BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF006K12

Length=407
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002265955.1|  PREDICTED: cellulose synthase A catalytic su...    194   3e-54   Vitis vinifera
ref|XP_006364140.1|  PREDICTED: cellulose synthase A catalytic su...    193   5e-54   Solanum tuberosum [potatoes]
emb|CBI18221.3|  unnamed protein product                                193   5e-54   Vitis vinifera
ref|XP_004252570.1|  PREDICTED: cellulose synthase A catalytic su...    193   6e-54   Solanum lycopersicum
dbj|BAG06272.1|  cellulose synthase Z632                                192   1e-53   Zinnia elegans [garden zinnia]
ref|XP_011074751.1|  PREDICTED: cellulose synthase A catalytic su...    191   2e-53   Sesamum indicum [beniseed]
ref|XP_011101270.1|  PREDICTED: cellulose synthase A catalytic su...    191   3e-53   Sesamum indicum [beniseed]
gb|AIA61439.1|  cellulose synthase                                      191   4e-53   Boehmeria nivea [Chinese silk-plant]
ref|XP_009765335.1|  PREDICTED: cellulose synthase A catalytic su...    191   4e-53   Nicotiana sylvestris
ref|XP_009599913.1|  PREDICTED: cellulose synthase A catalytic su...    191   4e-53   Nicotiana tomentosiformis
gb|AGV22110.1|  cellulose synthase 8                                    190   5e-53   Betula luminifera [liang ye hua]
ref|XP_007019545.1|  Cellulose synthase 6                               190   6e-53   
emb|CDP11417.1|  unnamed protein product                                190   6e-53   Coffea canephora [robusta coffee]
ref|XP_004138382.1|  PREDICTED: cellulose synthase A catalytic su...    190   6e-53   Cucumis sativus [cucumbers]
ref|XP_008463088.1|  PREDICTED: cellulose synthase A catalytic su...    190   6e-53   Cucumis melo [Oriental melon]
ref|XP_008463087.1|  PREDICTED: cellulose synthase A catalytic su...    190   6e-53   Cucumis melo [Oriental melon]
gb|AFZ78561.1|  cellulose synthase                                      189   2e-52   Populus tomentosa [Chinese white poplar]
ref|XP_010106861.1|  Isoxaben-resistant protein 2                       189   2e-52   
ref|XP_006367803.1|  PREDICTED: cellulose synthase A catalytic su...    188   2e-52   Solanum tuberosum [potatoes]
ref|XP_004237809.1|  PREDICTED: cellulose synthase A catalytic su...    188   3e-52   Solanum lycopersicum
ref|XP_011042869.1|  PREDICTED: cellulose synthase A catalytic su...    188   3e-52   Populus euphratica
ref|XP_002302169.1|  CesA7A-like family protein                         188   3e-52   
gb|AAT09895.1|  cellulose synthase                                      188   4e-52   Populus tremula x Populus tremuloides
ref|XP_009376550.1|  PREDICTED: cellulose synthase A catalytic su...    188   4e-52   Pyrus x bretschneideri [bai li]
gb|KJB66303.1|  hypothetical protein B456_010G134500                    187   4e-52   Gossypium raimondii
ref|XP_009339472.1|  PREDICTED: cellulose synthase A catalytic su...    187   5e-52   Pyrus x bretschneideri [bai li]
gb|EYU17481.1|  hypothetical protein MIMGU_mgv1a000527mg                187   5e-52   Erythranthe guttata [common monkey flower]
ref|XP_009782822.1|  PREDICTED: cellulose synthase A catalytic su...    187   5e-52   Nicotiana sylvestris
gb|AFY06685.1|  cellulose synthase                                      187   5e-52   Nicotiana tabacum [American tobacco]
ref|XP_008358296.1|  PREDICTED: cellulose synthase A catalytic su...    187   5e-52   
ref|XP_008381836.1|  PREDICTED: cellulose synthase A catalytic su...    187   5e-52   
ref|XP_011044242.1|  PREDICTED: cellulose synthase A catalytic su...    187   5e-52   Populus euphratica
ref|XP_008369157.1|  PREDICTED: cellulose synthase A catalytic su...    187   5e-52   
ref|XP_002524299.1|  Cellulose synthase A catalytic subunit 6 [UD...    187   5e-52   Ricinus communis
ref|XP_009609627.1|  PREDICTED: cellulose synthase A catalytic su...    187   7e-52   Nicotiana tomentosiformis
ref|XP_007199689.1|  hypothetical protein PRUPE_ppa000559mg             187   7e-52   Prunus persica
gb|AEI87569.1|  cellulose synthase catalytic subunit protein            187   7e-52   Nicotiana tabacum [American tobacco]
ref|XP_002306707.1|  CesA7A-like family protein                         187   7e-52   Populus trichocarpa [western balsam poplar]
gb|KJB59451.1|  hypothetical protein B456_009G255100                    187   9e-52   Gossypium raimondii
gb|KJB59449.1|  hypothetical protein B456_009G255100                    187   1e-51   Gossypium raimondii
gb|KHG29218.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    187   1e-51   Gossypium arboreum [tree cotton]
gb|EYU36833.1|  hypothetical protein MIMGU_mgv1a000540mg                186   1e-51   Erythranthe guttata [common monkey flower]
gb|EYU17480.1|  hypothetical protein MIMGU_mgv1a000527mg                185   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_004290503.1|  PREDICTED: cellulose synthase A catalytic su...    186   2e-51   Fragaria vesca subsp. vesca
gb|AAK49454.1|AF304374_1  cellulose synthase catalytic subunit          186   2e-51   Nicotiana alata [flowering tobacco]
gb|KJB59452.1|  hypothetical protein B456_009G255100                    185   2e-51   Gossypium raimondii
ref|XP_010241683.1|  PREDICTED: cellulose synthase A catalytic su...    186   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_009758840.1|  PREDICTED: cellulose synthase A catalytic su...    184   6e-51   Nicotiana sylvestris
gb|KJB59450.1|  hypothetical protein B456_009G255100                    183   7e-51   Gossypium raimondii
ref|XP_009629755.1|  PREDICTED: cellulose synthase A catalytic su...    184   1e-50   Nicotiana tomentosiformis
ref|XP_011042923.1|  PREDICTED: cellulose synthase A catalytic su...    183   1e-50   Populus euphratica
gb|AFZ78560.1|  cellulose synthase                                      184   1e-50   Populus tomentosa [Chinese white poplar]
gb|AFB18639.1|  CESA9                                                   183   1e-50   Gossypium hirsutum [American cotton]
ref|XP_008232182.1|  PREDICTED: cellulose synthase A catalytic su...    183   2e-50   Prunus mume [ume]
gb|KJB14950.1|  hypothetical protein B456_002G150300                    183   2e-50   Gossypium raimondii
gb|AFB18634.1|  CESA5                                                   183   2e-50   Gossypium hirsutum [American cotton]
ref|XP_007213713.1|  hypothetical protein PRUPE_ppa000567mg             182   3e-50   Prunus persica
gb|AEE60899.1|  cellulose synthase                                      182   3e-50   Populus tomentosa [Chinese white poplar]
gb|KDP35302.1|  hypothetical protein JCGZ_09461                         182   4e-50   Jatropha curcas
emb|CDP12843.1|  unnamed protein product                                182   4e-50   Coffea canephora [robusta coffee]
gb|KDO83761.1|  hypothetical protein CISIN_1g001373mg                   182   5e-50   Citrus sinensis [apfelsine]
gb|KDO83760.1|  hypothetical protein CISIN_1g001373mg                   182   5e-50   Citrus sinensis [apfelsine]
ref|XP_006473074.1|  PREDICTED: cellulose synthase A catalytic su...    182   5e-50   Citrus sinensis [apfelsine]
ref|XP_006434481.1|  hypothetical protein CICLE_v10000103mg             182   5e-50   Citrus clementina [clementine]
ref|XP_002307145.1|  cellulose synthase family protein                  182   5e-50   Populus trichocarpa [western balsam poplar]
gb|KHG02518.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    182   6e-50   Gossypium arboreum [tree cotton]
ref|XP_003531396.1|  PREDICTED: cellulose synthase A catalytic su...    182   6e-50   Glycine max [soybeans]
ref|XP_007048203.1|  Cellulose synthase 6                               182   6e-50   
gb|AAO25581.1|  cellulose synthase                                      181   9e-50   Populus tremuloides
gb|KDP30751.1|  hypothetical protein JCGZ_15180                         181   9e-50   Jatropha curcas
gb|AAT09898.1|  cellulose synthase                                      181   1e-49   Populus tremula x Populus tremuloides
ref|XP_007159799.1|  hypothetical protein PHAVU_002G268200g             181   1e-49   Phaseolus vulgaris [French bean]
ref|XP_011013550.1|  PREDICTED: cellulose synthase A catalytic su...    181   1e-49   Populus euphratica
ref|XP_011013552.1|  PREDICTED: cellulose synthase A catalytic su...    181   1e-49   Populus euphratica
ref|XP_011021978.1|  PREDICTED: cellulose synthase A catalytic su...    181   1e-49   Populus euphratica
ref|XP_011021980.1|  PREDICTED: cellulose synthase A catalytic su...    181   2e-49   Populus euphratica
ref|XP_010260984.1|  PREDICTED: cellulose synthase A catalytic su...    181   2e-49   Nelumbo nucifera [Indian lotus]
gb|KDO83763.1|  hypothetical protein CISIN_1g001373mg                   178   2e-49   Citrus sinensis [apfelsine]
ref|XP_007213712.1|  hypothetical protein PRUPE_ppa000567mg             178   3e-49   
ref|XP_003536418.1|  PREDICTED: cellulose synthase A catalytic su...    180   3e-49   Glycine max [soybeans]
gb|KHG24947.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    179   4e-49   Gossypium arboreum [tree cotton]
gb|AFZ78553.1|  cellulose synthase                                      179   4e-49   Populus tomentosa [Chinese white poplar]
gb|KJB18370.1|  hypothetical protein B456_003G049300                    179   5e-49   Gossypium raimondii
gb|KDO83762.1|  hypothetical protein CISIN_1g001373mg                   178   6e-49   Citrus sinensis [apfelsine]
gb|KJB18373.1|  hypothetical protein B456_003G049300                    179   6e-49   Gossypium raimondii
gb|EPS58530.1|  hypothetical protein M569_16283                         171   7e-49   Genlisea aurea
ref|XP_002310628.1|  cellulose synthase family protein                  179   7e-49   Populus trichocarpa [western balsam poplar]
ref|XP_002310629.1|  hypothetical protein POPTR_0007s07120g             179   8e-49   Populus trichocarpa [western balsam poplar]
ref|XP_004503981.1|  PREDICTED: cellulose synthase A catalytic su...    178   1e-48   Cicer arietinum [garbanzo]
ref|XP_007151999.1|  hypothetical protein PHAVU_004G093300g             178   1e-48   Phaseolus vulgaris [French bean]
ref|XP_010520165.1|  PREDICTED: cellulose synthase A catalytic su...    177   2e-48   Tarenaya hassleriana [spider flower]
gb|KJB18372.1|  hypothetical protein B456_003G049300                    177   2e-48   Gossypium raimondii
gb|KHN41284.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    176   3e-48   Glycine soja [wild soybean]
ref|XP_009350646.1|  PREDICTED: cellulose synthase A catalytic su...    177   3e-48   Pyrus x bretschneideri [bai li]
ref|XP_008338760.1|  PREDICTED: cellulose synthase A catalytic su...    177   3e-48   
ref|XP_009350645.1|  PREDICTED: cellulose synthase A catalytic su...    177   3e-48   
ref|XP_003630174.1|  Cellulose synthase A catalytic subunit             176   4e-48   Medicago truncatula
ref|XP_010680991.1|  PREDICTED: cellulose synthase A catalytic su...    176   5e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010547636.1|  PREDICTED: cellulose synthase A catalytic su...    175   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_010678670.1|  PREDICTED: cellulose synthase A catalytic su...    176   1e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007143558.1|  hypothetical protein PHAVU_007G081700g             175   1e-47   Phaseolus vulgaris [French bean]
gb|KEH43649.1|  cellulose synthase-like protein                         175   2e-47   Medicago truncatula
gb|AES62337.2|  cellulose synthase-like protein                         175   2e-47   Medicago truncatula
ref|XP_002864919.1|  hypothetical protein ARALYDRAFT_496689             175   2e-47   
ref|NP_201279.1|  cellulose synthase A catalytic subunit 6 [UDP-f...    174   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525098.1|  PREDICTED: cellulose synthase A catalytic su...    175   2e-47   Glycine max [soybeans]
gb|KHN34038.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    174   2e-47   Glycine soja [wild soybean]
ref|XP_008440995.1|  PREDICTED: cellulose synthase A catalytic su...    174   2e-47   Cucumis melo [Oriental melon]
ref|XP_010546378.1|  PREDICTED: cellulose synthase A catalytic su...    174   3e-47   Tarenaya hassleriana [spider flower]
ref|XP_010526630.1|  PREDICTED: cellulose synthase A catalytic su...    174   3e-47   Tarenaya hassleriana [spider flower]
ref|XP_006279743.1|  hypothetical protein CARUB_v10027598mg             174   3e-47   Capsella rubella
ref|XP_004141979.1|  PREDICTED: probable cellulose synthase A cat...    174   3e-47   Cucumis sativus [cucumbers]
ref|XP_003548102.1|  PREDICTED: cellulose synthase A catalytic su...    174   4e-47   Glycine max [soybeans]
gb|KHN00756.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    173   4e-47   Glycine soja [wild soybean]
ref|XP_003518592.1|  PREDICTED: cellulose synthase A catalytic su...    173   5e-47   Glycine max [soybeans]
gb|AHL45030.1|  cellulose synthase 6D                                   173   6e-47   Linum usitatissimum
gb|AHL45029.1|  cellulose synthase 6C                                   173   7e-47   Linum usitatissimum
gb|AGV22108.1|  cellulose synthase 6                                    173   7e-47   Betula luminifera [liang ye hua]
ref|XP_006399471.1|  hypothetical protein EUTSA_v10012521mg             173   8e-47   Eutrema salsugineum [saltwater cress]
ref|XP_010462809.1|  PREDICTED: cellulose synthase A catalytic su...    173   8e-47   Camelina sativa [gold-of-pleasure]
gb|AHL45027.1|  cellulose synthase 6A                                   172   1e-46   Linum usitatissimum
gb|KFK25282.1|  hypothetical protein AALP_AA8G091900                    172   1e-46   Arabis alpina [alpine rockcress]
ref|XP_002871389.1|  hypothetical protein ARALYDRAFT_908936             172   1e-46   Arabidopsis lyrata subsp. lyrata
ref|NP_196549.1|  cellulose synthase A catalytic subunit 5 [UDP-f...    172   1e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AHL45028.1|  cellulose synthase 6B                                   172   1e-46   Linum usitatissimum
ref|XP_009150553.1|  PREDICTED: cellulose synthase A catalytic su...    172   1e-46   Brassica rapa
emb|CDY08854.1|  BnaA06g23700D                                          172   1e-46   Brassica napus [oilseed rape]
emb|CDY14504.1|  BnaC03g49550D                                          172   1e-46   Brassica napus [oilseed rape]
ref|XP_010444419.1|  PREDICTED: cellulose synthase A catalytic su...    172   2e-46   Camelina sativa [gold-of-pleasure]
emb|CDY18696.1|  BnaA09g06990D                                          172   2e-46   Brassica napus [oilseed rape]
gb|AEK86669.1|  cellulose synthase 5                                    171   2e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81249.1|  BnaC09g06600D                                          172   2e-46   
ref|XP_009112155.1|  PREDICTED: cellulose synthase A catalytic su...    171   2e-46   Brassica rapa
dbj|BAF01335.1|  cellulose synthase                                     169   2e-46   Arabidopsis thaliana [mouse-ear cress]
gb|ACS68196.1|  cellulose synthase 6.1 catalytic subunit                171   3e-46   Brassica napus [oilseed rape]
ref|XP_010088737.1|  Isoxaben-resistant protein 2                       171   3e-46   Morus notabilis
gb|KDO57137.1|  hypothetical protein CISIN_1g001369mg                   171   3e-46   Citrus sinensis [apfelsine]
ref|XP_006427904.1|  hypothetical protein CICLE_v10024766mg             171   3e-46   Citrus clementina [clementine]
ref|XP_010491630.1|  PREDICTED: cellulose synthase A catalytic su...    171   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010452989.1|  PREDICTED: cellulose synthase A catalytic su...    171   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_003592086.1|  Cellulose synthase                                 171   5e-46   
ref|XP_002866842.1|  hypothetical protein ARALYDRAFT_490712             171   5e-46   
ref|XP_006411737.1|  hypothetical protein EUTSA_v10024277mg             169   1e-45   Eutrema salsugineum [saltwater cress]
ref|XP_010484268.1|  PREDICTED: cellulose synthase A catalytic su...    169   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010027732.1|  PREDICTED: cellulose synthase A catalytic su...    169   1e-45   Eucalyptus grandis [rose gum]
ref|XP_011090445.1|  PREDICTED: cellulose synthase A catalytic su...    169   1e-45   Sesamum indicum [beniseed]
ref|XP_006286951.1|  hypothetical protein CARUB_v10000099mg             169   2e-45   Capsella rubella
emb|CDY31305.1|  BnaA02g34360D                                          169   2e-45   Brassica napus [oilseed rape]
gb|KDO57138.1|  hypothetical protein CISIN_1g001369mg                   167   2e-45   Citrus sinensis [apfelsine]
gb|AAC29067.1|  cellulose synthase                                      169   2e-45   Arabidopsis thaliana [mouse-ear cress]
gb|EYU31127.1|  hypothetical protein MIMGU_mgv1a000549mg                169   3e-45   Erythranthe guttata [common monkey flower]
gb|KJB18371.1|  hypothetical protein B456_003G049300                    167   3e-45   Gossypium raimondii
ref|XP_009130469.1|  PREDICTED: cellulose synthase A catalytic su...    168   4e-45   Brassica rapa
ref|NP_195645.1|  cellulose synthase A catalytic subunit 2 [UDP-f...    167   6e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283042.1|  hypothetical protein CARUB_v10004034mg             167   7e-45   Capsella rubella
ref|XP_002277635.1|  PREDICTED: cellulose synthase A catalytic su...    167   7e-45   Vitis vinifera
emb|CDY46820.1|  BnaC02g43280D                                          167   8e-45   Brassica napus [oilseed rape]
emb|CBI21555.3|  unnamed protein product                                167   8e-45   Vitis vinifera
gb|KHG03006.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    167   9e-45   Gossypium arboreum [tree cotton]
emb|CDY42621.1|  BnaC01g00330D                                          167   1e-44   Brassica napus [oilseed rape]
ref|XP_009115076.1|  PREDICTED: cellulose synthase A catalytic su...    166   2e-44   Brassica rapa
emb|CDY41973.1|  BnaA01g05450D                                          166   2e-44   Brassica napus [oilseed rape]
gb|ACS68191.1|  cellulose synthase 2.1 catalytic subunit                166   2e-44   Brassica napus [oilseed rape]
ref|XP_010437052.1|  PREDICTED: cellulose synthase A catalytic su...    166   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010431901.1|  PREDICTED: cellulose synthase A catalytic su...    166   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002878571.1|  hypothetical protein ARALYDRAFT_900606             166   2e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_009131129.1|  PREDICTED: cellulose synthase A catalytic su...    166   3e-44   Brassica rapa
emb|CDY56540.1|  BnaA03g55860D                                          165   3e-44   Brassica napus [oilseed rape]
emb|CDX81145.1|  BnaC03g03990D                                          165   5e-44   
gb|ACS68195.1|  cellulose synthase 5.1 catalytic subunit                165   5e-44   Brassica napus [oilseed rape]
ref|XP_006394118.1|  hypothetical protein EUTSA_v100035740mg            162   2e-43   
ref|XP_006847152.1|  hypothetical protein AMTR_s00017p00239550          163   2e-43   Amborella trichopoda
ref|NP_179768.1|  cellulose synthase A9                                 161   9e-43   Arabidopsis thaliana [mouse-ear cress]
gb|EPS71230.1|  hypothetical protein M569_03522                         161   1e-42   Genlisea aurea
ref|XP_004502891.1|  PREDICTED: cellulose synthase A catalytic su...    160   3e-42   Cicer arietinum [garbanzo]
ref|XP_006427905.1|  hypothetical protein CICLE_v10024766mg             159   3e-42   
ref|XP_010446473.1|  PREDICTED: cellulose synthase A catalytic su...    159   6e-42   Camelina sativa [gold-of-pleasure]
gb|EPS66740.1|  hypothetical protein M569_08032                         158   1e-41   Genlisea aurea
ref|XP_010063847.1|  PREDICTED: cellulose synthase A catalytic su...    158   2e-41   Eucalyptus grandis [rose gum]
ref|XP_010063851.1|  PREDICTED: cellulose synthase A catalytic su...    157   3e-41   Eucalyptus grandis [rose gum]
ref|XP_006351001.1|  PREDICTED: cellulose synthase A catalytic su...    156   6e-41   Solanum tuberosum [potatoes]
gb|AFD33697.1|  cellulose synthase A                                    156   7e-41   Eucalyptus camaldulensis
ref|XP_010312466.1|  PREDICTED: cellulose synthase A catalytic su...    155   2e-40   Solanum lycopersicum
gb|KHG02517.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    153   1e-39   Gossypium arboreum [tree cotton]
ref|XP_010927397.1|  PREDICTED: cellulose synthase A catalytic su...    143   2e-36   Elaeis guineensis
gb|ACJ38667.1|  cellulose synthase                                      138   1e-34   Betula luminifera [liang ye hua]
ref|XP_009414591.1|  PREDICTED: cellulose synthase A catalytic su...    137   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417280.1|  PREDICTED: probable cellulose synthase A cat...    137   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011079380.1|  PREDICTED: cellulose synthase A catalytic su...    136   4e-34   Sesamum indicum [beniseed]
ref|XP_011079381.1|  PREDICTED: cellulose synthase A catalytic su...    136   5e-34   
ref|XP_002963550.1|  family 2 glycosyltransferase                       136   5e-34   
ref|XP_011079382.1|  PREDICTED: cellulose synthase A catalytic su...    136   5e-34   
ref|XP_009408434.1|  PREDICTED: probable cellulose synthase A cat...    136   5e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU35355.1|  hypothetical protein MIMGU_mgv1a000638mg                136   6e-34   Erythranthe guttata [common monkey flower]
ref|XP_009385959.1|  PREDICTED: probable cellulose synthase A cat...    135   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011083940.1|  PREDICTED: cellulose synthase A catalytic su...    135   2e-33   Sesamum indicum [beniseed]
ref|XP_010912005.1|  PREDICTED: cellulose synthase A catalytic su...    135   2e-33   Elaeis guineensis
ref|XP_006849886.1|  hypothetical protein AMTR_s00022p00086120          135   2e-33   Amborella trichopoda
ref|XP_009777624.1|  PREDICTED: cellulose synthase A catalytic su...    134   2e-33   Nicotiana sylvestris
ref|XP_009622822.1|  PREDICTED: cellulose synthase A catalytic su...    134   2e-33   Nicotiana tomentosiformis
ref|XP_009622821.1|  PREDICTED: cellulose synthase A catalytic su...    134   2e-33   Nicotiana tomentosiformis
ref|XP_010932185.1|  PREDICTED: probable cellulose synthase A cat...    134   3e-33   Elaeis guineensis
ref|XP_008796456.1|  PREDICTED: probable cellulose synthase A cat...    134   3e-33   Phoenix dactylifera
gb|AFW69155.1|  putative cellulose synthase family protein              134   3e-33   
ref|XP_004242614.1|  PREDICTED: cellulose synthase A catalytic su...    134   4e-33   Solanum lycopersicum
ref|XP_004956855.1|  PREDICTED: cellulose synthase A catalytic su...    134   4e-33   Setaria italica
ref|XP_002460229.1|  hypothetical protein SORBIDRAFT_02g025020          134   4e-33   Sorghum bicolor [broomcorn]
ref|XP_006660635.1|  PREDICTED: cellulose synthase A catalytic su...    134   4e-33   Oryza brachyantha
ref|NP_001105532.1|  cellulose synthase catalytic subunit 12            134   5e-33   Zea mays [maize]
ref|XP_008670200.1|  PREDICTED: cellulose synthase A catalytic su...    134   5e-33   
dbj|BAM05574.1|  cellulose synthase 3                                   130   5e-33   Eucalyptus pyrocarpa
ref|XP_002277713.1|  PREDICTED: probable cellulose synthase A cat...    134   5e-33   Vitis vinifera
ref|XP_006343620.1|  PREDICTED: cellulose synthase A catalytic su...    133   6e-33   Solanum tuberosum [potatoes]
gb|KCW70399.1|  hypothetical protein EUGRSUZ_F03635                     133   6e-33   Eucalyptus grandis [rose gum]
ref|XP_010687624.1|  PREDICTED: cellulose synthase A catalytic su...    133   6e-33   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA61529.1|  TPA: putative cellulose synthase family protein        133   7e-33   
ref|XP_010250039.1|  PREDICTED: probable cellulose synthase A cat...    133   7e-33   Nelumbo nucifera [Indian lotus]
emb|CAN73700.1|  hypothetical protein VITISV_013112                     133   7e-33   Vitis vinifera
ref|XP_008785840.1|  PREDICTED: cellulose synthase A catalytic su...    133   7e-33   Phoenix dactylifera
ref|XP_002319002.2|  cellulose synthase 6 family protein                133   7e-33   
gb|KCW78813.1|  hypothetical protein EUGRSUZ_C00246                     133   7e-33   Eucalyptus grandis [rose gum]
ref|NP_001289648.1|  probable cellulose synthase A catalytic subu...    133   8e-33   Eucalyptus grandis [rose gum]
gb|KCW78814.1|  hypothetical protein EUGRSUZ_C00246                     133   8e-33   Eucalyptus grandis [rose gum]
gb|KCW78812.1|  hypothetical protein EUGRSUZ_C00246                     133   8e-33   Eucalyptus grandis [rose gum]
ref|NP_001289644.1|  cellulose synthase A catalytic subunit 7           133   8e-33   Eucalyptus grandis [rose gum]
gb|AGJ71354.1|  cellulose synthase 3                                    133   8e-33   Eucalyptus urophylla
gb|AFR58756.2|  cellulose synthase 3                                    133   8e-33   Eucalyptus tereticornis [red ironbark]
gb|AEK31217.1|  cellulose synthase A                                    133   8e-33   Eucalyptus camaldulensis
gb|KCW78815.1|  hypothetical protein EUGRSUZ_C00246                     133   8e-33   Eucalyptus grandis [rose gum]
gb|AGE09566.1|  cellulose synthase-like protein                         133   8e-33   Eucalyptus cladocalyx
gb|KDP36709.1|  hypothetical protein JCGZ_08000                         133   8e-33   Jatropha curcas
gb|KCW70400.1|  hypothetical protein EUGRSUZ_F03635                     133   8e-33   Eucalyptus grandis [rose gum]
ref|XP_008794369.1|  PREDICTED: cellulose synthase A catalytic su...    133   8e-33   Phoenix dactylifera
gb|AFP93559.1|  cellulose synthase A1                                   133   9e-33   Neolamarckia cadamba
ref|XP_010091161.1|  OsCesA7 protein                                    133   9e-33   Morus notabilis
gb|EPS60781.1|  hypothetical protein M569_14019                         133   9e-33   Genlisea aurea
ref|XP_006842872.1|  hypothetical protein AMTR_s00081p00171100          133   9e-33   Amborella trichopoda
ref|XP_010929171.1|  PREDICTED: cellulose synthase A catalytic su...    133   1e-32   Elaeis guineensis
gb|KHG11460.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    132   1e-32   Gossypium arboreum [tree cotton]
ref|XP_002276890.2|  PREDICTED: cellulose synthase A catalytic su...    132   1e-32   Vitis vinifera
ref|XP_003598145.1|  Cellulose synthase                                 132   1e-32   Medicago truncatula
emb|CDP02834.1|  unnamed protein product                                132   1e-32   Coffea canephora [robusta coffee]
ref|XP_010265522.1|  PREDICTED: cellulose synthase A catalytic su...    132   1e-32   Nelumbo nucifera [Indian lotus]
gb|KHG19749.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    132   1e-32   Gossypium arboreum [tree cotton]
dbj|BAJ85783.1|  predicted protein                                      132   1e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB53884.1|  hypothetical protein B456_009G009700                    132   1e-32   Gossypium raimondii
gb|AFB18637.1|  CESA8                                                   132   1e-32   Gossypium hirsutum [American cotton]
gb|AFB18636.1|  CESA7                                                   132   1e-32   Gossypium hirsutum [American cotton]
gb|KJB07762.1|  hypothetical protein B456_001G044700                    132   1e-32   Gossypium raimondii
ref|NP_001051830.1|  Os03g0837100                                       132   2e-32   
ref|XP_010254360.1|  PREDICTED: probable cellulose synthase A cat...    132   2e-32   Nelumbo nucifera [Indian lotus]
gb|KJB07761.1|  hypothetical protein B456_001G044700                    132   2e-32   Gossypium raimondii
ref|XP_008450511.1|  PREDICTED: cellulose synthase A catalytic su...    132   2e-32   Cucumis melo [Oriental melon]
ref|XP_008796554.1|  PREDICTED: probable cellulose synthase A cat...    132   2e-32   Phoenix dactylifera
ref|XP_009410192.1|  PREDICTED: cellulose synthase A catalytic su...    132   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADD71499.1|  cellulose synthase catalytic subunit                    132   2e-32   Gossypium hirsutum [American cotton]
gb|AFI71895.1|  cellulose synthase 6                                    132   2e-32   Paeonia lactiflora [common garden peony]
ref|XP_010927484.1|  PREDICTED: probable cellulose synthase A cat...    132   2e-32   Elaeis guineensis
ref|XP_008790154.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    132   2e-32   Phoenix dactylifera
dbj|BAJ05813.1|  cellulose synthase catalytic subunit                   132   2e-32   Oryza sativa Indica Group [Indian rice]
ref|NP_001063207.1|  Os09g0422500                                       132   2e-32   
gb|AAM26299.1|  cellulose synthase                                      132   2e-32   Populus tremuloides
ref|XP_010270654.1|  PREDICTED: probable cellulose synthase A cat...    132   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010905024.1|  PREDICTED: cellulose synthase A catalytic su...    132   2e-32   Elaeis guineensis
gb|KCW81421.1|  hypothetical protein EUGRSUZ_C02801                     132   2e-32   Eucalyptus grandis [rose gum]
ref|XP_002325122.1|  cellulose synthase family protein                  132   2e-32   
gb|AAP40636.1|  cellulose synthase 6                                    132   2e-32   Populus tremuloides
emb|CBI40805.3|  unnamed protein product                                131   3e-32   Vitis vinifera
ref|XP_007013859.1|  Cellulose synthase family protein isoform 1        131   3e-32   
ref|XP_011023647.1|  PREDICTED: probable cellulose synthase A cat...    131   3e-32   Populus euphratica
ref|XP_004287144.1|  PREDICTED: cellulose synthase A catalytic su...    131   3e-32   Fragaria vesca subsp. vesca
gb|ADV58936.1|  cellulose synthase                                      131   3e-32   Populus ussuriensis
gb|ADR74043.1|  cellulose synthase                                      131   3e-32   Populus ussuriensis
emb|CDP13491.1|  unnamed protein product                                131   3e-32   Coffea canephora [robusta coffee]
ref|NP_001289657.1|  cellulose synthase A catalytic subunit 1           131   3e-32   Eucalyptus grandis [rose gum]
ref|XP_004238519.1|  PREDICTED: probable cellulose synthase A cat...    131   3e-32   Solanum lycopersicum
ref|XP_010273667.1|  PREDICTED: cellulose synthase A catalytic su...    131   3e-32   Nelumbo nucifera [Indian lotus]
gb|AFZ78551.1|  cellulose synthase                                      131   3e-32   Populus tomentosa [Chinese white poplar]
ref|XP_011033387.1|  PREDICTED: cellulose synthase A catalytic su...    131   3e-32   Populus euphratica
ref|XP_011018058.1|  PREDICTED: cellulose synthase A catalytic su...    131   3e-32   
gb|AEK31219.1|  cellulose synthase A                                    131   4e-32   
gb|AEE60897.1|  cellulose synthase                                      130   5e-32   
ref|XP_006354075.1|  PREDICTED: probable cellulose synthase A cat...    131   5e-32   
ref|XP_004507755.1|  PREDICTED: cellulose synthase A catalytic su...    130   5e-32   
ref|XP_010925238.1|  PREDICTED: probable cellulose synthase A cat...    130   5e-32   
ref|XP_008784981.1|  PREDICTED: probable cellulose synthase A cat...    130   5e-32   
gb|KEH32618.1|  cellulose synthase-like protein                         130   5e-32   
ref|XP_003610282.1|  Cellulose synthase catalytic subunit               130   5e-32   
gb|AFZ78555.1|  cellulose synthase                                      130   6e-32   
gb|ACC59196.1|  cellulose synthase                                      130   6e-32   
gb|ACJ38665.1|  cellulose synthase                                      130   6e-32   
ref|XP_008243020.1|  PREDICTED: cellulose synthase A catalytic su...    130   7e-32   
ref|XP_007204670.1|  hypothetical protein PRUPE_ppa000618mg             130   7e-32   
gb|AII73574.1|  cellulose synthase 7-A                                  130   7e-32   
gb|EYU17477.1|  hypothetical protein MIMGU_mgv1a016004mg                121   7e-32   
ref|XP_010914890.1|  PREDICTED: probable cellulose synthase A cat...    130   7e-32   
gb|AGV22109.1|  cellulose synthase 7                                    130   8e-32   
gb|KJB07760.1|  hypothetical protein B456_001G044700                    129   8e-32   
ref|XP_003522926.1|  PREDICTED: cellulose synthase A catalytic su...    130   8e-32   
ref|XP_006826669.1|  hypothetical protein AMTR_s00137p00043990          130   8e-32   
ref|XP_004152851.1|  PREDICTED: cellulose synthase A catalytic su...    130   9e-32   
ref|XP_010270659.1|  PREDICTED: probable cellulose synthase A cat...    130   9e-32   
ref|XP_009366208.1|  PREDICTED: cellulose synthase A catalytic su...    130   9e-32   
ref|XP_008366693.1|  PREDICTED: cellulose synthase A catalytic su...    130   9e-32   
gb|AGX27222.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27212.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27231.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27219.1|  cellulose synthase 7                                    130   1e-31   
ref|XP_008394069.1|  PREDICTED: cellulose synthase A catalytic su...    130   1e-31   
gb|AGX27238.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27236.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27233.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27229.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27223.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27220.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27216.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27215.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27207.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27206.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27205.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27203.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27202.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27201.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27199.1|  cellulose synthase 7                                    130   1e-31   
gb|AFZ78559.1|  cellulose synthase                                      130   1e-31   
gb|AGX27235.1|  cellulose synthase 7                                    130   1e-31   
gb|AGX27211.1|  cellulose synthase 7                                    130   1e-31   
gb|AGC97433.2|  cellulose synthase                                      130   1e-31   
gb|AGX27214.1|  cellulose synthase 7                                    130   1e-31   
ref|XP_008362868.1|  PREDICTED: cellulose synthase A catalytic su...    130   1e-31   
gb|AFW81389.1|  cellulose synthase1                                     130   1e-31   
gb|AFW81388.1|  cellulose synthase1                                     129   1e-31   
gb|AHH81946.1|  cellulose synthase                                      129   1e-31   
ref|XP_006381880.1|  hypothetical protein POPTR_0006s19580g             129   1e-31   
ref|XP_007018605.1|  Cellulose synthase 6                               129   1e-31   
ref|XP_002308412.1|  cellulose synthase family protein                  129   1e-31   
ref|XP_009358418.1|  PREDICTED: cellulose synthase A catalytic su...    129   1e-31   
ref|XP_009355721.1|  PREDICTED: cellulose synthase A catalytic su...    129   1e-31   
gb|KCW81422.1|  hypothetical protein EUGRSUZ_C02801                     129   1e-31   
dbj|BAG06269.1|  cellulose synthase Z811                                129   1e-31   
ref|XP_006382504.1|  cellulose synthase 6 family protein                129   1e-31   
ref|XP_006453581.1|  hypothetical protein CICLE_v10007321mg             129   1e-31   
ref|XP_007154868.1|  hypothetical protein PHAVU_003G154600g             129   1e-31   
ref|XP_006474028.1|  PREDICTED: cellulose synthase A catalytic su...    129   1e-31   
ref|XP_006474027.1|  PREDICTED: cellulose synthase A catalytic su...    129   1e-31   
gb|KDO62270.1|  hypothetical protein CISIN_1g039060mg                   129   2e-31   
gb|AAX18649.1|  cellulose synthase catalytic subunit                    129   2e-31   
gb|KHN17507.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    129   2e-31   
dbj|BAF93202.1|  cellulose synthase catalytic subunit                   129   2e-31   
ref|XP_002533228.1|  Cellulose synthase A catalytic subunit 3 [UD...    129   2e-31   
ref|XP_011036833.1|  PREDICTED: probable cellulose synthase A cat...    129   2e-31   
gb|AFS95066.1|  cellulose synthase                                      129   2e-31   
gb|AAT57672.1|  cellulose synthase catalytic subunit                    129   2e-31   
gb|KHN14136.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    129   2e-31   
ref|XP_006651997.1|  PREDICTED: probable cellulose synthase A cat...    129   2e-31   
gb|AFZ78563.1|  cellulose synthase                                      129   2e-31   
ref|XP_003519160.1|  PREDICTED: cellulose synthase A catalytic su...    129   2e-31   
ref|XP_003549532.1|  PREDICTED: cellulose synthase A catalytic su...    129   2e-31   
ref|XP_006600535.1|  PREDICTED: cellulose synthase A catalytic su...    129   2e-31   
ref|NP_001104954.1|  cellulose synthase-1                               129   2e-31   
ref|XP_011036830.1|  PREDICTED: probable cellulose synthase A cat...    129   2e-31   
ref|XP_010266321.1|  PREDICTED: probable cellulose synthase A cat...    129   2e-31   
gb|KDO85323.1|  hypothetical protein CISIN_1g045222mg                   129   2e-31   
ref|XP_006435515.1|  hypothetical protein CICLE_v10000117mg             129   2e-31   
gb|ACT67415.1|  cellulose synthase                                      129   2e-31   
gb|KEH32617.1|  cellulose synthase-like protein                         128   3e-31   
ref|XP_007138395.1|  hypothetical protein PHAVU_009G205100g             129   3e-31   
ref|XP_010545449.1|  PREDICTED: cellulose synthase A catalytic su...    129   3e-31   
ref|XP_007013860.1|  Cellulose synthase family protein isoform 2        127   3e-31   
gb|AFR38707.1|  cellulose synthase                                      118   3e-31   
ref|XP_003527198.1|  PREDICTED: cellulose synthase A catalytic su...    128   3e-31   
gb|AFR38732.1|  cellulose synthase                                      118   4e-31   
gb|EYU32338.1|  hypothetical protein MIMGU_mgv1a000544mg                128   4e-31   
ref|XP_003568832.2|  PREDICTED: probable cellulose synthase A cat...    128   4e-31   
gb|AEE60896.1|  cellulose synthase                                      128   4e-31   
gb|AFR38724.1|  cellulose synthase                                      118   4e-31   
gb|AFR38726.1|  cellulose synthase                                      118   4e-31   
gb|AFR38723.1|  cellulose synthase                                      118   4e-31   
gb|AFR38730.1|  cellulose synthase                                      118   4e-31   
gb|KEH32616.1|  cellulose synthase-like protein                         127   4e-31   
ref|XP_010648652.1|  PREDICTED: cellulose synthase A catalytic su...    128   4e-31   
ref|XP_006664834.1|  PREDICTED: probable cellulose synthase A cat...    128   5e-31   
gb|EEE67058.1|  hypothetical protein OsJ_24012                          128   5e-31   
ref|XP_004291468.1|  PREDICTED: cellulose synthase A catalytic su...    128   5e-31   
ref|XP_011459196.1|  PREDICTED: cellulose synthase A catalytic su...    128   5e-31   
ref|NP_001059487.1|  Os07g0424400                                       128   5e-31   
ref|XP_002440694.1|  hypothetical protein SORBIDRAFT_09g005280          128   5e-31   
gb|AAY43217.1|  cellulose synthase BoCesA1                              128   5e-31   
gb|AHL45024.1|  cellulose synthase 1B                                   127   6e-31   
ref|XP_006494425.1|  PREDICTED: probable cellulose synthase A cat...    127   6e-31   
ref|XP_010266322.1|  PREDICTED: probable cellulose synthase A cat...    127   6e-31   
ref|XP_008387657.1|  PREDICTED: cellulose synthase A catalytic su...    127   6e-31   
ref|XP_008792060.1|  PREDICTED: probable cellulose synthase A cat...    127   7e-31   
ref|XP_004981133.1|  PREDICTED: probable cellulose synthase A cat...    127   1e-30   
ref|XP_006400279.1|  hypothetical protein EUTSA_v10012538mg             127   1e-30   
ref|XP_008219478.1|  PREDICTED: cellulose synthase A catalytic su...    127   1e-30   
ref|XP_007221583.1|  hypothetical protein PRUPE_ppa000611mg             127   1e-30   
ref|XP_004981131.1|  PREDICTED: probable cellulose synthase A cat...    127   1e-30   
gb|EMT30130.1|  Cellulose synthase A catalytic subunit 9 (UDP-for...    127   1e-30   
ref|XP_009411928.1|  PREDICTED: cellulose synthase A catalytic su...    127   1e-30   
ref|XP_003578137.1|  PREDICTED: cellulose synthase A catalytic su...    127   1e-30   
gb|AFM37966.1|  cellulose synthase catalytic subunit                    127   1e-30   
emb|CBI21020.3|  unnamed protein product                                126   1e-30   
ref|XP_010238067.1|  PREDICTED: probable cellulose synthase A cat...    127   1e-30   
ref|XP_002873827.1|  hypothetical protein ARALYDRAFT_909737             127   1e-30   
ref|NP_001105574.1|  cellulose synthase2                                127   1e-30   
gb|ABI78958.1|  cellulose synthase 5                                    127   1e-30   
ref|XP_004300066.1|  PREDICTED: probable cellulose synthase A cat...    127   1e-30   
gb|ACS68197.1|  cellulose synthase 7.1 catalytic subunit                126   1e-30   
ref|XP_001757887.1|  cellulose synthase 5, glycosyltransferase fa...    126   1e-30   
ref|XP_010238134.1|  PREDICTED: probable cellulose synthase A cat...    126   1e-30   
ref|XP_008394301.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    126   2e-30   
gb|AFR38984.1|  cellulose synthase                                      116   2e-30   
ref|XP_006286973.1|  hypothetical protein CARUB_v10000119mg             126   2e-30   
gb|ACR38558.1|  unknown                                                 124   2e-30   
ref|XP_009131595.1|  PREDICTED: cellulose synthase A catalytic su...    126   2e-30   
gb|AHL45023.1|  cellulose synthase 1A                                   126   2e-30   
ref|XP_004965873.1|  PREDICTED: probable cellulose synthase A cat...    126   2e-30   
dbj|BAM05571.1|  cellulose synthase 3                                   120   2e-30   
gb|KHG22630.1|  Cellulose synthase A catalytic subunit 9 [UDP-for...    120   2e-30   
gb|ACL36367.1|  cellulose synthase CesA9                                120   2e-30   
ref|XP_007210416.1|  hypothetical protein PRUPE_ppa000557mg             126   3e-30   
ref|XP_008233413.1|  PREDICTED: probable cellulose synthase A cat...    126   3e-30   
ref|XP_004956059.1|  PREDICTED: probable cellulose synthase A cat...    126   3e-30   
gb|KHG19971.1|  Cellulose synthase A catalytic subunit 9 [UDP-for...    120   3e-30   
ref|XP_010525969.1|  PREDICTED: cellulose synthase A catalytic su...    125   3e-30   
ref|XP_010110357.1|  Protein radially swollen 1                         125   3e-30   
ref|XP_004956058.1|  PREDICTED: probable cellulose synthase A cat...    125   3e-30   
ref|XP_009617930.1|  PREDICTED: probable cellulose synthase A cat...    125   3e-30   
ref|XP_009617929.1|  PREDICTED: probable cellulose synthase A cat...    125   3e-30   
gb|ACL36368.1|  cellulose synthase CesA10                               120   3e-30   
ref|XP_010645442.1|  PREDICTED: probable cellulose synthase A cat...    125   4e-30   
ref|XP_010238033.1|  PREDICTED: probable cellulose synthase A cat...    125   4e-30   
gb|KFK25953.1|  hypothetical protein AALP_AA8G184200                    125   4e-30   
ref|XP_010453934.1|  PREDICTED: cellulose synthase A catalytic su...    125   4e-30   
ref|XP_010420462.1|  PREDICTED: cellulose synthase A catalytic su...    125   4e-30   
ref|XP_010492694.1|  PREDICTED: cellulose synthase A catalytic su...    125   4e-30   
ref|XP_010453933.1|  PREDICTED: cellulose synthase A catalytic su...    125   4e-30   
ref|XP_010420461.1|  PREDICTED: cellulose synthase A catalytic su...    125   4e-30   
gb|KFK25952.1|  hypothetical protein AALP_AA8G184200                    125   4e-30   
ref|XP_003562886.1|  PREDICTED: probable cellulose synthase A cat...    125   4e-30   
gb|AAD32031.1|AF088917_1  cellulose synthase catalytic subunit          125   4e-30   
ref|XP_001757832.1|  predicted protein                                  125   4e-30   
ref|NP_197244.1|  cellulose synthase A catalytic subunit 7 [UDP-f...    125   4e-30   
ref|XP_006654097.1|  PREDICTED: probable cellulose synthase A cat...    125   4e-30   
ref|XP_004956061.1|  PREDICTED: probable cellulose synthase A cat...    125   5e-30   
ref|XP_004956060.1|  PREDICTED: probable cellulose synthase A cat...    125   5e-30   
ref|XP_010255732.1|  PREDICTED: probable cellulose synthase A cat...    125   5e-30   
ref|XP_010255731.1|  PREDICTED: probable cellulose synthase A cat...    125   5e-30   
ref|XP_011071168.1|  PREDICTED: cellulose synthase A catalytic su...    125   5e-30   
gb|KHN07088.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    125   5e-30   
ref|XP_007137035.1|  hypothetical protein PHAVU_009G094200g             125   5e-30   
ref|XP_003526416.1|  PREDICTED: cellulose synthase A catalytic su...    125   5e-30   
emb|CAN60659.1|  hypothetical protein VITISV_018069                     125   5e-30   
gb|KHN08123.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    125   6e-30   
ref|XP_008648127.1|  PREDICTED: cellulose synthase6 isoform X1          125   6e-30   
ref|XP_003522623.1|  PREDICTED: cellulose synthase A catalytic su...    125   6e-30   
ref|XP_002960719.1|  hypothetical protein SELMODRAFT_73698              125   6e-30   
ref|XP_002983952.1|  family 2 glycosyltransferase                       125   6e-30   
ref|XP_011081578.1|  PREDICTED: cellulose synthase A catalytic su...    125   6e-30   
ref|XP_009126184.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    125   6e-30   
gb|AFR39009.1|  cellulose synthase                                      115   6e-30   
ref|XP_002960291.1|  family 2 glycosyltransferase                       124   7e-30   
ref|XP_002967423.1|  hypothetical protein SELMODRAFT_86720              124   7e-30   
ref|XP_002466137.1|  hypothetical protein SORBIDRAFT_01g002050          124   7e-30   
ref|XP_010526207.1|  PREDICTED: cellulose synthase A catalytic su...    124   7e-30   
gb|AAY43224.2|  cellulose synthase BoCesA7                              124   8e-30   
emb|CDX85455.1|  BnaA02g03580D                                          124   8e-30   
emb|CBI37703.3|  unnamed protein product                                124   9e-30   
gb|AFR38735.1|  cellulose synthase                                      114   1e-29   
ref|NP_001104957.1|  cellulose synthase7                                124   1e-29   
gb|AAT66940.1|  CesA1                                                   124   1e-29   
ref|XP_009768318.1|  PREDICTED: cellulose synthase A catalytic su...    124   1e-29   
gb|ACQ99194.1|  cellulose synthase                                      124   2e-29   
gb|KJB49074.1|  hypothetical protein B456_008G100100                    117   3e-29   
ref|XP_007013842.1|  Cellulose synthase 1                               123   3e-29   
ref|XP_010047060.1|  PREDICTED: cellulose synthase A catalytic su...    123   3e-29   
ref|XP_010048223.1|  PREDICTED: cellulose synthase A catalytic su...    123   3e-29   
ref|XP_006450469.1|  hypothetical protein CICLE_v10007296mg             123   3e-29   
gb|KDP33612.1|  hypothetical protein JCGZ_07183                         122   3e-29   
gb|KGN60109.1|  hypothetical protein Csa_3G878780                       122   4e-29   
ref|XP_002515536.1|  Cellulose synthase A catalytic subunit 6 [UD...    122   4e-29   
ref|XP_004136343.1|  PREDICTED: cellulose synthase A catalytic su...    122   4e-29   
ref|XP_006285557.1|  hypothetical protein CARUB_v10006999mg             122   4e-29   
ref|NP_001054788.1|  Os05g0176100                                       122   4e-29   
ref|XP_004499618.1|  PREDICTED: probable cellulose synthase A cat...    122   5e-29   
ref|XP_004960821.1|  PREDICTED: probable cellulose synthase A cat...    122   5e-29   
ref|NP_194967.1|  cellulose synthase A catalytic subunit 1 [UDP-f...    122   5e-29   
ref|XP_002867245.1|  hypothetical protein ARALYDRAFT_491486             122   5e-29   
ref|XP_004960820.1|  PREDICTED: probable cellulose synthase A cat...    122   5e-29   
gb|AAC39333.1|  RSW1-like cellulose synthase catalytic subunit          120   6e-29   
ref|XP_004955913.1|  PREDICTED: probable cellulose synthase A cat...    122   6e-29   
ref|XP_002308657.1|  cellulose synthase family protein                  122   6e-29   
ref|XP_004245031.1|  PREDICTED: cellulose synthase A catalytic su...    122   6e-29   
ref|XP_009623502.1|  PREDICTED: cellulose synthase A catalytic su...    122   7e-29   
gb|AFZ78556.1|  cellulose synthase                                      122   7e-29   
ref|XP_002324291.1|  TGACG-motif binding family protein                 122   8e-29   
ref|XP_011039709.1|  PREDICTED: cellulose synthase A catalytic su...    122   8e-29   
ref|XP_007148742.1|  hypothetical protein PHAVU_005G010400g             121   8e-29   
ref|XP_007148743.1|  hypothetical protein PHAVU_005G010400g             121   8e-29   



>ref|XP_002265955.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Vitis vinifera]
Length=1096

 Score =   194 bits (492),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_006364140.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Solanum tuberosum]
Length=1084

 Score =   193 bits (490),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDELEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>emb|CBI18221.3| unnamed protein product [Vitis vinifera]
Length=1067

 Score =   193 bits (490),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_004252570.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum lycopersicum]
Length=1083

 Score =   193 bits (490),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDELEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>dbj|BAG06272.1| cellulose synthase Z632 [Zinnia elegans]
Length=1090

 Score =   192 bits (487),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 81/85 (95%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFP+CRPCYEYERREGNQACPQCK
Sbjct  61   CAFPICRPCYEYERREGNQACPQCK  85



>ref|XP_011074751.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Sesamum indicum]
Length=1092

 Score =   191 bits (486),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKEL+GQICQICGDE+E TVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELTGQICQICGDEIEFTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_011101270.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Sesamum indicum]
Length=1084

 Score =   191 bits (485),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+E TVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEFTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|AIA61439.1| cellulose synthase [Boehmeria nivea]
Length=1090

 Score =   191 bits (484),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_009765335.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1084

 Score =   191 bits (484),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVD EPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDEEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_009599913.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1084

 Score =   191 bits (484),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVD EPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDEEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|AGV22110.1| cellulose synthase 8 [Betula luminifera]
Length=1091

 Score =   190 bits (483),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEF+LINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFILINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_007019545.1| Cellulose synthase 6 [Theobroma cacao]
 gb|EOY16770.1| Cellulose synthase 6 [Theobroma cacao]
Length=1091

 Score =   190 bits (483),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADEI RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>emb|CDP11417.1| unnamed protein product [Coffea canephora]
Length=1096

 Score =   190 bits (483),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 83/85 (98%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+E TVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEFTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_004138382.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004160741.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cucumis sativus]
Length=1090

 Score =   190 bits (483),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_008463088.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Cucumis melo]
Length=1090

 Score =   190 bits (483),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_008463087.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Cucumis melo]
Length=1091

 Score =   190 bits (483),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|AFZ78561.1| cellulose synthase [Populus tomentosa]
Length=1097

 Score =   189 bits (479),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+EITVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQC+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCR  85



>ref|XP_010106861.1| Isoxaben-resistant protein 2 [Morus notabilis]
 gb|EXC12321.1| Isoxaben-resistant protein 2 [Morus notabilis]
Length=1121

 Score =   189 bits (479),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFV+INADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_006367803.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Solanum tuberosum]
Length=1091

 Score =   188 bits (478),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+E+TVDGE FVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEVTVDGETFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_004237809.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum lycopersicum]
Length=1090

 Score =   188 bits (478),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+E+TVDGE FVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEVTVDGETFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_011042869.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=1093

 Score =   188 bits (477),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQC+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCR  85



>ref|XP_002302169.1| CesA7A-like family protein [Populus trichocarpa]
 gb|EEE81442.1| CesA7A-like family protein [Populus trichocarpa]
Length=1093

 Score =   188 bits (477),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQC+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCR  85



>gb|AAT09895.1| cellulose synthase [Populus tremula x Populus tremuloides]
Length=1095

 Score =   188 bits (477),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQC+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCR  85



>ref|XP_009376550.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1095

 Score =   188 bits (477),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 81/85 (95%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCK  85



>gb|KJB66303.1| hypothetical protein B456_010G134500 [Gossypium raimondii]
Length=1090

 Score =   187 bits (476),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADEI RVTSVKELSGQICQICGDE+EI++DGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIARVTSVKELSGQICQICGDEIEISLDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_009339472.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1095

 Score =   187 bits (476),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 81/85 (95%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCK  85



>gb|EYU17481.1| hypothetical protein MIMGU_mgv1a000527mg [Erythranthe guttata]
Length=1093

 Score =   187 bits (476),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVE TVDGEPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEFTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFP+CRPCYEYERREGNQ+CPQCK
Sbjct  61   CAFPICRPCYEYERREGNQSCPQCK  85



>ref|XP_009782822.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1091

 Score =   187 bits (476),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCK  85



>gb|AFY06685.1| cellulose synthase [Nicotiana tabacum]
Length=1091

 Score =   187 bits (476),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCK  85



>ref|XP_008358296.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   187 bits (476),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 81/85 (95%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCK  85



>ref|XP_008381836.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   187 bits (476),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 81/85 (95%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCK  85



>ref|XP_011044242.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=1095

 Score =   187 bits (476),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+TKGRL+AGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+EITVDGEPFVACNE
Sbjct  1    METKGRLVAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQC+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCR  85



>ref|XP_008369157.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
 ref|XP_008369158.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
 ref|XP_008369159.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   187 bits (476),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 81/85 (95%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCK  85



>ref|XP_002524299.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF38039.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=1095

 Score =   187 bits (476),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGN+ACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNRACPQCK  85



>ref|XP_009609627.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1087

 Score =   187 bits (475),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCK  85



>ref|XP_007199689.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica]
 ref|XP_008237530.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Prunus mume]
 gb|EMJ00888.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica]
Length=1096

 Score =   187 bits (475),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCK  85



>gb|AEI87569.1| cellulose synthase catalytic subunit protein [Nicotiana tabacum]
Length=1091

 Score =   187 bits (475),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCK  85



>ref|XP_002306707.1| CesA7A-like family protein [Populus trichocarpa]
 gb|EEE93703.1| CesA7A-like family protein [Populus trichocarpa]
Length=1095

 Score =   187 bits (475),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+EITVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQC+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCR  85



>gb|KJB59451.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1064

 Score =   187 bits (474),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRACYEYERREGNQACPQCK  85



>gb|KJB59449.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1090

 Score =   187 bits (474),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRACYEYERREGNQACPQCK  85



>gb|KHG29218.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1090

 Score =   187 bits (474),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRACYEYERREGNQACPQCK  85



>gb|EYU36833.1| hypothetical protein MIMGU_mgv1a000540mg [Erythranthe guttata]
Length=1087

 Score =   186 bits (473),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+E + DGEPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEFSADGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFP+CRPCYEYERREGNQ+CPQCK
Sbjct  61   CAFPICRPCYEYERREGNQSCPQCK  85



>gb|EYU17480.1| hypothetical protein MIMGU_mgv1a000527mg [Erythranthe guttata]
Length=938

 Score =   185 bits (470),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVE TVDGEPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEFTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFP+CRPCYEYERREGNQ+CPQCK
Sbjct  61   CAFPICRPCYEYERREGNQSCPQCK  85



>ref|XP_004290503.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Fragaria vesca subsp. vesca]
Length=1093

 Score =   186 bits (472),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQ+CPQCK
Sbjct  61   CAFPVCRSCYEYERREGNQSCPQCK  85



>gb|AAK49454.1|AF304374_1 cellulose synthase catalytic subunit [Nicotiana alata]
Length=1091

 Score =   186 bits (472),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFV+INAD++GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADDVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCK  85



>gb|KJB59452.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1035

 Score =   185 bits (470),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRACYEYERREGNQACPQCK  85



>ref|XP_010241683.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1095

 Score =   186 bits (471),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRL+AGSHNRNEFVLINADEIGRV SV+ELSGQICQICGDEVEIT DGEPFVACNE
Sbjct  1    MDTGGRLVAGSHNRNEFVLINADEIGRVKSVRELSGQICQICGDEVEITEDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_009758840.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1094

 Score =   184 bits (468),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADEIGR+ SV+ELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  3    MNTGGRLIAGSHNRNEFVLINADEIGRIKSVRELSGQVCQICGDEIEITVDGEPFVACNE  62

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  63   CAFPVCRPCYEYERREGNQACPQCK  87



>gb|KJB59450.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=902

 Score =   183 bits (465),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRACYEYERREGNQACPQCK  85



>ref|XP_009629755.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1094

 Score =   184 bits (466),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADEIGR+ SV+ELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  3    MNTGGRLIAGSHNRNEFVLINADEIGRIKSVRELSGQVCQICGDEIEITVDGEPFVACNE  62

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFP+CRPCYEYERREGNQACPQCK
Sbjct  63   CAFPICRPCYEYERREGNQACPQCK  87



>ref|XP_011042923.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=943

 Score =   183 bits (464),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQC+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCR  85



>gb|AFZ78560.1| cellulose synthase [Populus tomentosa]
Length=1093

 Score =   184 bits (466),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+TKGRLIAGSHNRNEFVLINADEI RVT  KELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTPFKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQC+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCR  85



>gb|AFB18639.1| CESA9 [Gossypium hirsutum]
Length=1090

 Score =   183 bits (465),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AG HNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGPHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRACYEYERREGNQACPQCK  85



>ref|XP_008232182.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Prunus mume]
Length=1095

 Score =   183 bits (464),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT+GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|KJB14950.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
 gb|KJB14951.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
Length=1095

 Score =   183 bits (464),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|AFB18634.1| CESA5 [Gossypium hirsutum]
Length=1095

 Score =   183 bits (464),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_007213713.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
 gb|EMJ14912.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
Length=1095

 Score =   182 bits (463),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT+GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|AEE60899.1| cellulose synthase [Populus tomentosa]
Length=1100

 Score =   182 bits (463),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 80/90 (89%), Positives = 84/90 (93%), Gaps = 5/90 (6%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGR-----VTSVKELSGQICQICGDEVEITVDGEPF  309
            M+TKGRLIAGSHNRNEFVLINADEI R     VTSVKELSGQIC+ICGDE+EITVDGEPF
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARLLSIPVTSVKELSGQICKICGDEIEITVDGEPF  60

Query  310  VACNECAFPVCRPCYEYERREGNQACPQCK  399
            VACNECAFPVCRPCYEYERREGNQACPQC+
Sbjct  61   VACNECAFPVCRPCYEYERREGNQACPQCR  90



>gb|KDP35302.1| hypothetical protein JCGZ_09461 [Jatropha curcas]
Length=1097

 Score =   182 bits (462),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRL+AGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESGRIKSVQELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>emb|CDP12843.1| unnamed protein product [Coffea canephora]
Length=1093

 Score =   182 bits (462),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSHNRNEFVLINAD+IG++ SV+ELSGQICQICGDEVEITVDGE FVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADDIGKIKSVQELSGQICQICGDEVEITVDGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|KDO83761.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=1089

 Score =   182 bits (461),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|KDO83760.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=1091

 Score =   182 bits (461),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_006473074.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Citrus sinensis]
Length=1091

 Score =   182 bits (461),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_006434481.1| hypothetical protein CICLE_v10000103mg [Citrus clementina]
 gb|ESR47721.1| hypothetical protein CICLE_v10000103mg [Citrus clementina]
Length=1091

 Score =   182 bits (461),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_002307145.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE94141.1| cellulose synthase family protein [Populus trichocarpa]
Length=1096

 Score =   182 bits (461),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|KHG02518.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] [Gossypium 
arboreum]
Length=1095

 Score =   182 bits (461),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_003531396.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
 gb|KHN29142.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1097

 Score =   182 bits (461),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRL+AGSHNRNEFVLINADE GR+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADENGRIKSVRELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_007048203.1| Cellulose synthase 6 [Theobroma cacao]
 gb|EOX92360.1| Cellulose synthase 6 [Theobroma cacao]
Length=1096

 Score =   182 bits (461),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENGRIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|AAO25581.1| cellulose synthase [Populus tremuloides]
Length=1096

 Score =   181 bits (460),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|KDP30751.1| hypothetical protein JCGZ_15180 [Jatropha curcas]
Length=1092

 Score =   181 bits (459),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+TKGRLIAGSHNRNEFVLINADEI RVTSV+ELSGQICQICGDE+E T DGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEISRVTSVEELSGQICQICGDEIEFTRDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  61   CAFPVCRHCYEYERREGNQACPQCK  85



>gb|AAT09898.1| cellulose synthase [Populus tremula x Populus tremuloides]
Length=1096

 Score =   181 bits (459),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_007159799.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris]
 gb|ESW31793.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris]
Length=1097

 Score =   181 bits (458),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRL+AGSHNRNEFVLINADE GR+ SV+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADENGRIKSVRELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_011013550.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Populus euphratica]
 ref|XP_011013551.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Populus euphratica]
Length=1097

 Score =   181 bits (458),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_011013552.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X3 [Populus euphratica]
Length=1096

 Score =   181 bits (458),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_011021978.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X1 [Populus euphratica]
 ref|XP_011021979.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X2 [Populus euphratica]
Length=1097

 Score =   181 bits (458),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_011021980.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X3 [Populus euphratica]
Length=1096

 Score =   181 bits (458),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_010260984.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1093

 Score =   181 bits (458),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRL+AGSHNRNEFV+INADEIGRV SVKELSGQICQICGDEVEIT DGEPFVACNE
Sbjct  1    MYTGGRLVAGSHNRNEFVVINADEIGRVKSVKELSGQICQICGDEVEITDDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQICPQCK  85



>gb|KDO83763.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
 gb|KDO83764.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=786

 Score =   178 bits (451),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_007213712.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
 gb|EMJ14911.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
Length=853

 Score =   178 bits (452),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT+GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_003536418.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
 gb|KHN17022.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1095

 Score =   180 bits (456),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARVNAVTELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGN+ CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNKICPQCK  85



>gb|KHG24947.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1071

 Score =   179 bits (454),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|AFZ78553.1| cellulose synthase [Populus tomentosa]
Length=1096

 Score =   179 bits (455),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQVCPQCK  85



>gb|KJB18370.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1096

 Score =   179 bits (454),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|KDO83762.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=917

 Score =   178 bits (451),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|KJB18373.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1082

 Score =   179 bits (453),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|EPS58530.1| hypothetical protein M569_16283, partial [Genlisea aurea]
Length=343

 Score =   171 bits (433),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MD  GRL+AGSHNRNEFVLINADEIG+VTSVKELSGQICQICGDE+E  +DGEPFVACNE
Sbjct  1    MDATGRLVAGSHNRNEFVLINADEIGKVTSVKELSGQICQICGDEIEFKIDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ+CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCK  85



>ref|XP_002310628.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE91078.1| cellulose synthase family protein [Populus trichocarpa]
Length=1096

 Score =   179 bits (453),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+C ICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQVCHICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_002310629.1| hypothetical protein POPTR_0007s07120g [Populus trichocarpa]
 gb|EEE91079.1| hypothetical protein POPTR_0007s07120g [Populus trichocarpa]
Length=1095

 Score =   179 bits (453),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+C ICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQVCHICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_004503981.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cicer arietinum]
Length=1096

 Score =   178 bits (452),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRLIAGSHNRNEFVLINA+E GR+ SV+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYER+EGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERKEGNQACPQCK  85



>ref|XP_007151999.1| hypothetical protein PHAVU_004G093300g [Phaseolus vulgaris]
 gb|ESW23993.1| hypothetical protein PHAVU_004G093300g [Phaseolus vulgaris]
Length=1089

 Score =   178 bits (451),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSHNRNEFVLINADE  RVT+V ELSGQICQICGDE+E+TV GEPFVACNE
Sbjct  1    MDTNGRLIAGSHNRNEFVLINADETARVTAVTELSGQICQICGDELEVTVIGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQVCPQCK  85



>ref|XP_010520165.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Tarenaya hassleriana]
Length=1066

 Score =   177 bits (450),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADENARIRSVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|KJB18372.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1008

 Score =   177 bits (449),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|KHN41284.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=847

 Score =   176 bits (445),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 1/85 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ CPQCK
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCK  84



>ref|XP_009350646.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Pyrus x bretschneideri]
Length=1097

 Score =   177 bits (448),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT+GRL+AGSHNRNEFVLINADE  R+  V+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENSRIQPVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACP CK
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCK  85



>ref|XP_008338760.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1097

 Score =   177 bits (448),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT+GRL+AGSHNRNEFVLINADE  R+  V+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENSRIQPVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACP CK
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCK  85



>ref|XP_009350645.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Pyrus x bretschneideri]
Length=1099

 Score =   177 bits (448),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT+GRL+AGSHNRNEFVLINADE  R+  V+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENSRIQPVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACP CK
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCK  85



>ref|XP_003630174.1| Cellulose synthase A catalytic subunit [Medicago truncatula]
 gb|AET04650.1| cellulose synthase-like protein [Medicago truncatula]
Length=1098

 Score =   176 bits (447),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRLIAGSHNRNEFVLINA+E GR+ SV+ELSGQIC ICGDE+E+TVDGEPFVACNE
Sbjct  1    MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSGQICMICGDEIEVTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYER+EGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERKEGNQACPQCK  85



>ref|XP_010680991.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1102

 Score =   176 bits (447),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINAD+IGRVTSVKELSGQ+CQICGDE+E T + EPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADDIGRVTSVKELSGQLCQICGDEIENTKNDEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCY+YER EGNQACPQCK
Sbjct  61   CAFPVCRPCYDYERGEGNQACPQCK  85



>ref|XP_010547636.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Tarenaya hassleriana]
Length=1068

 Score =   175 bits (444),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E+TVDG+PFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQICQICGDEIELTVDGDPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPC+EYERREGNQACPQCK
Sbjct  61   CAFPVCRPCFEYERREGNQACPQCK  85



>ref|XP_010678670.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1102

 Score =   176 bits (445),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINAD+IGRVTSVKELSGQ+CQICGDE+E   + EPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADDIGRVTSVKELSGQLCQICGDEIENIENNEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCY+YER EGNQACPQCK
Sbjct  61   CAFPVCRPCYDYEREEGNQACPQCK  85



>ref|XP_007143558.1| hypothetical protein PHAVU_007G081700g [Phaseolus vulgaris]
 gb|ESW15552.1| hypothetical protein PHAVU_007G081700g [Phaseolus vulgaris]
Length=1093

 Score =   175 bits (443),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRL+A SHNRNEF++INAD+ GRV +V EL GQICQICGDE+EIT DGEPFVACNE
Sbjct  1    MDTTGRLVASSHNRNEFIIINADQTGRVNAVTELCGQICQICGDEIEITADGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|KEH43649.1| cellulose synthase-like protein [Medicago truncatula]
Length=1097

 Score =   175 bits (443),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRL+AGSHNRNEFVLINAD+  RV +V ELSGQICQICGDE+E TVD EPFVACNE
Sbjct  5    MDTNGRLVAGSHNRNEFVLINADDTARVNAVTELSGQICQICGDEIEFTVDDEPFVACNE  64

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACP CK
Sbjct  65   CAFPVCRPCYEYERREGNQACPHCK  89



>gb|AES62337.2| cellulose synthase-like protein [Medicago truncatula]
Length=1093

 Score =   175 bits (443),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRL+AGSHNRNEFVLINAD+  RV +V ELSGQICQICGDE+E TVD EPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADDTARVNAVTELSGQICQICGDEIEFTVDDEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACP CK
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCK  85



>ref|XP_002864919.1| hypothetical protein ARALYDRAFT_496689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41178.1| hypothetical protein ARALYDRAFT_496689 [Arabidopsis lyrata subsp. 
lyrata]
Length=1089

 Score =   175 bits (443),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|NP_201279.1| cellulose synthase A catalytic subunit 6 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q94JQ6.2|CESA6_ARATH RecName: Full=Cellulose synthase A catalytic subunit 6 [UDP-forming]; 
Short=AtCesA6; AltName: Full=AraxCelA; AltName: Full=Isoxaben-resistant 
protein 2; AltName: Full=Protein PROCUSTE 
1; AltName: Full=Protein QUILL [Arabidopsis thaliana]
 dbj|BAB10307.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AED97945.1| cellulose synthase A catalytic subunit 6 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AID66000.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1084

 Score =   174 bits (442),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_003525098.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1097

 Score =   175 bits (443),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 74/84 (88%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRL+AGSHNRNEFVLINAD+ GR+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADDNGRIKSVRELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQC  396
            CAFPVCRPCYEYERREG QACPQC
Sbjct  61   CAFPVCRPCYEYERREGIQACPQC  84



>gb|KHN34038.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1097

 Score =   174 bits (442),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 74/84 (88%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRL+AGSHNRNEFVLINAD+ GR+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADDNGRIKSVRELSGQICQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQC  396
            CAFPVCRPCYEYERREG QACPQC
Sbjct  61   CAFPVCRPCYEYERREGIQACPQC  84



>ref|XP_008440995.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Cucumis melo]
Length=1091

 Score =   174 bits (442),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEVE+T +GE FVACNE
Sbjct  1    MDTAGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICGDEVELTAEGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_010546378.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Tarenaya hassleriana]
Length=1075

 Score =   174 bits (441),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E+TVDG+ FVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQICQICGDEIELTVDGDSFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_010526630.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Tarenaya hassleriana]
Length=1073

 Score =   174 bits (441),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADETARIRSVQELSGQNCQICGDEIEFTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_006279743.1| hypothetical protein CARUB_v10027598mg [Capsella rubella]
 gb|EOA12641.1| hypothetical protein CARUB_v10027598mg [Capsella rubella]
Length=1084

 Score =   174 bits (441),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_004141979.1| PREDICTED: probable cellulose synthase A catalytic subunit 9 
[UDP-forming]-like [Cucumis sativus]
 ref|XP_004160480.1| PREDICTED: probable cellulose synthase A catalytic subunit 9 
[UDP-forming]-like [Cucumis sativus]
 gb|KGN48397.1| hypothetical protein Csa_6G486700 [Cucumis sativus]
Length=1090

 Score =   174 bits (441),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEVE+T +GE FVACNE
Sbjct  1    MDTAGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICGDEVELTAEGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_003548102.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1078

 Score =   174 bits (440),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 1/85 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ CPQCK
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCK  84



>gb|KHN00756.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1052

 Score =   173 bits (439),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 1/85 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ CPQCK
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCK  84



>ref|XP_003518592.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1078

 Score =   173 bits (439),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 1/85 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ CPQCK
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCK  84



>gb|AHL45030.1| cellulose synthase 6D [Linum usitatissimum]
Length=1097

 Score =   173 bits (439),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EITVDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENGRIRSVQELSGQVCQICGDEIEITVDGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREG QACPQC+
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCR  85



>gb|AHL45029.1| cellulose synthase 6C [Linum usitatissimum]
Length=1097

 Score =   173 bits (438),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EITVDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESGRIRSVQELSGQVCQICGDEIEITVDGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREG QACPQC+
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCR  85



>gb|AGV22108.1| cellulose synthase 6 [Betula luminifera]
Length=1103

 Score =   173 bits (438),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 77/91 (85%), Positives = 81/91 (89%), Gaps = 6/91 (7%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGR------VTSVKELSGQICQICGDEVEITVDGEP  306
            MDT+GRLIAGSHNRNE +LINADE GR      + SVKELSGQ+CQICGDEVEITVDGE 
Sbjct  1    MDTRGRLIAGSHNRNELILINADENGRGDENGRIKSVKELSGQMCQICGDEVEITVDGEL  60

Query  307  FVACNECAFPVCRPCYEYERREGNQACPQCK  399
            FVACNECAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   FVACNECAFPVCRPCYEYERREGNQACPQCK  91



>ref|XP_006399471.1| hypothetical protein EUTSA_v10012521mg [Eutrema salsugineum]
 gb|ESQ40924.1| hypothetical protein EUTSA_v10012521mg [Eutrema salsugineum]
Length=1073

 Score =   173 bits (438),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E+T DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQICQICGDEIELTDDGESFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ+CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCK  85



>ref|XP_010462809.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Camelina sativa]
Length=1084

 Score =   173 bits (438),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGN+ACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNKACPQCK  85



>gb|AHL45027.1| cellulose synthase 6A [Linum usitatissimum]
Length=1096

 Score =   172 bits (437),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EIT DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESGRIQSVRELSGQVCQICGDEIEITADGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREG QACPQC+
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCR  85



>gb|KFK25282.1| hypothetical protein AALP_AA8G091900 [Arabis alpina]
Length=1071

 Score =   172 bits (437),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQICQICGDEIELSDDGESFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_002871389.1| hypothetical protein ARALYDRAFT_908936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47648.1| hypothetical protein ARALYDRAFT_908936 [Arabidopsis lyrata subsp. 
lyrata]
Length=1069

 Score =   172 bits (436),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELSVDGESFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ+CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCK  85



>ref|NP_196549.1| cellulose synthase A catalytic subunit 5 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q8L778.2|CESA5_ARATH RecName: Full=Cellulose synthase A catalytic subunit 5 [UDP-forming]; 
Short=AtCesA5 [Arabidopsis thaliana]
 dbj|BAB09408.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AED91458.1| cellulose synthase A catalytic subunit 5 [UDP-forming] [Arabidopsis 
thaliana]
Length=1069

 Score =   172 bits (436),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELSVDGESFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ+CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCK  85



>gb|AHL45028.1| cellulose synthase 6B [Linum usitatissimum]
Length=1096

 Score =   172 bits (436),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EIT DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESGRIRSVRELSGQVCQICGDEIEITADGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREG QACPQC+
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCR  85



>ref|XP_009150553.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Brassica rapa]
Length=1082

 Score =   172 bits (436),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>emb|CDY08854.1| BnaA06g23700D [Brassica napus]
Length=1082

 Score =   172 bits (436),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>emb|CDY14504.1| BnaC03g49550D [Brassica napus]
Length=1082

 Score =   172 bits (436),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_010444419.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Camelina sativa]
Length=1090

 Score =   172 bits (435),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGN+ACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNKACPQCK  85



>emb|CDY18696.1| BnaA09g06990D [Brassica napus]
Length=1084

 Score =   172 bits (435),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DEVE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|AEK86669.1| cellulose synthase 5 [Arabidopsis thaliana]
Length=996

 Score =   171 bits (434),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELSVDGESFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ+CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCK  85



>emb|CDX81249.1| BnaC09g06600D [Brassica napus]
Length=1084

 Score =   172 bits (435),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DEVE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_009112155.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Brassica rapa]
Length=1083

 Score =   171 bits (434),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DEVE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>dbj|BAF01335.1| cellulose synthase [Arabidopsis thaliana]
Length=771

 Score =   169 bits (429),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|ACS68196.1| cellulose synthase 6.1 catalytic subunit [Brassica napus]
Length=1084

 Score =   171 bits (434),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DEVE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_010088737.1| Isoxaben-resistant protein 2 [Morus notabilis]
 gb|EXB36918.1| Isoxaben-resistant protein 2 [Morus notabilis]
Length=1082

 Score =   171 bits (434),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 73/81 (90%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +1

Query  157  GRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNECAFP  336
            GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+EITVDGE FVACNECAFP
Sbjct  4    GRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGELFVACNECAFP  63

Query  337  VCRPCYEYERREGNQACPQCK  399
            VCRPCYEYERREGNQACPQCK
Sbjct  64   VCRPCYEYERREGNQACPQCK  84



>gb|KDO57137.1| hypothetical protein CISIN_1g001369mg [Citrus sinensis]
Length=1091

 Score =   171 bits (434),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQIC DE+EIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_006427904.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
 ref|XP_006464533.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Citrus sinensis]
 gb|ESR41144.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
Length=1091

 Score =   171 bits (433),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQIC DE+EIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_010491630.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Camelina sativa]
Length=1068

 Score =   171 bits (433),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+ VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELGVDGESFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ+CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCK  85



>ref|XP_010452989.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Camelina sativa]
Length=1068

 Score =   171 bits (433),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+ VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELGVDGESFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ+CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCK  85



>ref|XP_003592086.1| Cellulose synthase [Medicago truncatula]
Length=1135

 Score =   171 bits (432),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 73/87 (84%), Positives = 78/87 (90%), Gaps = 2/87 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVT--SVKELSGQICQICGDEVEITVDGEPFVAC  318
            MDT GRL+AGSHNRNEFVLINAD+  RV+  +V ELSGQICQICGDE+E TVD EPFVAC
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADDTARVSVNAVTELSGQICQICGDEIEFTVDDEPFVAC  60

Query  319  NECAFPVCRPCYEYERREGNQACPQCK  399
            NECAFPVCRPCYEYERREGNQACP CK
Sbjct  61   NECAFPVCRPCYEYERREGNQACPHCK  87



>ref|XP_002866842.1| hypothetical protein ARALYDRAFT_490712 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43101.1| hypothetical protein ARALYDRAFT_490712 [Arabidopsis lyrata subsp. 
lyrata]
Length=1084

 Score =   171 bits (432),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCQICGDEIELTVNGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_006411737.1| hypothetical protein EUTSA_v10024277mg [Eutrema salsugineum]
 gb|ESQ53190.1| hypothetical protein EUTSA_v10024277mg [Eutrema salsugineum]
Length=1084

 Score =   169 bits (429),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICGDEIELTVNGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_010484268.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Camelina sativa]
Length=1084

 Score =   169 bits (429),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TV GEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVGGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGN+ACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNKACPQCK  85



>ref|XP_010027732.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Eucalyptus grandis]
 gb|KCW54322.1| hypothetical protein EUGRSUZ_I00286 [Eucalyptus grandis]
Length=1092

 Score =   169 bits (429),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 78/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQICQICGDEVEI  DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESSRIKSVKELSGQICQICGDEVEIA-DGELFVACNE  59

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  60   CAFPVCRPCYEYERREGNQACPQCK  84



>ref|XP_011090445.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Sesamum indicum]
Length=1090

 Score =   169 bits (428),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRL+AGSHNRNEFVLINADEIGR+ SV ELSGQ CQICGDEVEITVDGE FVACNE
Sbjct  3    MNTGGRLVAGSHNRNEFVLINADEIGRIKSVHELSGQTCQICGDEVEITVDGELFVACNE  62

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYER+EG Q CPQCK
Sbjct  63   CAFPVCRTCYEYERKEGTQCCPQCK  87



>ref|XP_006286951.1| hypothetical protein CARUB_v10000099mg [Capsella rubella]
 gb|EOA19849.1| hypothetical protein CARUB_v10000099mg [Capsella rubella]
Length=1068

 Score =   169 bits (428),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL+GQ CQICGDE+E+ +DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELTGQTCQICGDEIELNLDGESFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQ+CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCK  85



>emb|CDY31305.1| BnaA02g34360D [Brassica napus]
Length=1079

 Score =   169 bits (428),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DE+E TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELRGQTCEICRDEIESTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|KDO57138.1| hypothetical protein CISIN_1g001369mg [Citrus sinensis]
Length=791

 Score =   167 bits (423),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQIC DE+EIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|AAC29067.1| cellulose synthase [Arabidopsis thaliana]
Length=1081

 Score =   169 bits (427),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 71/80 (89%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  160  RLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNECAFPV  339
            RLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNECAFPV
Sbjct  3    RLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNECAFPV  62

Query  340  CRPCYEYERREGNQACPQCK  399
            CRPCYEYERREGNQACPQCK
Sbjct  63   CRPCYEYERREGNQACPQCK  82



>gb|EYU31127.1| hypothetical protein MIMGU_mgv1a000549mg [Erythranthe guttata]
Length=1082

 Score =   169 bits (427),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRL+AGSHNR EFVLINADEIG + SV+ELSGQ C+ICGDEVEIT+DGE FVACNE
Sbjct  1    MNTGGRLVAGSHNRKEFVLINADEIGSIKSVQELSGQTCKICGDEVEITLDGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYER+EGNQ+CPQCK
Sbjct  61   CAFPVCRPCYEYERKEGNQSCPQCK  85



>gb|KJB18371.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=925

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_009130469.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Brassica rapa]
Length=1079

 Score =   168 bits (425),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GR+IAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DE+E TVDGEPFVACNE
Sbjct  1    MNTGGRVIAGSHNRNEFVLINADENARIRSVQELKGQTCEICRDEIESTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|NP_195645.1| cellulose synthase A catalytic subunit 2 [UDP-forming] [Arabidopsis 
thaliana]
 sp|O48947.1|CESA2_ARATH RecName: Full=Cellulose synthase A catalytic subunit 2 [UDP-forming]; 
Short=AtCesA2; Short=Ath-A [Arabidopsis thaliana]
 gb|AAC39335.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 emb|CAB43650.1| cellulose synthase catalytic subunit (Ath-A) [Arabidopsis thaliana]
 emb|CAB80598.1| cellulose synthase catalytic subunit (Ath-A) [Arabidopsis thaliana]
 gb|AEE87059.1| cellulose synthase A catalytic subunit 2 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AHL38978.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1084

 Score =   167 bits (424),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+TV  E FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCQICGDEIELTVSSELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_006283042.1| hypothetical protein CARUB_v10004034mg [Capsella rubella]
 gb|EOA15940.1| hypothetical protein CARUB_v10004034mg [Capsella rubella]
Length=1084

 Score =   167 bits (424),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+TV  E FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCQICGDEIELTVTSELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_002277635.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Vitis vinifera]
 emb|CAN72601.1| hypothetical protein VITISV_012984 [Vitis vinifera]
Length=1097

 Score =   167 bits (424),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRL+AGSH+RNEFVLINAD+I R+ SV+ELSGQIC ICGD VEITVDGE FVACNE
Sbjct  1    MATGGRLVAGSHHRNEFVLINADDIARIKSVRELSGQICHICGDGVEITVDGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGN+ CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNKVCPQCK  85



>emb|CDY46820.1| BnaC02g43280D [Brassica napus]
Length=1079

 Score =   167 bits (423),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DE+E TV+GEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELRGQTCEICRDEIESTVEGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>emb|CBI21555.3| unnamed protein product [Vitis vinifera]
Length=1097

 Score =   167 bits (423),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRL+AGSH+RNEFVLINAD+I R+ SV+ELSGQIC ICGD VEITVDGE FVACNE
Sbjct  1    MATGGRLVAGSHHRNEFVLINADDIARIKSVRELSGQICHICGDGVEITVDGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGN+ CPQCK
Sbjct  61   CAFPVCRPCYEYERREGNKVCPQCK  85



>gb|KHG03006.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1059

 Score =   167 bits (423),  Expect = 9e-45, Method: Composition-based stats.
 Identities = 75/87 (86%), Positives = 77/87 (89%), Gaps = 2/87 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEI--TVDGEPFVAC  318
            MDT GRLIAGSHNRNEFVLINA E  R+ SVKELSGQ CQICGDE+EI  TVDGEPFVAC
Sbjct  1    MDTGGRLIAGSHNRNEFVLINAYENARIKSVKELSGQSCQICGDEIEIEITVDGEPFVAC  60

Query  319  NECAFPVCRPCYEYERREGNQACPQCK  399
            NECAFPVCR CYEY RREGNQACPQCK
Sbjct  61   NECAFPVCRTCYEYGRREGNQACPQCK  87



>emb|CDY42621.1| BnaC01g00330D [Brassica napus]
Length=1069

 Score =   167 bits (422),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ CQICGD++E++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_009115076.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Brassica rapa]
Length=1074

 Score =   166 bits (421),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ CQICGD++E++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>emb|CDY41973.1| BnaA01g05450D [Brassica napus]
Length=1074

 Score =   166 bits (421),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ CQICGD++E++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>gb|ACS68191.1| cellulose synthase 2.1 catalytic subunit [Brassica napus]
Length=1074

 Score =   166 bits (421),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ CQICGD++E++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_010437052.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Camelina sativa]
Length=1074

 Score =   166 bits (421),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVNGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_010431901.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Camelina sativa]
Length=1074

 Score =   166 bits (420),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C IC DE+E+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCHICRDEIELTVNGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_002878571.1| hypothetical protein ARALYDRAFT_900606 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54830.1| hypothetical protein ARALYDRAFT_900606 [Arabidopsis lyrata subsp. 
lyrata]
Length=1089

 Score =   166 bits (420),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 68/85 (80%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+T +GEPF+ACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADETARIRSVQELSGQTCKICRDEIELTENGEPFIACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYER+EGNQACPQC+
Sbjct  61   CAFPVCRPCYEYERKEGNQACPQCR  85



>ref|XP_009131129.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Brassica rapa]
Length=1072

 Score =   166 bits (419),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQ+CPQCK
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCK  85



>emb|CDY56540.1| BnaA03g55860D [Brassica napus]
Length=1074

 Score =   165 bits (418),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQ+CPQCK
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCK  85



>emb|CDX81145.1| BnaC03g03990D [Brassica napus]
Length=1070

 Score =   165 bits (417),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQ+CPQCK
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCK  85



>gb|ACS68195.1| cellulose synthase 5.1 catalytic subunit [Brassica napus]
Length=1070

 Score =   165 bits (417),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQ+CPQCK
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCK  85



>ref|XP_006394118.1| hypothetical protein EUTSA_v100035740mg, partial [Eutrema salsugineum]
 gb|ESQ31404.1| hypothetical protein EUTSA_v100035740mg, partial [Eutrema salsugineum]
Length=798

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_006847152.1| hypothetical protein AMTR_s00017p00239550 [Amborella trichopoda]
 gb|ERN08733.1| hypothetical protein AMTR_s00017p00239550 [Amborella trichopoda]
Length=1087

 Score =   163 bits (412),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 76/85 (89%), Gaps = 3/85 (4%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRL+AGSHNRNEFV+INADE      ++ELSGQ CQICGDE+EITVDGE FVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVVINADE---PKPLRELSGQTCQICGDEIEITVDGEAFVACNE  57

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  58   CAFPVCRPCYEYERREGNQACPQCK  82



>ref|NP_179768.1| cellulose synthase A9 [Arabidopsis thaliana]
 sp|Q9SJ22.1|CESA9_ARATH RecName: Full=Probable cellulose synthase A catalytic subunit 
9 [UDP-forming]; Short=AtCesA9 [Arabidopsis thaliana]
 gb|AAD20396.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AEC07220.1| cellulose synthase A9 [Arabidopsis thaliana]
Length=1088

 Score =   161 bits (408),  Expect = 9e-43, Method: Composition-based stats.
 Identities = 66/84 (79%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINAD+  R+ S +ELSGQ C+IC DE+E+T +GEPF+ACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADDTARIRSAEELSGQTCKICRDEIELTDNGEPFIACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQC  396
            CAFP CRPCYEYERREGNQACPQC
Sbjct  61   CAFPTCRPCYEYERREGNQACPQC  84



>gb|EPS71230.1| hypothetical protein M569_03522 [Genlisea aurea]
Length=1086

 Score =   161 bits (408),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRL+AGSHNRNEFVLINADEIGR+ SV ELS Q CQICGDE+EIT D E FVACNE
Sbjct  3    MNTGGRLVAGSHNRNEFVLINADEIGRIKSVHELSDQTCQICGDELEITADRELFVACNE  62

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREG+Q CPQC+
Sbjct  63   CAFPVCRTCYEYERREGSQCCPQCR  87



>ref|XP_004502891.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Cicer arietinum]
Length=1084

 Score =   160 bits (405),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRL+AGSHNRNE VLINA+E G++ SV+ELSGQICQICGDE+EI   GE FVACNE
Sbjct  1    MNTGGRLVAGSHNRNELVLINAEENGKIKSVQELSGQICQICGDEIEIMDQGEIFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFP+CRPCYEYER EGNQACPQCK
Sbjct  61   CAFPICRPCYEYERLEGNQACPQCK  85



>ref|XP_006427905.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
 gb|ESR41145.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
Length=918

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQIC DE+EIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCK  85



>ref|XP_010446473.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Camelina sativa]
Length=1075

 Score =   159 bits (402),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TV GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVTGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYE ERREG QACPQCK
Sbjct  61   CAFPVCRPCYEDERREGKQACPQCK  85



>gb|EPS66740.1| hypothetical protein M569_08032, partial [Genlisea aurea]
Length=1015

 Score =   158 bits (400),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T GRLIAGSHNRNEFVLINADEIGR+ SV+ELSGQ CQICGDEVEI+  G+ FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADEIGRIKSVQELSGQTCQICGDEVEISA-GDLFVACNE  59

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREG Q CPQC+
Sbjct  60   CAFPVCRTCYEYERREGTQCCPQCQ  84



>ref|XP_010063847.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Eucalyptus grandis]
 gb|KCW71116.1| hypothetical protein EUGRSUZ_F04216 [Eucalyptus grandis]
Length=1092

 Score =   158 bits (399),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRL+ GSHNRNE +LINADE+GRVT VK LSG+ICQIC DE+EIT DGEPFVACNE
Sbjct  1    MDT-GRLVTGSHNRNEIILINADEVGRVTCVKHLSGKICQICADEIEITGDGEPFVACNE  59

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYER EG QACP CK
Sbjct  60   CAFPVCRHCYEYERSEGTQACPHCK  84



>ref|XP_010063851.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Eucalyptus grandis]
 gb|KCW71112.1| hypothetical protein EUGRSUZ_F04212 [Eucalyptus grandis]
Length=1091

 Score =   157 bits (397),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRL+ GSHNRNE +LINADE+GRVT VK LSG+ICQIC DE+EIT DGEPFVACNE
Sbjct  1    MDT-GRLVTGSHNRNEIILINADEVGRVTCVKHLSGKICQICADEIEITGDGEPFVACNE  59

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYER EG QACP CK
Sbjct  60   CAFPVCRHCYEYERSEGTQACPHCK  84



>ref|XP_006351001.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum tuberosum]
Length=1090

 Score =   156 bits (395),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRLIAGSH RNEFVLI ADE GRV SV  LS ++CQICGDE+EIT DGE FVACNE
Sbjct  4    MDTSGRLIAGSHIRNEFVLIKADEFGRVESVHALSARMCQICGDELEIT-DGELFVACNE  62

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQACPQCK
Sbjct  63   CAFPVCRLCYEYERREGNQACPQCK  87



>gb|AFD33697.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1092

 Score =   156 bits (394),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT GRL+ GSHNRNE +LINADE+GRVT VK LSG+IC+IC DE+EIT DGEPFVACNE
Sbjct  1    MDT-GRLVTGSHNRNEIILINADEVGRVTCVKHLSGKICRICADEIEITGDGEPFVACNE  59

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYER EG QACP CK
Sbjct  60   CAFPVCRHCYEYERSEGTQACPHCK  84



>ref|XP_010312466.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Solanum lycopersicum]
Length=1086

 Score =   155 bits (391),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 71/88 (81%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = +1

Query  136  VGLMDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVA  315
            + +MDT GRLIAGSH RNEFVLI ADE GRV SV ELS Q+CQICGDE+E T DGE FVA
Sbjct  1    MAMMDTGGRLIAGSHIRNEFVLIKADEFGRVESVHELSEQMCQICGDELE-TSDGELFVA  59

Query  316  CNECAFPVCRPCYEYERREGNQACPQCK  399
            CNECAFPVCR CYEYERREG QACPQCK
Sbjct  60   CNECAFPVCRLCYEYERREGTQACPQCK  87



>gb|KHG02517.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] [Gossypium 
arboreum]
Length=1106

 Score =   153 bits (386),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 70/96 (73%), Positives = 75/96 (78%), Gaps = 11/96 (11%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELS-GQIC----------QICGDEVEIT  291
            MDT GRLIAGSHNRNEFVLINADE  R  + +  +   +C          QICGDE+EIT
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARDCANRTFTTALVCTGFVVLAFHNQICGDEIEIT  60

Query  292  VDGEPFVACNECAFPVCRPCYEYERREGNQACPQCK  399
            VDGEPFVACNECAFPVCRPCYEYERREGNQACPQCK
Sbjct  61   VDGEPFVACNECAFPVCRPCYEYERREGNQACPQCK  96



>ref|XP_010927397.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Elaeis guineensis]
Length=1097

 Score =   143 bits (361),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEI-TVDGEPFVACN  321
            MDT GRL+AGS NRNEFV+INAD+ GR  SV++ +G  CQICGD++EI   + EPFVACN
Sbjct  1    MDTGGRLVAGSRNRNEFVVINADDFGRSKSVQDSNGLNCQICGDDIEILEEEKEPFVACN  60

Query  322  ECAFPVCRPCYEYERREGNQACPQCK  399
            ECAFPVCR CYEYERREG+Q+CPQC+
Sbjct  61   ECAFPVCRTCYEYERREGSQSCPQCR  86



>gb|ACJ38667.1| cellulose synthase [Betula luminifera]
Length=1093

 Score =   138 bits (347),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I  D       +++LSGQICQICGD+V +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGESAPRPLQQLSGQICQICGDDVGLTVDGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFP+CR CYEYERREGNQ CPQCK
Sbjct  61   CAFPICRTCYEYERREGNQVCPQCK  85



>ref|XP_009414591.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Musa acuminata subsp. malaccensis]
Length=1097

 Score =   137 bits (345),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            MDT  RL+AGS NRNEFV+INAD+  R    +  S QICQICGD++E+ V+ E FVACNE
Sbjct  1    MDTGRRLVAGSRNRNEFVVINADDFERPKFAQVSSRQICQICGDDIEVLVEEEFFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREG QACPQCK
Sbjct  61   CAFPVCRTCYEYERREGTQACPQCK  85



>ref|XP_009417280.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1091

 Score =   137 bits (344),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I  D       +++LSGQICQICGD+V +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGESGPKPLQQLSGQICQICGDDVGLTVDGDLFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQ CPQCK
Sbjct  61   CAFPVCRTCYEYERREGNQVCPQCK  85



>ref|XP_011079380.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Sesamum indicum]
Length=1037

 Score =   136 bits (343),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      +K L+GQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLTGQVCEICGDEIGLTVDGELFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREGNQ CPQCK
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCK  83



>ref|XP_011079381.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Sesamum indicum]
Length=1036

 Score =   136 bits (343),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      +K L+GQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLTGQVCEICGDEIGLTVDGELFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREGNQ CPQCK
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCK  83



>ref|XP_002963550.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 ref|XP_002981528.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ17343.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ35421.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1093

 Score =   136 bits (343),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I  +  G V  +K L+GQ+CQICGD+V  TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRQEGDG-VKPLKHLNGQVCQICGDDVGCTVDGELFVACNE  59

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYER++GNQ+CPQCK
Sbjct  60   CAFPVCRPCYEYERKDGNQSCPQCK  84



>ref|XP_011079382.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X3 [Sesamum indicum]
Length=1029

 Score =   136 bits (343),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      +K L+GQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLTGQVCEICGDEIGLTVDGELFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREGNQ CPQCK
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCK  83



>ref|XP_009408434.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1091

 Score =   136 bits (343),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I  D       +++LSGQICQICGD+V +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGESAPKPLQQLSGQICQICGDDVGLTVDGDLFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFP+CR CYEYERREGNQ CPQCK
Sbjct  61   CAFPICRTCYEYERREGNQVCPQCK  85



>gb|EYU35355.1| hypothetical protein MIMGU_mgv1a000638mg [Erythranthe guttata]
Length=1036

 Score =   136 bits (343),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E     ++K LSGQ C+ICGDEV +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKTLKNLSGQDCEICGDEVGLTVDGELFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREGNQ CPQCK
Sbjct  59   CGFPVCRPCYEYERREGNQLCPQCK  83



>ref|XP_009385959.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1091

 Score =   135 bits (341),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/86 (69%), Positives = 70/86 (81%), Gaps = 2/86 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINAD-EIGRVTSVKELSGQICQICGDEVEITVDGEPFVACN  321
            M+    L+AGSHNRNE V+I  D E+G    +++LSGQICQICGD+V +TVDG+ FVACN
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGELGP-KPLQQLSGQICQICGDDVGLTVDGDLFVACN  59

Query  322  ECAFPVCRPCYEYERREGNQACPQCK  399
            ECAFP+CR CYEYERREGNQ CPQCK
Sbjct  60   ECAFPICRTCYEYERREGNQVCPQCK  85



>ref|XP_011083940.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Sesamum indicum]
Length=1041

 Score =   135 bits (339),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      +K LSGQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLSGQVCEICGDEIGLTVDGELFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCK  83



>ref|XP_010912005.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Elaeis guineensis]
Length=1099

 Score =   135 bits (339),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/86 (70%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE-VEITVDGEPFVACN  321
            MDT GRL+AGS NRNEFV+INAD+ GR  + K+ +GQIC ICGD+   +  + E FVACN
Sbjct  1    MDTGGRLVAGSRNRNEFVVINADDFGRSKAAKDSNGQICHICGDDIEILEEEKELFVACN  60

Query  322  ECAFPVCRPCYEYERREGNQACPQCK  399
            ECAFPVCR CYEYERREG+QACPQCK
Sbjct  61   ECAFPVCRTCYEYERREGSQACPQCK  86



>ref|XP_006849886.1| hypothetical protein AMTR_s00022p00086120 [Amborella trichopoda]
 gb|ERN11467.1| hypothetical protein AMTR_s00022p00086120 [Amborella trichopoda]
Length=1095

 Score =   135 bits (339),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I  +       +++LSGQICQICGD+V +T DGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRREGESGPRPLQQLSGQICQICGDDVGLTADGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQ CPQCK
Sbjct  61   CAFPVCRTCYEYERREGNQVCPQCK  85



>ref|XP_009777624.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Nicotiana sylvestris]
Length=1041

 Score =   134 bits (338),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCEICGDEIGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCK  83



>ref|XP_009622822.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Nicotiana tomentosiformis]
Length=1041

 Score =   134 bits (338),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCEICGDEIGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCK  83



>ref|XP_009622821.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Nicotiana tomentosiformis]
Length=1079

 Score =   134 bits (338),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCEICGDEIGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCK  83



>ref|XP_010932185.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Elaeis guineensis]
Length=1090

 Score =   134 bits (338),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I  +       +++LSGQICQICGD+V +T DGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRREGESGPKPLQQLSGQICQICGDDVGLTTDGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFP+CR CYEYERREGNQ CPQCK
Sbjct  61   CAFPICRTCYEYERREGNQVCPQCK  85



>ref|XP_008796456.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Phoenix dactylifera]
Length=1090

 Score =   134 bits (338),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I  +       +++LSGQICQICGD+V +T DGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRREGESGPKPLQQLSGQICQICGDDVGLTTDGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFP+CR CYEYERREGNQ CPQCK
Sbjct  61   CAFPICRTCYEYERREGNQVCPQCK  85



>gb|AFW69155.1| putative cellulose synthase family protein [Zea mays]
Length=981

 Score =   134 bits (337),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEANAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCK  83



>ref|XP_004242614.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Solanum lycopersicum]
Length=1041

 Score =   134 bits (337),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCDICGDEIGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCK  83



>ref|XP_004956855.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Setaria italica]
Length=1050

 Score =   134 bits (337),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCK  83



>ref|XP_002460229.1| hypothetical protein SORBIDRAFT_02g025020 [Sorghum bicolor]
 gb|EER96750.1| hypothetical protein SORBIDRAFT_02g025020 [Sorghum bicolor]
Length=1049

 Score =   134 bits (336),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCK  83



>ref|XP_006660635.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Oryza brachyantha]
Length=1053

 Score =   134 bits (336),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE VLI   E      ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCK  83



>ref|NP_001105532.1| cellulose synthase catalytic subunit 12 [Zea mays]
 gb|AAR23312.1| cellulose synthase catalytic subunit 12 [Zea mays]
 tpg|DAA61528.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1052

 Score =   134 bits (336),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCK  83



>ref|XP_008670200.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
[Zea mays]
 tpg|DAA40096.1| TPA: putative cellulose synthase family protein [Zea mays]
 gb|AIL25252.1| cellulose synthase catalytic subunit 13 [Zea mays]
Length=1052

 Score =   134 bits (336),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEANAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCK  83



>dbj|BAM05574.1| cellulose synthase 3, partial [Eucalyptus pyrocarpa]
 dbj|BAM05575.1| cellulose synthase 3, partial [Eucalyptus pilularis]
Length=473

 Score =   130 bits (328),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCK  83



>ref|XP_002277713.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Vitis vinifera]
 ref|XP_010664050.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Vitis vinifera]
Length=1091

 Score =   134 bits (336),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I  D       +++LSGQICQICGD+V + VDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGESGPKPLQQLSGQICQICGDDVGLNVDGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREG+Q CPQCK
Sbjct  61   CAFPVCRTCYEYERREGSQVCPQCK  85



>ref|XP_006343620.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Solanum tuberosum]
Length=1041

 Score =   133 bits (335),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCDICGDEIGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCK  83



>gb|KCW70399.1| hypothetical protein EUGRSUZ_F03635 [Eucalyptus grandis]
Length=1097

 Score =   133 bits (335),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLIN-ADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACN  321
            M+    L+AGSHNRNE V+I   +E+G+   +++LSGQICQICGD+V +TVDGE FVACN
Sbjct  1    MEVSSGLVAGSHNRNELVVIRRENELGQ-KPLQKLSGQICQICGDDVGLTVDGELFVACN  59

Query  322  ECAFPVCRPCYEYERREGNQACPQCK  399
            ECAFP+CR CYEYERREG+Q CPQCK
Sbjct  60   ECAFPICRTCYEYERREGSQICPQCK  85



>ref|XP_010687624.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Beta vulgaris subsp. vulgaris]
Length=1036

 Score =   133 bits (335),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I   E      +K+LSGQ+C+ICGDE+ ++VDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIQGHE--EPKPLKDLSGQVCEICGDEIGLSVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQNCPQCK  83



>tpg|DAA61529.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1056

 Score =   133 bits (335),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCK  83



>ref|XP_010250039.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Nelumbo nucifera]
Length=1085

 Score =   133 bits (335),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 54/85 (64%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+ K  ++AGSH RNEFV+I  +       +K L+GQ+CQICGD V +T  G+ FVACNE
Sbjct  1    MEAKAGMVAGSHKRNEFVMIRNEGEAGPKPLKHLNGQVCQICGDTVGVTATGDVFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCRPCYEYERR+GNQ+CPQCK
Sbjct  61   CAFPVCRPCYEYERRDGNQSCPQCK  85



>emb|CAN73700.1| hypothetical protein VITISV_013112 [Vitis vinifera]
Length=1024

 Score =   133 bits (334),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      ++ L+GQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLRSLNGQVCEICGDEIGLTVDGEVFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCK  83



>ref|XP_008785840.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Phoenix dactylifera]
Length=1099

 Score =   133 bits (335),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEP-FVACN  321
            M T GRL+AGS NRNEFV+INAD+ GR  + ++ +GQICQICGD++EI  + +  FVACN
Sbjct  1    MATGGRLVAGSRNRNEFVVINADDFGRSKAAQDSNGQICQICGDDIEILEEEKELFVACN  60

Query  322  ECAFPVCRPCYEYERREGNQACPQCK  399
            ECAFPVCR CYEYERREG+QACPQCK
Sbjct  61   ECAFPVCRTCYEYERREGSQACPQCK  86



>ref|XP_002319002.2| cellulose synthase 6 family protein [Populus trichocarpa]
 gb|EEE94925.2| cellulose synthase 6 family protein [Populus trichocarpa]
Length=1104

 Score =   133 bits (335),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I  D      S++ +S QICQICGD+V +TVDGE FVACNE
Sbjct  1    MEVSAGLVAGSHNRNELVVIRRDGESAPRSLERVSRQICQICGDDVGLTVDGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFP+CR CYEYERREGNQ CPQCK
Sbjct  61   CAFPICRTCYEYERREGNQVCPQCK  85



>gb|KCW78813.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1012

 Score =   133 bits (334),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCK  83



>ref|NP_001289648.1| probable cellulose synthase A catalytic subunit 5 [Eucalyptus 
grandis]
 gb|AAY60848.1| cellulose synthase 6 [Eucalyptus grandis]
Length=1097

 Score =   133 bits (335),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLIN-ADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACN  321
            M+    L+AGSHNRNE V+I   +E+G+   +++LSGQICQICGD+V +TVDGE FVACN
Sbjct  1    MEVSSGLVAGSHNRNELVVIRRENELGQ-KPLQKLSGQICQICGDDVGLTVDGELFVACN  59

Query  322  ECAFPVCRPCYEYERREGNQACPQCK  399
            ECAFP+CR CYEYERREG+Q CPQCK
Sbjct  60   ECAFPICRTCYEYERREGSQICPQCK  85



>gb|KCW78814.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1040

 Score =   133 bits (334),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCK  83



>gb|KCW78812.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1040

 Score =   133 bits (334),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCK  83



>ref|NP_001289644.1| cellulose synthase A catalytic subunit 7 [Eucalyptus grandis]
 gb|AAY60845.1| cellulose synthase 3 [Eucalyptus grandis]
Length=1040

 Score =   133 bits (334),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCK  83



>gb|AGJ71354.1| cellulose synthase 3 [Eucalyptus urophylla]
Length=1040

 Score =   133 bits (334),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCK  83



>gb|AFR58756.2| cellulose synthase 3 [Eucalyptus tereticornis]
Length=1040

 Score =   133 bits (334),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCK  83



>gb|AEK31217.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1040

 Score =   133 bits (334),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCK  83



>gb|KCW78815.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1041

 Score =   133 bits (334),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCK  83



>gb|AGE09566.1| cellulose synthase-like protein [Eucalyptus cladocalyx]
Length=1041

 Score =   133 bits (334),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCK  83



>gb|KDP36709.1| hypothetical protein JCGZ_08000 [Jatropha curcas]
Length=1089

 Score =   133 bits (334),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I  D       +++LSGQIC ICGD+V +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGESAPKPLQQLSGQICHICGDDVGLTVDGELFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFP+CR CYEYERREG Q CPQCK
Sbjct  61   CAFPICRTCYEYERREGTQVCPQCK  85



>gb|KCW70400.1| hypothetical protein EUGRSUZ_F03635 [Eucalyptus grandis]
Length=1063

 Score =   133 bits (334),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLIN-ADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACN  321
            M+    L+AGSHNRNE V+I   +E+G+   +++LSGQICQICGD+V +TVDGE FVACN
Sbjct  1    MEVSSGLVAGSHNRNELVVIRRENELGQ-KPLQKLSGQICQICGDDVGLTVDGELFVACN  59

Query  322  ECAFPVCRPCYEYERREGNQACPQCK  399
            ECAFP+CR CYEYERREG+Q CPQCK
Sbjct  60   ECAFPICRTCYEYERREGSQICPQCK  85



>ref|XP_008794369.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Phoenix dactylifera]
Length=1049

 Score =   133 bits (334),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE VLI   E      +K L+GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLKALNGQVCEICGDEIGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCK  83



>gb|AFP93559.1| cellulose synthase A1 [Neolamarckia cadamba]
Length=1041

 Score =   133 bits (334),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      +K+L+GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKDLNGQVCEICGDEIGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCK  83



>ref|XP_010091161.1| OsCesA7 protein [Morus notabilis]
 gb|EXB42931.1| OsCesA7 protein [Morus notabilis]
Length=1042

 Score =   133 bits (334),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E     +++ L GQ+C+ICGD+V +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKTLRNLDGQVCEICGDQVGLTVDGELFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQNCPQCK  83



>gb|EPS60781.1| hypothetical protein M569_14019 [Genlisea aurea]
Length=1043

 Score =   133 bits (334),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E     +VK LSGQ+C+ICGD V +TV GE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKAVKNLSGQVCEICGDRVGVTVGGELFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCK  83



>ref|XP_006842872.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
 gb|ERN04547.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
Length=1083

 Score =   133 bits (334),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 55/86 (64%), Positives = 68/86 (79%), Gaps = 2/86 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINAD-EIGRVTSVKELSGQICQICGDEVEITVDGEPFVACN  321
            M+    ++AGSH RNEFV+I  + E+G    +K L+ Q+CQICGD V +T  GEPFVACN
Sbjct  1    MEANAGMVAGSHKRNEFVMIRHEGEVGP-KPIKNLNSQVCQICGDTVGLTASGEPFVACN  59

Query  322  ECAFPVCRPCYEYERREGNQACPQCK  399
            ECAFPVCRPCYEYER++GNQ+CPQCK
Sbjct  60   ECAFPVCRPCYEYERKDGNQSCPQCK  85



>ref|XP_010929171.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Elaeis guineensis]
Length=1048

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE VLI   E      +K L+GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLKALNGQVCEICGDEIGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCK  83



>gb|KHG11460.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=996

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQQCPQCK  83



>ref|XP_002276890.2| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Vitis vinifera]
 emb|CBI36551.3| unnamed protein product [Vitis vinifera]
Length=1037

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      ++ L+GQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLRSLNGQVCEICGDEIGLTVDGEVFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCK  83



>ref|XP_003598145.1| Cellulose synthase [Medicago truncatula]
 gb|AES68396.1| cellulose synthase-like protein [Medicago truncatula]
Length=1050

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+T   L+AGSHN+NEF++I  D     T ++EL G  CQ+CG+++ +  DG+PFVACNE
Sbjct  1    METNFGLVAGSHNKNEFIIIRQDGDYARTDLQELDGDTCQLCGEDIGVNADGDPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREGNQ CPQCK
Sbjct  61   CAFPVCRNCYEYERREGNQVCPQCK  85



>emb|CDP02834.1| unnamed protein product [Coffea canephora]
Length=1041

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      +K+L+GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKDLTGQVCEICGDEIGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCK  83



>ref|XP_010265522.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1034

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDEV IT +G+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKALDGQVCEICGDEVGITAEGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREGNQ CPQCK
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCK  83



>gb|KHG19749.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1057

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCK  83



>dbj|BAJ85783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AIY30130.1| cellulose synthase 8 [Hordeum vulgare]
Length=1055

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE VLI   E  +   V+ LSGQ+C+ICGDEV  TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVLIRGHEDHK--PVRALSGQVCEICGDEVGRTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCK  83



>gb|KJB53884.1| hypothetical protein B456_009G009700 [Gossypium raimondii]
Length=1039

 Score =   132 bits (332),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQQCPQCK  83



>gb|AFB18637.1| CESA8 [Gossypium hirsutum]
Length=1039

 Score =   132 bits (332),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG+Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGSQQCPQCK  83



>gb|AFB18636.1| CESA7 [Gossypium hirsutum]
 gb|AIE38017.1| cellulose synthase-7 [Gossypium hirsutum]
Length=1042

 Score =   132 bits (332),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCK  83



>gb|KJB07762.1| hypothetical protein B456_001G044700 [Gossypium raimondii]
Length=1043

 Score =   132 bits (332),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            C FPVCRPCYEYERREG Q CPQCK
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCK  83



>ref|NP_001051830.1| Os03g0837100 [Oryza sativa Japonica Group]
 sp|Q851L8.1|CESA5_ORYSJ RecName: Full=Probable cellulose synthase A catalytic subunit 
5 [UDP-forming]; AltName: Full=OsCesA5 [Oryza sativa Japonica 
Group]
 sp|A2XNT2.1|CESA5_ORYSI RecName: Full=Probable cellulose synthase A catalytic subunit 
5 [UDP-forming]; AltName: Full=OsCesA5 [Oryza sativa Indica 
Group]
 gb|AAO41140.1| cellulose synthase [Oryza sativa Japonica Group]
 gb|ABF99771.1| Cellulose synthase A catalytic subunit 6, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13744.1| Os03g0837100 [Oryza sativa Japonica Group]
 gb|EAY92492.1| hypothetical protein OsI_14229 [Oryza sativa Indica Group]
 gb|EAZ29219.1| hypothetical protein OsJ_13280 [Oryza sativa Japonica Group]
Length=1092

 Score =   132 bits (332),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  145  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  324
            M+    L+AGSHNRNE V+I  D       VK  +GQ+CQICGD+V +T DGEPFVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGEPGPKPVKHTNGQVCQICGDDVGLTPDGEPFVACNE  60

Query  325  CAFPVCRPCYEYERREGNQACPQCK  399
            CAFPVCR CYEYERREG Q CPQCK
Sbjct  61   CAFPVCRDCYEYERREGTQNCPQCK  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 568922768400