LOTGIDRAFT_147385, partial [Lottia gigantea]
 gb|ESO95895.1| hypothetical protein LOTGIDRAFT_147385, partial [Lottia gigantea]
 gb|KFP99277.1| Histone H3, partial [Leptosomus discolor]
Length=127

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_008669425.1| PREDICTED: histone H3.2-like [Zea mays]
 tpg|DAA37858.1| TPA: histone H3.2 [Zea mays]
Length=169

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  34   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  82



>gb|AIF33143.1| histone H3, partial [Diaphus thiollierei]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABX71374.1| histone H3, partial [Sasquaperla hoopa]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_008558783.1| PREDICTED: histone H3, embryonic-like, partial [Microplitis demolitor]
Length=61

 Score = 95.1 bits (235),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABX71412.1| histone H3, partial [Austronemoura sp. BYU_PL149]
 gb|AGT20426.1| histone H3, partial [Ummidia sp. MY2310]
Length=126

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_008484412.1| PREDICTED: histone H3, partial [Diaphorina citri]
Length=89

 Score = 95.9 bits (237),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIF33249.1| histone H3, partial [Taaningichthys minimus]
Length=124

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_010158279.1| PREDICTED: histone H3, partial [Eurypyga helias]
 ref|XP_010293866.1| PREDICTED: histone H3, partial [Phaethon lepturus]
 gb|AAX52101.1| histone H3 [Cyathermia naticoides]
 gb|AAX52113.1| histone H3 [Scissurella cf. coronata CET-2005]
 gb|AAY98262.1| histone H3 [Epeorus longimanus]
 gb|AAY98289.1| histone H3 [Siphloplecton interlineatum]
 gb|AAY98291.1| histone H3 [Plethogenesia sp. EP121]
 gb|AAY98308.1| histone H3 [Oligoneuriella rhenana]
 gb|ABR67483.1| histone H3 [Acromantis insularis]
 gb|ADD70128.1| histone 3 [Sergia sp. KC4548]
 gb|ADH95956.1| histone 3 [Callobius paskenta]
 gb|ADH95963.1| histone 3 [Callobius sp. Carl Inn population]
 gb|ADH95975.1| histone 3 [Callobius olympus]
 gb|ADH95987.1| histone 3 [Callobius sp. White River population]
 gb|ADH96006.1| histone 3 [Callobius pauculus]
 gb|ADH96014.1| histone 3 [Callobius sp. Lunch Gulch population]
 gb|ADH96016.1| histone 3 [Callobius olympus]
 gb|ADH96020.1| histone 3 [Callobius enus]
 gb|ADH96021.1| histone 3 [Callobius guachama]
 gb|ADH96022.1| histone 3 [Callobius sp. Josephine Co population]
 gb|ADH96023.1| histone 3, partial [Callobius severus]
 gb|ADH96028.1| histone 3 [Callobius sierra]
 gb|ADH96050.1| histone 3, partial [Callobius sp. Eight Dollar Road population]
 gb|ADX98625.1| histone III [Tenodera costalis]
 gb|ADX98628.1| histone III [Tenodera superstitiosa]
 gb|ADX98634.1| histone III [Tenodera superstitiosa]
 gb|AET79410.1| histone H3, partial [Ophelina sp. pol413]
 gb|AHC04204.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04205.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04206.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04212.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04213.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04214.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04215.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04216.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04217.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04218.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04219.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04220.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04221.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04222.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04223.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04224.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04225.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04226.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04227.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04228.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04229.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04230.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04231.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04232.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04233.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04234.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04235.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04236.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04237.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04238.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04239.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04240.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04241.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04242.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04243.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04244.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04245.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04246.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04247.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04248.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04249.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04250.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04251.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04252.1| histone H3, partial [Ceratophysella denticulata]
 gb|AHC04253.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04254.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04255.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04256.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04257.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04258.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04259.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04260.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04261.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04262.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04263.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04264.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04265.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04266.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04267.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04268.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04269.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04270.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04271.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04272.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04273.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04274.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04278.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04279.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04280.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04281.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04282.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04283.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04284.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04285.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04286.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04287.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04288.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04289.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04290.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04291.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04292.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04293.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04294.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04295.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04296.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04297.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04298.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04299.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04300.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04301.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04303.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04304.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04305.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04306.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04307.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHC04308.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHM91947.1| histone H3, partial [Barylestis occidentalis]
 gb|AHM91953.1| histone H3, partial [Eusparassus dufouri]
 gb|AHM91962.1| histone H3, partial [Heteropoda cf. languida SD763]
 gb|AHM91965.1| histone H3, partial [Isopeda vasta]
 gb|AHM91966.1| histone H3, partial [Leucorchestris arenicola]
 gb|AHM91968.1| histone H3, partial [Olios cf. bibranchiatus SD705]
 gb|AHM91969.1| histone H3, partial [Olios cf. lacticolor SD740]
 gb|AHM91972.1| histone H3, partial [Olios sanguinifrons]
 gb|AHM91974.1| histone H3, partial [Panaretella sp. SD302]
 gb|AHM91975.1| histone H3, partial [Pandercetes sp. SD662]
 gb|AHM91977.1| histone H3, partial [Pseudomicrommata sp. SD742]
 gb|AHM91979.1| histone H3, partial [Rhitymna sp. SD681]
 gb|AHM91980.1| histone H3, partial [Selenops muehlmannorum]
 gb|AHM91981.1| histone H3, partial [Sinopoda tham]
 gb|AHM91983.1| histone H3, partial [Staianus sp. SD753]
 gb|AHM91984.1| histone H3, partial [Thelcticopis sp. SD713]
 gb|AHV90911.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90912.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90913.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90914.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90915.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90916.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90917.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90918.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90919.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90920.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90921.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90922.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90923.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90924.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90925.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90926.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90927.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90928.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90929.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90930.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90931.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90932.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90933.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90934.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90935.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90936.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90937.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90938.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90939.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90940.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90941.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90942.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90943.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90944.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90945.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90946.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90947.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90948.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90949.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90950.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90951.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90952.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90953.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90954.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90955.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90956.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90957.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90959.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90960.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90961.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90962.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90963.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90964.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90965.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90966.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90967.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90968.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90969.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90974.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90975.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90976.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90977.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90978.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90979.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90980.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90981.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90982.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90983.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90984.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90985.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90986.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90987.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90988.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90989.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90990.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90991.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90992.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90993.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90994.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90995.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90996.1| histone H3, partial [Folsomia quadrioculata]
 gb|AHV90997.1| histone H3, partial [Folsomia quadrioculata]
 gb|AIJ27313.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27314.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27315.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27316.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27317.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27318.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27319.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27320.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27321.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27322.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27323.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27324.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27325.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27326.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27327.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27328.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27329.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27330.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27331.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27332.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27333.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27334.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27335.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27336.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27337.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27338.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27339.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27340.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27341.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27342.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27343.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27344.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27345.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27346.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27347.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27348.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27349.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27350.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27351.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27352.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27353.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27354.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27355.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27356.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27357.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27358.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27359.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27360.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27361.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27362.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27363.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27364.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27365.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27366.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27367.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27368.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27369.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27370.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27371.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27372.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27373.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27374.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27375.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27376.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27377.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27378.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27379.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27380.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27381.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27382.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27383.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27384.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27385.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27386.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27387.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27388.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27389.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27390.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27391.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27392.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27393.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27394.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27395.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27396.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27397.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27398.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27399.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27400.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27401.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27402.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27403.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27404.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27405.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27406.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27407.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27408.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27409.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27410.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27411.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27412.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27413.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27414.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27415.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27416.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27417.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27418.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27419.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27420.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27421.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27422.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27423.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27424.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27425.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27426.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27427.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27428.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27429.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27430.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27431.1| histone H3, partial [Parisotoma notabilis]
 gb|AIJ27432.1| histone H3, partial [Parisotoma notabilis]
 gb|AIY68782.1| histone 3, partial [Crassostrea ariakensis]
 gb|AIY68783.1| histone 3, partial [Crassostrea ariakensis]
 gb|AIY68784.1| histone 3, partial [Crassostrea ariakensis]
 gb|AIY68785.1| histone 3, partial [Crassostrea gigas]
 gb|AIY68786.1| histone 3, partial [Crassostrea gigas]
 gb|AIY68787.1| histone 3, partial [Crassostrea nippona]
 gb|AIY68788.1| histone 3, partial [Crassostrea nippona]
 gb|AIY68789.1| histone 3, partial [Crassostrea nippona]
 gb|AIY68790.1| histone 3, partial [Ostrea denselamellosa]
 gb|AIY68795.1| histone 3, partial [Saccostrea kegaki]
 gb|AIY68796.1| histone 3, partial [Saccostrea kegaki]
 gb|AIY68797.1| histone 3, partial [Saccostrea kegaki]
 gb|AIY68798.1| histone 3, partial [Hyotissa hyotis]
 gb|AIY68799.1| histone 3, partial [Hyotissa hyotis]
 gb|AIY68800.1| histone 3, partial [Hyotissa hyotis]
 gb|AIY68801.1| histone 3, partial [Crassostrea virginica]
 gb|AIY68802.1| histone 3, partial [Crassostrea virginica]
Length=124

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ADH95980.1| histone 3 [Callobius sp. Josephine Co population]
Length=124

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|KHJ86469.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
Length=118

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIF33098.1| histone H3, partial [Ceratoscopelus townsendi]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABR67508.1| histone H3 [Angela sp. MN120]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABR67516.1| histone H3 [Musoniella sp. MN137]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AAW48001.1| histone 3 [Chelisoches annulatus]
Length=125

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_004670965.1| PREDICTED: histone H3, embryonic-like [Jaculus jaculus]
Length=67

 Score = 95.1 bits (235),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ACG80487.1| histone 3 [Radima sp. 1 BCOD-2008]
Length=116

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_003980057.1| PREDICTED: histone H3.1-like, partial [Takifugu rubripes]
Length=83

 Score = 95.5 bits (236),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHZ58432.1| histone H3, partial [Boreotrophon clathratus]
 gb|AHZ58433.1| histone H3, partial [Boreotrophon clathratus]
Length=131

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  6    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  54



>ref|XP_009301170.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100038789 
[Danio rerio]
Length=340

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 55/63 (87%), Gaps = 2/63 (3%)
 Frame = +3

Query  24   NLYIQFEL--SIVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGT  197
             LY  F L   ++ MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGT
Sbjct  97   TLYGAFYLISGVLTMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGT  156

Query  198  VAL  206
            VAL
Sbjct  157  VAL  159



>ref|XP_004349092.1| histone [Capsaspora owczarzaki ATCC 30864]
Length=140

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +3

Query  51   IVPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            ++ MARTKQTARKSTGGKAPRKQLATKAARK+APATGGVKKPHR+RPGTVAL
Sbjct  2    VLAMARTKQTARKSTGGKAPRKQLATKAARKTAPATGGVKKPHRYRPGTVAL  53



>ref|XP_002155115.2| PREDICTED: histone H3.1-like [Hydra vulgaris]
Length=102

 Score = 96.3 bits (238),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_009951278.1| PREDICTED: histone H3 [Leptosomus discolor]
Length=129

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_003494930.1| PREDICTED: histone H3-like, partial [Bombus impatiens]
 ref|XP_009017688.1| hypothetical protein HELRODRAFT_79133, partial [Helobdella robusta]
 gb|ESO04419.1| hypothetical protein HELRODRAFT_79133, partial [Helobdella robusta]
Length=129

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_009892706.1| PREDICTED: uncharacterized protein LOC104294757 [Charadrius vociferus]
Length=375

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/51 (96%), Positives = 51/51 (100%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            +PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  238  IPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  288


 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABZ89650.1| histone H3, partial [Lanistes sp. 1 AJ-2008]
Length=84

 Score = 95.5 bits (236),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ERZ94804.1| hypothetical protein GLOINDRAFT_341556 [Rhizophagus irregularis 
DAOM 181602]
 gb|ESA03678.1| hypothetical protein GLOINDRAFT_336643 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX68148.1| Hht2p [Rhizophagus irregularis DAOM 197198w]
Length=136

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_004977985.1| PREDICTED: histone H3-like centromeric protein CSE4-like [Setaria 
italica]
Length=278

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  57   PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  142  PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  191


 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  49



>gb|ABR67504.1| histone H3 [Acontista sp. MN111]
Length=125

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABR67479.1| histone H3 [Hapalopeza nilgirica]
Length=125

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIT12989.1| histone H3, partial [Orcula restituta]
Length=115

 Score = 96.3 bits (238),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHZ58420.1| histone H3, partial [Amphitrite figulus]
Length=130

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  5    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  53



>ref|XP_001862705.1| histone H3.2 [Culex quinquefasciatus]
 ref|XP_001862709.1| histone H3.3 type 2 [Culex quinquefasciatus]
 ref|XP_001862713.1| histone H3.3 type 2 [Culex quinquefasciatus]
 ref|XP_001862717.1| histone H3 type 2 [Culex quinquefasciatus]
 ref|XP_001862729.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37397.1| histone H3.2 [Culex quinquefasciatus]
 gb|EDS37401.1| histone H3.3 type 2 [Culex quinquefasciatus]
 gb|EDS37405.1| histone H3.3 type 2 [Culex quinquefasciatus]
 gb|EDS37409.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37421.1| histone H3 type 2 [Culex quinquefasciatus]
Length=155

 Score = 97.4 bits (241),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  18   IAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  68



>gb|AIY68794.1| histone 3, partial [Ostrea circumpicta]
Length=124

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABX71413.1| histone H3, partial [Udamocercia sp. BYU_PL150]
Length=81

 Score = 95.5 bits (236),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AJD38722.1| histone H3, partial [Ophryotrocha cyclops]
Length=124

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ADH95979.1| histone 3 [Callobius sp. x101]
Length=124

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIF33199.1| histone H3, partial [Metelectrona ventralis]
Length=125

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AGM53617.1| histone H3, partial [Orcula dolium]
Length=115

 Score = 96.3 bits (238),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIY68793.1| histone 3, partial [Ostrea circumpicta]
Length=124

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_008313557.1| PREDICTED: histone H3-like [Cynoglossus semilaevis]
Length=136

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AFI61665.1| histone 3 [Ruditapes philippinarum]
Length=136

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AEK26349.1| histone H3 [Delectopecten vancouverensis]
Length=121

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  4    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  52



>gb|ABR67467.1| histone H3 [Cliomantis obscura]
Length=125

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHZ58403.1| histone H3, partial [Acanthonotozoma inflatum]
Length=126

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABX71391.1| histone H3, partial [Moselia infuscata]
Length=126

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AEK26336.1| histone H3 [Laevichlamys cuneata]
Length=127

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  2    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  50



>gb|AIN56055.1| histone H3, partial [Paragoniastrea deformis]
Length=122

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|KDD73857.1| hypothetical protein H632_c1781p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=85

 Score = 95.5 bits (236),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHZ58414.1| histone H3, partial [Ectopleura larynx]
 gb|AHZ58417.1| histone H3, partial [Ectopleura larynx]
Length=119

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|EFB20847.1| hypothetical protein PANDA_018538 [Ailuropoda melanoleuca]
Length=139

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   VPMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  2    LEMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  52



>gb|AHZ58425.1| histone H3, partial [Arctica islandica]
Length=124

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  6    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  54



>ref|XP_008558785.1| PREDICTED: histone H3-like [Microplitis demolitor]
Length=124

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_011397775.1| Histone H3.1 [Auxenochlorella protothecoides]
 ref|XP_011399208.1| Histone H3.1 [Auxenochlorella protothecoides]
 ref|XP_011401547.1| Histone H3.1 [Auxenochlorella protothecoides]
 gb|KFM22525.1| Histone H3.1 [Auxenochlorella protothecoides]
 gb|KFM24887.1| Histone H3.1 [Auxenochlorella protothecoides]
 gb|KFM26312.1| Histone H3.1 [Auxenochlorella protothecoides]
Length=136

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHZ58423.1| histone H3, partial [Arctica islandica]
Length=131

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  6    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  54



>gb|KFZ56463.1| Histone H3, partial [Podiceps cristatus]
Length=131

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_010796966.1| PREDICTED: histone H3.1-like [Bos taurus]
 ref|XP_010806185.1| PREDICTED: histone H3.1-like [Bos taurus]
Length=100

 Score = 95.9 bits (237),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABM53708.1| histone 3, partial [Latiblattella sp. 3 DJGI-2006]
Length=123

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABX71390.1| histone H3, partial [Megaleuctra kincaidi]
Length=87

 Score = 95.5 bits (236),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_005643646.1| histone H3 [Coccomyxa subellipsoidea C-169]
 ref|XP_005643655.1| histone H3 [Coccomyxa subellipsoidea C-169]
 ref|XP_005643677.1| histone H3 [Coccomyxa subellipsoidea C-169]
 ref|XP_005643713.1| histone H3 [Coccomyxa subellipsoidea C-169]
 ref|XP_005646405.1| histone H3 [Coccomyxa subellipsoidea C-169]
 ref|XP_005646414.1| histone H3 [Coccomyxa subellipsoidea C-169]
 ref|XP_005648178.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE19102.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE19111.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE19133.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE19169.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE21861.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE21870.1| histone H3 [Coccomyxa subellipsoidea C-169]
 gb|EIE23634.1| histone H3 [Coccomyxa subellipsoidea C-169]
Length=136

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AAP94664.1| histone H3 [Mytilus californianus]
Length=136

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AEK26338.1| histone H3 [Veprichlamys jousseaumei]
 gb|AEK26343.1| histone H3 [Mizuhopecten yessoensis]
Length=126

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  2    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  50



>ref|XP_010668604.1| PREDICTED: histone H3-like isoform X2 [Beta vulgaris subsp. vulgaris]
Length=136

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AET97543.1| histone 3 [Panopeus herbstii]
Length=125

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ELK02686.1| Histone H3 [Pteropus alecto]
Length=84

 Score = 95.5 bits (236),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AAI29394.1| Zgc:158701 protein [Danio rerio]
Length=70

 Score = 95.1 bits (235),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AIF33097.1| histone H3, partial [Ceratoscopelus maderensis]
Length=125

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ACP74198.1| histone H3, partial [Campeloma floridense]
Length=125

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|KFM02264.1| Histone H3, partial [Aptenodytes forsteri]
Length=88

 Score = 95.5 bits (236),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>ref|XP_001620157.1| hypothetical protein NEMVEDRAFT_v1g148952 [Nematostella vectensis]
 gb|EDO28057.1| predicted protein, partial [Nematostella vectensis]
Length=140

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  5    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  53



>gb|AAW48000.1| histone 3 [Opisthocosmia tenius]
Length=125

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ADX77863.1| histone H3, partial [Phymastrea multipunctata]
 gb|ADX77874.1| histone H3, partial [Oulophyllia aff. bennettae DH-2011]
 gb|ADX77878.1| histone H3, partial [Pectinia lactuca]
 gb|AIN56034.1| histone H3, partial [Paragoniastrea australensis]
 gb|AIN56041.1| histone H3, partial [Paragoniastrea australensis]
 gb|AIN56045.1| histone H3, partial [Paragoniastrea australensis]
 gb|AIN56112.1| histone H3, partial [Goniastrea retiformis]
Length=122

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|ABR67478.1| histone H3 [Humbertiella similis]
 gb|ACD46266.1| histone H3 [Themira annulipes]
 gb|ADU18161.1| histone H3 [Armandia maculata]
 gb|ADU18163.1| histone H3 [Euzonus ezoensis]
 gb|ADU18165.1| histone H3 [Hyboscolex pacificus]
 gb|ADU18167.1| histone H3 [Notomastus hemipodus]
 gb|ADU18168.1| histone H3 [Onuphis iridescens]
 gb|ADU18169.1| histone H3 [Ophelina acuminata]
 gb|ADU18170.1| histone H3 [Ophelia bicornis]
 gb|ADU18171.1| histone H3 [Ophelina cylindricaudata]
 gb|ADU18172.1| histone H3 [Ophelia neglecta]
 gb|ADU18177.1| histone H3 [Typosyllis sp. CB-2010]
 emb|CBY05450.1| histone 3 [Antiporus blakeii]
 emb|CBY05451.1| histone 3 [Antiporus gilbertii]
 gb|AEA73450.1| histone H3, partial [Pseudofabriciola australiensis]
 gb|AEK26332.1| histone H3 [Veprichlamys jousseaumei]
Length=122

 Score = 96.7 bits (239),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



>gb|AHZ58405.1| histone H3, partial [Aglantha digitale]
Length=119

 Score = 96.3 bits (238),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  60   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVAL  206
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559716100580