BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF006P08

Length=227
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|O49954.1|GCSP_SOLTU  RecName: Full=Glycine dehydrogenase (deca...  71.6    3e-12   Solanum tuberosum [potatoes]
ref|XP_009797115.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  70.5    7e-12   Nicotiana sylvestris
ref|XP_009620998.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  69.3    2e-11   Nicotiana tomentosiformis
ref|XP_006361002.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...  69.3    2e-11   
ref|XP_004245101.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  67.0    1e-10   Solanum lycopersicum
ref|XP_008220472.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  63.2    2e-09   Prunus mume [ume]
emb|CDP08258.1|  unnamed protein product                              60.8    2e-08   Coffea canephora [robusta coffee]
ref|NP_001289247.1|  glycine dehydrogenase (decarboxylating), mit...  60.1    2e-08   Pyrus x bretschneideri [bai li]
ref|XP_008393646.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  60.1    2e-08   Malus domestica [apple tree]
ref|XP_009361869.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  60.1    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_009361863.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  60.1    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_010097067.1|  Glycine cleavage system P protein 1              58.2    1e-07   
ref|XP_010047334.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  58.2    1e-07   Eucalyptus grandis [rose gum]
ref|NP_001119106.1|  glycine dehydrogenase [decarboxylating] 2        56.6    4e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAN17423.1|  P-Protein - like protein                              56.6    4e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAK68740.1|  P-Protein - like protein                              56.6    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195027.1|  glycine dehydrogenase [decarboxylating] 2           56.6    4e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAL57651.1|  AT4g33010/F26P21_130                                  56.2    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867212.1|  hypothetical protein ARALYDRAFT_491390           56.2    5e-07   
ref|XP_004291039.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  55.8    6e-07   Fragaria vesca subsp. vesca
gb|KCW81693.1|  hypothetical protein EUGRSUZ_C03047                   55.5    9e-07   Eucalyptus grandis [rose gum]
ref|XP_010049196.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  55.1    1e-06   Eucalyptus grandis [rose gum]
gb|KHG06307.1|  Glycine dehydrogenase [decarboxylating], mitochon...  55.1    1e-06   Gossypium arboreum [tree cotton]
ref|XP_007012280.1|  Glycine decarboxylase P-protein 1                55.1    1e-06   
gb|KJB54687.1|  hypothetical protein B456_009G045100                  55.1    1e-06   Gossypium raimondii
gb|KFK29912.1|  hypothetical protein AALP_AA7G194500                  54.7    2e-06   Arabis alpina [alpine rockcress]
ref|XP_010262151.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  54.7    2e-06   Nelumbo nucifera [Indian lotus]
gb|KJB54688.1|  hypothetical protein B456_009G045100                  54.7    2e-06   Gossypium raimondii
ref|XP_006283054.1|  hypothetical protein CARUB_v10004049mg           54.3    2e-06   Capsella rubella
emb|CDX68930.1|  BnaC01g05230D                                        53.1    5e-06   
ref|XP_010432628.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  53.1    6e-06   Camelina sativa [gold-of-pleasure]
gb|KJB65558.1|  hypothetical protein B456_010G101200                  52.4    9e-06   Gossypium raimondii
ref|XP_010437818.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  52.4    1e-05   Camelina sativa [gold-of-pleasure]
gb|KJB65560.1|  hypothetical protein B456_010G101200                  52.4    1e-05   Gossypium raimondii
emb|CDX75316.1|  BnaA01g03860D                                        52.0    1e-05   
ref|XP_009125119.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  52.0    1e-05   Brassica rapa
gb|AAU94363.1|  glycine decarboxylase P-protein                       51.6    1e-05   Moricandia nitens
gb|KJB65559.1|  hypothetical protein B456_010G101200                  52.0    2e-05   Gossypium raimondii
gb|EYU29323.1|  hypothetical protein MIMGU_mgv1a000648mg              51.6    2e-05   Erythranthe guttata [common monkey flower]
gb|KHG00684.1|  Glycine dehydrogenase [decarboxylating], mitochon...  51.2    3e-05   Gossypium arboreum [tree cotton]
gb|AGH12215.1|  glycine decarboxylase P protein                       48.1    3e-05   Flaveria pringlei
ref|XP_011081684.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  51.2    3e-05   Sesamum indicum [beniseed]
ref|XP_010519851.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  50.8    4e-05   Tarenaya hassleriana [spider flower]
gb|AGH12216.1|  glycine decarboxylase P protein                       48.9    6e-05   Flaveria pringlei
dbj|BAJ34193.1|  unnamed protein product                              50.1    6e-05   Eutrema halophilum
ref|XP_010648358.1|  PREDICTED: glycine dehydrogenase (decarboxyl...  49.3    1e-04   Vitis vinifera
gb|KDP34101.1|  hypothetical protein JCGZ_07672                       49.3    1e-04   Jatropha curcas
emb|CAN63089.1|  hypothetical protein VITISV_032016                   49.3    1e-04   Vitis vinifera
ref|XP_006412401.1|  hypothetical protein EUTSA_v10024257mg           48.9    2e-04   
ref|XP_002516446.1|  glycine dehydrogenase, putative                  48.5    2e-04   Ricinus communis
sp|P49361.1|GCSPA_FLAPR  RecName: Full=Glycine dehydrogenase (dec...  48.1    3e-04   Flaveria pringlei
ref|XP_004498895.1|  PREDICTED: glycine dehydrogenase [decarboxyl...  48.1    3e-04   
ref|XP_007227061.1|  hypothetical protein PRUPE_ppa000675mg           48.1    3e-04   
gb|EYU20359.1|  hypothetical protein MIMGU_mgv1a000655mg              47.0    6e-04   Erythranthe guttata [common monkey flower]
gb|KDO80090.1|  hypothetical protein CISIN_1g001531mg                 47.0    7e-04   Citrus sinensis [apfelsine]
emb|CAA81076.1|  P protein                                            47.0    7e-04   Flaveria pringlei
gb|AFV46211.1|  hypothetical protein                                  45.8    8e-04   Scutellaria baicalensis [Baikal skullcap]
gb|KDO80092.1|  hypothetical protein CISIN_1g001531mg                 46.6    8e-04   Citrus sinensis [apfelsine]
emb|CBI20666.3|  unnamed protein product                              43.9    9e-04   Vitis vinifera
gb|KDO80091.1|  hypothetical protein CISIN_1g001531mg                 46.6    0.001   Citrus sinensis [apfelsine]
ref|XP_006450834.1|  hypothetical protein CICLE_v10007310mg           46.6    0.001   Citrus clementina [clementine]
ref|XP_006475931.1|  PREDICTED: glycine dehydrogenase [decarboxyl...  46.6    0.001   Citrus sinensis [apfelsine]
gb|KDO80085.1|  hypothetical protein CISIN_1g001531mg                 46.6    0.001   Citrus sinensis [apfelsine]



>sp|O49954.1|GCSP_SOLTU RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Solanum 
tuberosum]
 emb|CAB16918.1| P-Protein precursor [Solanum tuberosum]
Length=1035

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            MERARKLANRAIL+RLV ++KQ R+NE P+++L+RP+RYVSSL+P
Sbjct  1    MERARKLANRAILKRLVSQSKQSRSNEIPSSSLYRPSRYVSSLSP  45



>ref|XP_009797115.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana sylvestris]
Length=1046

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 1/46 (2%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETP-AAALHRPARYVSSLAP  211
            MERARKLANRAIL+RLV ++KQ RANE P +AAL+RP+RYVSSL+P
Sbjct  1    MERARKLANRAILKRLVSDSKQSRANEIPSSAALYRPSRYVSSLSP  46



>ref|XP_009620998.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana tomentosiformis]
Length=1043

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 42/46 (91%), Gaps = 1/46 (2%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETP-AAALHRPARYVSSLAP  211
            M+RARKLANRAIL+RLV E+KQ RAN+ P +AAL+RP+RYVSSL+P
Sbjct  1    MDRARKLANRAILKRLVSESKQSRANDIPSSAALYRPSRYVSSLSP  46



>ref|XP_006361002.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Solanum tuberosum]
Length=1092

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            MERARKLANRAIL+RLV ++KQ R+NE P+++L+ P+RYVSSL+P
Sbjct  1    MERARKLANRAILKRLVSQSKQSRSNEIPSSSLYWPSRYVSSLSP  45



>ref|XP_004245101.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Solanum lycopersicum]
Length=1036

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 42/46 (91%), Gaps = 1/46 (2%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPA-AALHRPARYVSSLAP  211
            MERARKLANRAIL+RLV ++KQ R+NE P+ ++L+RP+RYVSSL+P
Sbjct  1    MERARKLANRAILKRLVSQSKQSRSNEIPSPSSLYRPSRYVSSLSP  46



>ref|XP_008220472.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Prunus mume]
Length=1054

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 5/54 (9%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANET-----PAAALHRPARYVSSLAPCAAM  223
            MERAR+LANRA ++RLV +AKQ R NET      +  L+ P+RYVSSL+PC+ M
Sbjct  1    MERARRLANRAFVKRLVSDAKQFRQNETVFSSSTSPVLYTPSRYVSSLSPCSFM  54



>emb|CDP08258.1| unnamed protein product [Coffea canephora]
Length=1031

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 6/53 (11%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE------TPAAALHRPARYVSSLAPCA  217
            M+RARKLANRAIL+RLV EAKQ R N       +  +  +RP+RYVSSL+PC+
Sbjct  1    MDRARKLANRAILKRLVSEAKQRRGNGEANELLSAPSPFYRPSRYVSSLSPCS  53



>ref|NP_001289247.1| glycine dehydrogenase (decarboxylating), mitochondrial [Pyrus 
x bretschneideri]
 gb|AHM26626.1| glycine dehydrogenase decarboxylating protein [Pyrus x bretschneideri]
Length=1049

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 6/53 (11%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE------TPAAALHRPARYVSSLAPCA  217
            MERAR+LANRA ++RLV EAKQ R NE      + +  L+ P+RYVSSL+PC+
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCS  53



>ref|XP_008393646.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Malus domestica]
Length=1049

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 6/53 (11%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE------TPAAALHRPARYVSSLAPCA  217
            MERAR+LANRA ++RLV EAKQ R NE      + +  L+ P+RYVSSL+PC+
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCS  53



>ref|XP_009361869.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X2 [Pyrus x bretschneideri]
Length=1049

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 6/53 (11%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE------TPAAALHRPARYVSSLAPCA  217
            MERAR+LANRA ++RLV EAKQ R NE      + +  L+ P+RYVSSL+PC+
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCS  53



>ref|XP_009361863.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361876.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X3 [Pyrus x bretschneideri]
Length=1049

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 6/53 (11%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE------TPAAALHRPARYVSSLAPCA  217
            MERAR+LANRA ++RLV EAKQ R NE      + +  L+ P+RYVSSL+PC+
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCS  53



>ref|XP_010097067.1| Glycine cleavage system P protein 1 [Morus notabilis]
 gb|EXB66868.1| Glycine cleavage system P protein 1 [Morus notabilis]
Length=1059

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 8/55 (15%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEA-KQLRANETPAA-------ALHRPARYVSSLAPCA  217
            MERAR++ANRA L+RLV EA KQ R NE+PAA         + P+RYVSSL+PC+
Sbjct  1    MERARRVANRAFLKRLVSEAKKQYRQNESPAALQNASSPMSYTPSRYVSSLSPCS  55



>ref|XP_010047334.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Eucalyptus grandis]
 gb|KCW79221.1| hypothetical protein EUGRSUZ_C00646 [Eucalyptus grandis]
Length=1053

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 4/54 (7%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE----TPAAALHRPARYVSSLAPCAAMY  226
            MERAR+LANRAIL+R+V E K  R  E    + ++AL+ P+RYVSSL+ C++M+
Sbjct  1    MERARRLANRAILKRIVSETKHHRRLESGLDSSSSALYTPSRYVSSLSACSSMH  54



>ref|NP_001119106.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
 gb|AEE86160.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
Length=976

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP  45



>gb|AAN17423.1| P-Protein - like protein [Arabidopsis thaliana]
Length=956

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP  45



>gb|AAK68740.1| P-Protein - like protein [Arabidopsis thaliana]
 gb|AAM91322.1| P-protein-like protein [Arabidopsis thaliana]
Length=1037

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP  45



>ref|NP_195027.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
 sp|Q94B78.2|GCSP1_ARATH RecName: Full=Glycine dehydrogenase (decarboxylating) 1, mitochondrial; 
AltName: Full=Glycine cleavage system P protein 1; 
AltName: Full=Glycine decarboxylase 1; AltName: Full=Glycine 
decarboxylase P-protein 1; Short=AtGLDP1; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA21210.1| P-Protein-like protein [Arabidopsis thaliana]
 emb|CAB80018.1| P-Protein-like protein [Arabidopsis thaliana]
 gb|AAL36259.1| putative P-Protein [Arabidopsis thaliana]
 gb|AAM14125.1| putative P-protein [Arabidopsis thaliana]
 gb|AEE86159.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
Length=1037

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP  45



>gb|AAL57651.1| AT4g33010/F26P21_130 [Arabidopsis thaliana]
 gb|AAN64523.1| At4g33010/F26P21_130 [Arabidopsis thaliana]
Length=1037

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP  45



>ref|XP_002867212.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43471.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
Length=1037

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP  45



>ref|XP_004291039.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Fragaria vesca subsp. vesca]
Length=1048

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 7/51 (14%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAAL-------HRPARYVSSLA  208
            MERAR+LANRA ++RLV EAKQ R NET +A L         P+RYVSSL+
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNETSSALLGSSSPVMFTPSRYVSSLS  51



>gb|KCW81693.1| hypothetical protein EUGRSUZ_C03047 [Eucalyptus grandis]
Length=838

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 4/49 (8%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE----TPAAALHRPARYVSSLAP  211
            MERAR+LANRAIL+RLV E+KQ R +E    + +  +  P+RYVSSL P
Sbjct  1    MERARRLANRAILKRLVSESKQYRQDESLLSSSSPVIFTPSRYVSSLVP  49



>ref|XP_010049196.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW81692.1| hypothetical protein EUGRSUZ_C03047 [Eucalyptus grandis]
Length=1053

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 4/49 (8%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE----TPAAALHRPARYVSSLAP  211
            MERAR+LANRAIL+RLV E+KQ R +E    + +  +  P+RYVSSL P
Sbjct  1    MERARRLANRAILKRLVSESKQYRQDESLLSSSSPVIFTPSRYVSSLVP  49



>gb|KHG06307.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1028

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE--TPAAALHRPARYVSSLAP  211
            MERARK+ANRAIL+RLV+E+KQ R  E  + +   + P+RYVSSL+P
Sbjct  1    MERARKVANRAILKRLVNESKQSRNGEISSRSPVSYTPSRYVSSLSP  47



>ref|XP_007012280.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
 gb|EOY29899.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
Length=1050

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE--TPAAALHRPARYVSSLAP  211
            MERAR++ANRAIL+RLV+ AKQ R  E  + +  L+ P+RYVSSL+P
Sbjct  1    MERARRVANRAILKRLVNAAKQSRNGEISSRSPVLYTPSRYVSSLSP  47



>gb|KJB54687.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1050

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE--TPAAALHRPARYVSSLAP  211
            MERARK+ANRAIL+RLV+E+KQ R  E  + +   + P+RYVSSL+P
Sbjct  1    MERARKVANRAILKRLVNESKQSRNGEMSSRSPVSYTPSRYVSSLSP  47



>gb|KFK29912.1| hypothetical protein AALP_AA7G194500 [Arabis alpina]
Length=1042

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANET-PAAALHRPARYVSSLAP  211
            MERAR+LA R I+RRLV++ K+ R N+T P+   H P RYVSSL+P
Sbjct  1    MERARRLAYRGIVRRLVNDTKRHRNNQTSPSIVPHTPTRYVSSLSP  46



>ref|XP_010262151.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nelumbo nucifera]
Length=1043

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 7/50 (14%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANET-----PAAALHRPARYVSSLAP  211
            MERAR+LANRAILRRLVHE++Q + + T     PA+ +  PARY SSL+P
Sbjct  1    MERARRLANRAILRRLVHESRQQQRHATSSYSSPASFI--PARYFSSLSP  48



>gb|KJB54688.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1053

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE--TPAAALHRPARYVSSLAP  211
            MERARK+ANRAIL+RLV+E+KQ R  E  + +   + P+RYVSSL+P
Sbjct  1    MERARKVANRAILKRLVNESKQSRNGEMSSRSPVSYTPSRYVSSLSP  47



>ref|XP_006283054.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
 gb|EOA15952.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
Length=1038

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAP  211
            MERAR+LA R I++RLV+EAK+ R  ETP   + H PARYVSSL+P
Sbjct  1    MERARRLAYRGIVKRLVNEAKRHRNPETPHLVVPHAPARYVSSLSP  46



>emb|CDX68930.1| BnaC01g05230D [Brassica napus]
Length=1045

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAP  211
            MERAR+LA R I+RRLV+E+K+ R  E      P+   H PARY+SSL+P
Sbjct  1    MERARRLAYRGIVRRLVNESKRHRNGEITPHHVPSVVPHAPARYISSLSP  50



>ref|XP_010432628.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Camelina sativa]
Length=1045

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAP  211
            MERAR+LA R I++RLV++AK+ R  +TP   + H PARYVSSL+P
Sbjct  1    MERARRLAYRGIVKRLVNDAKRHRNPDTPHVVVPHAPARYVSSLSP  46



>gb|KJB65558.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=945

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETP--AAALHRPARYVSSLAPCAAMY  226
            MERAR+LA+RAIL+RLV+E KQ    +    +  L+ P+RYVSSL+P  + Y
Sbjct  1    MERARRLASRAILKRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKY  52



>ref|XP_010437818.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Camelina sativa]
Length=1040

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAP  211
            MERAR+LA R I++RLV++AK+ R  +TP   + H PARYVSSL+P
Sbjct  1    MERARRLAYRGIVKRLVNDAKRHRNPDTPHLVVPHAPARYVSSLSP  46



>gb|KJB65560.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=1047

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETP--AAALHRPARYVSSLAPCAAMY  226
            MERAR+LA+RAIL+RLV+E KQ    +    +  L+ P+RYVSSL+P  + Y
Sbjct  1    MERARRLASRAILKRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKY  52



>emb|CDX75316.1| BnaA01g03860D [Brassica napus]
Length=1044

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAP  211
            MERAR+LA R I+RRLV+E+K+ R  E      P+   H P+RY+SSL+P
Sbjct  1    MERARRLAYRGIVRRLVNESKRHRNGEITPHHVPSVVPHAPSRYISSLSP  50



>ref|XP_009125119.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Brassica rapa]
Length=1045

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAP  211
            MERAR+LA R I+RRLV+E+K+ R  E      P+   H P+RY+SSL+P
Sbjct  1    MERARRLAYRGIVRRLVNESKRHRNGEITPHHVPSVVPHAPSRYISSLSP  50



>gb|AAU94363.1| glycine decarboxylase P-protein [Moricandia nitens]
Length=497

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAP  211
            MERAR+LA R I+RRLV+E+K+ R  E      P+   H PARY+SSL+P
Sbjct  1    MERARRLAYRGIVRRLVNESKRHRKGEITPHHVPSVVPHAPARYISSLSP  50



>gb|KJB65559.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=973

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETP--AAALHRPARYVSSLAPCAAMY  226
            MERAR+LA+RAIL+RLV+E KQ    +    +  L+ P+RYVSSL+P  + Y
Sbjct  1    MERARRLASRAILKRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKY  52



>gb|EYU29323.1| hypothetical protein MIMGU_mgv1a000648mg [Erythranthe guttata]
Length=1032

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 8/47 (17%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCA  217
            MERARKLANRAILRRL  E+KQ          L++ +RYVSSL+P A
Sbjct  1    MERARKLANRAILRRLFSESKQ--------QPLYKSSRYVSSLSPSA  39



>gb|KHG00684.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1047

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETP--AAALHRPARYVSSLAP  211
            MERAR+LA+RAILRRLV+E KQ    +    +  L+ P+RYVSSL+P
Sbjct  1    MERARRLASRAILRRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSP  47



>gb|AGH12215.1| glycine decarboxylase P protein, partial [Flaveria pringlei]
Length=145

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 4/45 (9%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            MERAR+LAN+AILRRLV + K      TP  AL+ P+RYVSSL+P
Sbjct  1    MERARRLANKAILRRLVSKTKH--NPSTP--ALYSPSRYVSSLSP  41



>ref|XP_011081684.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Sesamum indicum]
Length=1037

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 8/45 (18%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            MERARKLANRAILRRLV E+KQ          L++ +RY+SSL+P
Sbjct  1    MERARKLANRAILRRLVSESKQ--------QPLYQSSRYISSLSP  37



>ref|XP_010519851.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Tarenaya hassleriana]
Length=1054

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 7/55 (13%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLR-------ANETPAAALHRPARYVSSLAPCAA  220
            MERAR+LANRAIL+RLV  +K+ R       +    + AL+ PARYVSSL+P A+
Sbjct  1    MERARRLANRAILKRLVDSSKRHRTAREASLSGGASSPALYSPARYVSSLSPFAS  55



>gb|AGH12216.1| glycine decarboxylase P protein, partial [Flaveria pringlei]
Length=250

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 4/45 (9%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            MERAR+LAN+AILRRLV + K     +    AL+ P+RYVSSL+P
Sbjct  1    MERARRLANKAILRRLVSKTK----TQPITPALYSPSRYVSSLSP  41



>dbj|BAJ34193.1| unnamed protein product [Thellungiella halophila]
Length=756

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 4/49 (8%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANET---PAAALHRPA-RYVSSLAP  211
            MERAR++A R I+RRLV++AK+ R  ET   P+A  H PA RY+SSL+P
Sbjct  1    MERARRIAYRGIVRRLVNDAKRHRNVETPHVPSAVPHAPATRYLSSLSP  49



>ref|XP_010648358.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Vitis vinifera]
Length=1053

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 5/52 (10%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLR-----ANETPAAALHRPARYVSSLAPCA  217
            MERAR++ANRAILRRLV E+KQ R      NE    +     RYVSSL  CA
Sbjct  1    MERARRIANRAILRRLVSESKQQRPCPRPQNEGLVNSSFSGWRYVSSLPTCA  52



>gb|KDP34101.1| hypothetical protein JCGZ_07672 [Jatropha curcas]
Length=1059

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 9/57 (16%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLR---ANETPA------AALHRPARYVSSLAPCAA  220
            MERAR+LANRAIL+RLV+E++Q      NE+ A        L+ P+RYVSSL+  A+
Sbjct  1    MERARRLANRAILKRLVNESRQCSHQGRNESSALLNSSSPVLYSPSRYVSSLSSFAS  57



>emb|CAN63089.1| hypothetical protein VITISV_032016 [Vitis vinifera]
Length=1036

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 5/52 (10%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLR-----ANETPAAALHRPARYVSSLAPCA  217
            MERAR++ANRAILRRLV E+KQ R      NE    +     RYVSSL  CA
Sbjct  1    MERARRIANRAILRRLVSESKQQRPCPRPQNEGLVNSSFSGWRYVSSLPTCA  52



>ref|XP_006412401.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
 gb|ESQ53854.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
Length=1146

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 5/56 (9%)
 Frame = +2

Query  59   FLEF-PAMERARKLANRAILRRLVHEAKQLRANET---PAAALHRPA-RYVSSLAP  211
            FL F  +MERAR++A R I+RRLV++AK+ R  ET   P+A  H PA RY+SSL+P
Sbjct  97   FLPFYISMERARRIAYRGIVRRLVNDAKRHRNVETPHVPSAVPHAPATRYLSSLSP  152



>ref|XP_002516446.1| glycine dehydrogenase, putative [Ricinus communis]
 gb|EEF45787.1| glycine dehydrogenase, putative [Ricinus communis]
Length=1057

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 12/60 (20%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLR------------ANETPAAALHRPARYVSSLAPCAA  220
            MERARKLANRAIL+RLV+E+K  +             N + +  L+ P+RYVSSL+  A+
Sbjct  1    MERARKLANRAILKRLVNESKPHKHHSRNESSATTLLNSSSSPILYTPSRYVSSLSSFAS  60



>sp|P49361.1|GCSPA_FLAPR RecName: Full=Glycine dehydrogenase (decarboxylating) A, mitochondrial; 
AltName: Full=Glycine cleavage system P protein A; 
AltName: Full=Glycine decarboxylase A; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) A; Flags: Precursor 
[Flaveria pringlei]
 emb|CAA85353.1| P-protein of the glycine cleavage system [Flaveria pringlei]
Length=1037

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            MERAR+LAN+AIL RLV + K   +  +P  AL  P+RYVSSL+P
Sbjct  1    MERARRLANKAILGRLVSQTKHNPSISSP--ALCSPSRYVSSLSP  43



>ref|XP_004498895.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X1 [Cicer arietinum]
 ref|XP_004498896.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=1114

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRP---ARYVSSLA  208
            MERAR+LANRA L+RL+ EAKQ R NET       P   +RYVSS++
Sbjct  57   MERARRLANRATLKRLLSEAKQNRNNETIWNTSTTPIPSSRYVSSVS  103



>ref|XP_007227061.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
 gb|EMJ28260.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
Length=1039

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSS  202
            MERAR+LAN+A ++RLV EAKQ R NET  ++   P  Y  S
Sbjct  1    MERARRLANQAFVKRLVSEAKQFRQNETVLSSSTSPVLYTPS  42



>gb|EYU20359.1| hypothetical protein MIMGU_mgv1a000655mg [Erythranthe guttata]
Length=1030

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 8/45 (18%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            MERARKL NRAILRRLV  +KQ          L+R +RYVSSL P
Sbjct  1    MERARKLVNRAILRRLVSASKQ--------QPLYRSSRYVSSLPP  37



>gb|KDO80090.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1049

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 7/53 (13%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCA  217
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+ CA
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLS-CA  52



>emb|CAA81076.1| P protein [Flaveria pringlei]
Length=1037

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  211
            M+RAR+LAN+AIL RLV + K   +  +P  AL  P+RYVSSL+P
Sbjct  1    MDRARRLANKAILGRLVSQTKHNPSISSP--ALCSPSRYVSSLSP  43



>gb|AFV46211.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=266

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 8/49 (16%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAM  223
            MERARKL +RAILRRLV E KQ          L++ +RYVSSL+   A+
Sbjct  1    MERARKLGSRAILRRLVSEQKQ--------QPLYKSSRYVSSLSASVAV  41



>gb|KDO80092.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=985

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 7/53 (13%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCA  217
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+ CA
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLS-CA  52



>emb|CBI20666.3| unnamed protein product [Vitis vinifera]
Length=94

 Score = 43.9 bits (102),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 31/48 (65%), Gaps = 5/48 (10%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLR-----ANETPAAALHRPARYVSSL  205
            MERAR++ANRAILRRLV E+KQ R      NE    +     RYVSSL
Sbjct  1    MERARRIANRAILRRLVSESKQQRPCPRPQNEGLVNSSFSGWRYVSSL  48



>gb|KDO80091.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=985

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 7/53 (13%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCA  217
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+ CA
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLS-CA  52



>ref|XP_006450834.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
 gb|ESR64074.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
Length=1058

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 7/53 (13%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCA  217
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+ CA
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLS-CA  52



>ref|XP_006475931.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Citrus sinensis]
 gb|KDO80086.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
 gb|KDO80087.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1058

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 7/53 (13%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCA  217
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+ CA
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLS-CA  52



>gb|KDO80085.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1016

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 7/53 (13%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCA  217
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+ CA
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLS-CA  52



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570526909590